F456252

General Info

Members Datasets Scaffolds Average Seq Length
504 390 324 121

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0489788|Ga0495588_0489788_51_467
Length 138
Sequence MGGPAAWKTYCQTEEGTLMSLKIITLTAMLAIVAAPVLAEDKPMDMSKPMGNHDAASHAFNEANAKMHKDMMIEYSGDADADFVRGMIPHHQGAIDMAKVELANGKDPEIRKLAEGVIAAQEAEIKQMQDWLAAHPVK

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
7 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
8 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
9 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
12 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
13 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
14 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
15 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
16 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
17 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
18 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
19 2519899620 Rhizobium sp. Pop5 Isolate Nodule
20 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
21 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
22 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
23 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
24 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
25 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
26 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
27 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
28 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
29 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
30 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
31 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
32 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
33 2718217882 Rhizobium sp. N741 Isolate Nodule
34 2718217927 Rhizobium sp. N324 Isolate Nodule
35 2718218009 Rhizobium sp. N561 Isolate Nodule
36 2718218363 Rhizobium sp. N113 Isolate Nodule
37 2718218365 Rhizobium sp. N731 Isolate Nodule
38 2718218366 Rhizobium sp. N621 Isolate Nodule
39 2718218423 Rhizobium sp. N941 Isolate Nodule
40 2721755514 Rhizobium sp. N6212 Isolate Nodule
41 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
42 2721755809 Rhizobium sp. N541 Isolate Nodule
43 2721755810 Rhizobium sp. N871 Isolate Nodule
44 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
45 2728369365 Rhizobium sp. N1341 Isolate Nodule
46 2728369397 Rhizobium sp. N1314 Isolate Nodule
47 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
48 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
49 2791355261 Rhizobium sp. J15 Isolate Nodule
50 2791355262 Rhizobium sp. M1 Isolate Nodule
51 2791355264 Rhizobium sp. S9 Isolate Nodule
52 2791355267 Rhizobium sp. L18 Isolate Nodule
53 2802429633 Rhizobium anhuiense J3 Isolate Nodule
54 2802429634 Rhizobium anhuiense S10 Isolate Nodule
55 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
56 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
57 2802429637 Rhizobium anhuiense C15 Isolate Nodule
58 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
59 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
60 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
61 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
62 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
63 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
64 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
65 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
66 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
67 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
68 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
69 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
70 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
71 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
72 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
73 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
74 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
75 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
76 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
77 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
78 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
79 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
80 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
81 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
82 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
83 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
84 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
85 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
86 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
87 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
88 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
89 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
90 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
91 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
92 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
93 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
94 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
95 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
96 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
97 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
98 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
99 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
100 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
101 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
102 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
103 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
104 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
105 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
106 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
107 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
108 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
109 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
110 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
111 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
112 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
113 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
114 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
115 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
116 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
117 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
118 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
119 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
120 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
121 2932401849 Devosia sp. 2618 Isolate Rhizosphere
122 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
123 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
124 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
125 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
126 2936381700 Rhizobium chutanense C16 Isolate Unclassified
127 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
128 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
129 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
130 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
131 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
132 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
133 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
134 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
135 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
136 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
137 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
138 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
139 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
140 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
141 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
142 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
143 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
144 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
145 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
146 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
147 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
148 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
149 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
150 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
151 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
152 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
153 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
154 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
155 2996887358 Rhizobium sp. R711 Isolate Nodule
156 2996893221 Rhizobium sp. R635 Isolate Nodule
157 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
158 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
159 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
160 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
161 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
162 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
163 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
164 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
165 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
166 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
167 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
168 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
169 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
170 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
173 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
174 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
175 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
176 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
177 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
178 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
179 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
180 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
181 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
184 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
185 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
186 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
187 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
188 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
189 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
190 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
191 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
192 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
193 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
194 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
195 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
196 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
197 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
198 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
199 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
200 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
201 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
202 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
203 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
204 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
205 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
206 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
207 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
208 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
209 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
210 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
211 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
212 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
213 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
214 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
215 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
216 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
217 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
218 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
219 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
220 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
221 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
222 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
223 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
224 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
225 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
230 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
232 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
235 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
255 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
259 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
260 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
261 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
262 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
263 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
264 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
265 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
266 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
267 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
268 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
269 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
270 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
271 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
272 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
273 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
274 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
277 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
308 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
333 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
353 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
354 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
362 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
366 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
367 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
368 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
370 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
371 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
372 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
373 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
374 8005258706 Rhizobium sp. R693 Isolate Nodule
375 8005275841 Rhizobium sp. N4311 Isolate Nodule
376 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
377 8005321885 Rhizobium sp. R72 Isolate Nodule
378 8005382845 Rhizobium sp. R634 Isolate Nodule
379 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
380 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
381 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
382 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
383 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
384 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
385 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
386 8018176218 Rhizobium sp. N122 Isolate Nodule
387 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
388 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
389 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
390 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.49
Metatranscriptomes 0.79
Isolates 35.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.42
Nodule 30.95
Rhizoplane 3.97
Rhizosphere 25
Stem 0
Stem Tuber 0
Unclassified 17.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1065497 3300001915 Bacteria 538
2 JGI24740J21852_10005203 3300001979 Bacteria 5523
3 JGI25162J39368_1000788 3300002737 Bacteria 21288
4 JGI25152J39213_1002564 3300002773 Bacteria 6819
5 JGI25150J39212_1000042 3300002774 Bacteria 84513
6 JGI25151J46595_10000565 3300003187 Bacteria 33453
7 JGI25151J46595_10063649 3300003187 Bacteria 1159
8 JGI25151J46595_10074764 3300003187 Bacteria 1008
9 JGI25165J46597_1000415 3300003214 Bacteria 44714
10 JGI25153J46596_10005251 3300003215 Bacteria 6811
11 JGI25153J46596_10097637 3300003215 Bacteria 697
12 JGI25160J50197_1000046 3300003354 Bacteria 141352
13 JGI25160J50197_1008324 3300003354 Bacteria 3960
14 JGI25160J50197_1009725 3300003354 Bacteria 3538
15 JGI25161J50226_1000031 3300003374 Bacteria 141352
16 JGI25161J50226_1002065 3300003374 Bacteria 5453
17 Ga0006562J51391_1031567 3300003578 Bacteria 2970
18 Ga0055526_1004833 3300003771 Bacteria 7955
19 Ga0055526_1018263 3300003771 Bacteria 2626
20 Ga0055526_1029848 3300003771 Bacteria 1605
21 Ga0055524_1003205 3300003775 Bacteria 8026
22 Ga0055524_1017605 3300003775 Bacteria 2516
23 Ga0055528_1014436 3300003790 Bacteria 2922
24 Ga0055528_1038679 3300003790 Bacteria 1102
25 Ga0055530_10040087 3300003791 Bacteria 1152
26 Ga0055540_1000111 3300003792 Bacteria 88263
27 Ga0055540_1016199 3300003792 Bacteria 2133
28 Ga0055543_1003374 3300004625 Bacteria 4751
29 Ga0065165_1000693 3300005262 Bacteria 48076
30 Ga0065165_1036333 3300005262 Bacteria 1503
31 Ga0070658_10601649 3300005327 Bacteria 953
32 Ga0070691_10119996 3300005341 Bacteria 1323
33 Ga0070691_10988704 3300005341 Bacteria 524
34 Ga0070668_100075203 3300005347 Bacteria 2637
35 Ga0070669_100563220 3300005353 Bacteria 951
36 Ga0070671_100188140 3300005355 Bacteria 1749
37 Ga0070667_101991147 3300005367 Bacteria 547
38 Ga0070700_101706168 3300005441 Bacteria 540
39 Ga0070663_101190643 3300005455 Bacteria 669
40 Ga0070662_100334823 3300005457 Bacteria 1237
41 Ga0070685_10593479 3300005466 Bacteria 796
42 Ga0070665_100070373 3300005548 Bacteria 3505
43 Ga0070665_100769601 3300005548 Bacteria 976
44 Ga0068856_100122752 3300005614 Bacteria 2600
45 Ga0068859_101983226 3300005617 Bacteria 643
46 Ga0068862_100278888 3300005844 Bacteria 1531
47 Ga0075365_10009533 3300006038 Bacteria 5590
48 Ga0075365_10232085 3300006038 Bacteria 1295
49 Ga0075365_10422829 3300006038 Bacteria 941
50 Ga0075365_10478139 3300006038 Bacteria 880
51 Ga0075368_10035500 3300006042 Bacteria 1946
52 Ga0075368_10053025 3300006042 Bacteria 1614
53 Ga0075368_10210313 3300006042 Bacteria 825
54 Ga0075363_100126782 3300006048 Bacteria 1430
55 Ga0075363_100133088 3300006048 Bacteria 1396
56 Ga0075364_10374908 3300006051 Bacteria 970
57 Ga0075432_10491274 3300006058 Bacteria 545
58 Ga0075362_10004716 3300006177 Bacteria 4921
59 Ga0075367_10019652 3300006178 Bacteria 3749
60 Ga0075367_10063099 3300006178 Bacteria 2214
61 Ga0075367_10077154 3300006178 Bacteria 2011
62 Ga0075369_10002530 3300006186 Bacteria 6541
63 Ga0075366_10035395 3300006195 Bacteria 2943
64 Ga0075366_10783063 3300006195 Bacteria 593
65 Ga0075370_10023191 3300006353 Bacteria 3416
66 Ga0075370_10075928 3300006353 Bacteria 1927
67 Ga0068871_101933539 3300006358 Bacteria 561
68 Ga0068865_101757401 3300006881 Bacteria 560
69 Ga0097620_101983177 3300006931 Bacteria 643
70 Ga0105251_10069842 3300009011 Bacteria 1637
71 Ga0105244_10389782 3300009036 Bacteria 641
72 Ga0105240_11445932 3300009093 Bacteria 722
73 Ga0105245_11761960 3300009098 Bacteria 672
74 Ga0105247_11381415 3300009101 Bacteria 569
75 Ga0114129_10001489 3300009147 Bacteria 31706
76 Ga0105243_12476713 3300009148 Bacteria 558
77 Ga0105242_11246849 3300009176 Bacteria 765
78 Ga0105248_10005517 3300009177 Bacteria 13892
79 Ga0105249_10149760 3300009553 Bacteria 2245
80 Ga0123342_1014969 3300009766 Bacteria 7225
81 Ga0105239_11581552 3300010375 Bacteria 758
82 Ga0157371_10008023 3300013102 Bacteria 8454
83 Ga0157370_10717756 3300013104 Bacteria 912
84 Ga0157379_10427209 3300014968 Bacteria 1221
85 Ga0157376_10594599 3300014969 Bacteria 1101
86 Ga0209437_100036 3300025233 Bacteria 469153
87 Ga0207425_1000012 3300025245 Bacteria 528324
88 Ga0207425_1007985 3300025245 Bacteria 2745
89 Ga0209646_1011056 3300025246 Bacteria 1403
90 Ga0209129_1000086 3300025258 Bacteria 181543
91 Ga0209129_1000472 3300025258 Bacteria 29524
92 Ga0209129_1045314 3300025258 Bacteria 684
93 Ga0209233_1000166 3300025261 Bacteria 152270
94 Ga0209455_1024515 3300025272 Bacteria 1113
95 Ga0209673_1008627 3300025273 Bacteria 4517
96 Ga0209673_1017059 3300025273 Bacteria 2689
97 Ga0209130_1000312 3300025284 Bacteria 57303
98 Ga0209130_1053686 3300025284 Bacteria 723
99 Ga0209676_1028150 3300025292 Bacteria 1756
100 Ga0209676_1103450 3300025292 Bacteria 601
101 Ga0209025_1000024 3300025294 Bacteria 528324
102 Ga0209025_1000407 3300025294 Bacteria 87041
103 Ga0209025_1014042 3300025294 Bacteria 4973
104 Ga0209025_1033478 3300025294 Bacteria 2373
105 Ga0209564_1002399 3300025295 Bacteria 14953
106 Ga0209564_1005352 3300025295 Bacteria 7364
107 Ga0209564_1009840 3300025295 Bacteria 4486
108 Ga0209758_1000046 3300025297 Bacteria 364931
109 Ga0209758_1000336 3300025297 Bacteria 87439
110 Ga0209758_1008444 3300025297 Bacteria 6667
111 Ga0209758_1017685 3300025297 Bacteria 3532
112 Ga0209758_1158312 3300025297 Bacteria 566
113 Ga0209050_1004756 3300025298 Bacteria 8971
114 Ga0209256_1009845 3300025299 Bacteria 4112
115 Ga0209256_1010628 3300025299 Bacteria 3822
116 Ga0209256_1053637 3300025299 Bacteria 964
117 Ga0209256_1065023 3300025299 Bacteria 837
118 Ga0207426_1000012 3300025302 Bacteria 730942
119 Ga0207426_1000063 3300025302 Bacteria 358920
120 Ga0207426_1004140 3300025302 Bacteria 7272
121 Ga0209051_1000084 3300025303 Bacteria 190324
122 Ga0209051_1038123 3300025303 Bacteria 1753
123 Ga0209257_1085937 3300025304 Bacteria 796
124 Ga0207713_1056292 3300025735 Bacteria 1529
125 Ga0207705_10241675 3300025909 Bacteria 1375
126 Ga0207681_10717764 3300025923 Bacteria 832
127 Ga0207681_11727073 3300025923 Bacteria 523
128 Ga0207687_11216946 3300025927 Bacteria 647
129 Ga0207644_10307894 3300025931 Bacteria 1278
130 Ga0207706_10252551 3300025933 Bacteria 1540
131 Ga0207709_10512016 3300025935 Bacteria 938
132 Ga0207670_10681060 3300025936 Bacteria 850
133 Ga0207704_11081843 3300025938 Bacteria 681
134 Ga0207711_10199656 3300025941 Bacteria 1825
135 Ga0207712_10461632 3300025961 Bacteria 1079
136 Ga0207668_10052704 3300025972 Bacteria 2816
137 Ga0207678_10045153 3300026067 Bacteria 3810
138 Ga0207702_10094329 3300026078 Bacteria 2627
139 Ga0207683_10195836 3300026121 Bacteria 1836
140 Ga0209813_10016647 3300027866 Bacteria 2009
141 Ga0209813_10121747 3300027866 Bacteria 909
142 Ga0268266_10387147 3300028379 Bacteria 1320
143 Ga0268266_10590135 3300028379 Bacteria 1067
144 Ga0307515_10180451 3300028794 Bacteria 2063
145 Ga0307515_10661515 3300028794 Bacteria 658
146 Ga0307513_10232953 3300031456 Bacteria 1653
147 Ga0307413_10249613 3300031824 Bacteria 1316
148 Ga0307412_10001828 3300031911 Bacteria 11789
149 Ga0451787_188412 3300041441 Bacteria 1905
150 Ga0451787_690327 3300041441 Bacteria 506
151 Ga0451791_0258176 3300041451 Bacteria 882
152 Ga0451795_0120547 3300041456 Bacteria 1854
153 Ga0451798_0330937 3300041458 Bacteria 1164
154 Ga0451804_0502585 3300041463 Bacteria 809
155 Ga0451833_0664051 3300041491 Bacteria 889
156 Ga0451833_0676543 3300041491 Bacteria 1015
157 Ga0451835_0262066 3300041492 Bacteria 773
158 Ga0451835_1107060 3300041492 Bacteria 1143
159 Ga0451837_0910510 3300041494 Bacteria 1044
160 Ga0451837_1325476 3300041494 Bacteria 2164
161 Ga0451839_0493762 3300041496 Bacteria 936
162 Ga0451839_0666940 3300041496 Bacteria 1714
163 Ga0451839_1045664 3300041496 Bacteria 1695
164 Ga0451841_0435581 3300041498 Bacteria 1006
165 Ga0451841_0693720 3300041498 Bacteria 994
166 Ga0451845_0404306 3300041501 Bacteria 2691
167 Ga0451846_27480 3300041502 Bacteria 920
168 Ga0451847_0124849 3300041503 Bacteria 3817
169 Ga0451849_0382172 3300041505 Bacteria 1049
170 Ga0451849_1234730 3300041505 Bacteria 551
171 Ga0451851_0200564 3300041507 Bacteria 2267
172 Ga0451843_0716281 3300041509 Bacteria 1216
173 Ga0451855_0087596 3300041511 Bacteria 2334
174 Ga0451855_0112266 3300041511 Bacteria 3124
175 Ga0451855_0893854 3300041511 Bacteria 3696
176 Ga0451853_1769866 3300041512 Bacteria 925
177 Ga0452271_25868 3300041916 Bacteria 852
178 Ga0495617_033346 3300046452 Bacteria 1728
179 Ga0495638_0189123 3300046460 Bacteria 1169
180 Ga0495638_0220019 3300046460 Bacteria 1062
181 Ga0495605_0056738 3300046474 Bacteria 1888
182 Ga0495585_0023476 3300046492 Bacteria 3539
183 Ga0495585_0043884 3300046492 Bacteria 2499
184 Ga0495596_0169775 3300046500 Bacteria 848
185 Ga0495607_0068245 3300046501 Bacteria 1995
186 Ga0495607_0110691 3300046501 Bacteria 1456
187 Ga0495583_0209671 3300046506 Bacteria 790
188 Ga0495606_0228791 3300046507 Bacteria 1043
189 Ga0495606_0273737 3300046507 Bacteria 926
190 Ga0495610_0033892 3300046512 Bacteria 2634
191 Ga0495620_0040363 3300046515 Bacteria 2054
192 Ga0495631_0169520 3300046518 Bacteria 936
193 Ga0495643_0036604 3300046522 Bacteria 2695
194 Ga0495643_0252099 3300046522 Bacteria 823
195 Ga0495644_0250343 3300046523 Bacteria 688
196 Ga0495648_0426873 3300046524 Bacteria 586
197 Ga0495663_0209198 3300046525 Bacteria 683
198 Ga0495654_0438567 3300046530 Bacteria 515
199 Ga0495609_0043721 3300046538 Bacteria 2011
200 Ga0495597_0034648 3300046542 Bacteria 2281
201 Ga0495633_0033463 3300046558 Bacteria 2478
202 Ga0495656_0152765 3300046615 Bacteria 1116
203 Ga0495668_0194529 3300046616 Bacteria 1110
204 Ga0495668_0196240 3300046616 Bacteria 1105
205 Ga0495611_0127304 3300046648 Bacteria 1188
206 Ga0495625_0044036 3300046660 Bacteria 3233
207 Ga0495625_0071458 3300046660 Bacteria 2435
208 Ga0495625_0655830 3300046660 Bacteria 624
209 Ga0495588_0489788 3300046674 Bacteria 645
210 Ga0495670_0091791 3300046691 Bacteria 1555
211 Ga0495670_0162402 3300046691 Bacteria 1174
212 Ga0495671_0082971 3300046692 Bacteria 1571
213 Ga0495649_0139438 3300046694 Bacteria 1277
214 Ga0495589_0419795 3300046794 Bacteria 613
215 Ga0495660_0209159 3300046810 Bacteria 926
216 Ga0495687_018432 3300047443 Bacteria 3451
217 Ga0495679_032258 3300047446 Bacteria 1682
218 Ga0495685_117222 3300047447 Bacteria 875
219 Ga0495681_0292730 3300047470 Bacteria 632
220 Ga0495686_0110836 3300047472 Bacteria 1646
221 Ga0495615_0150860 3300048090 Bacteria 692
222 Ga0495626_0097742 3300048091 Bacteria 1283
223 Ga0496100_0624916 3300048903 Bacteria 838
224 Ga0496101_0203477 3300048904 Bacteria 1531
225 Ga0496102_0108776 3300048905 Bacteria 2582
226 Ga0496103_0054932 3300048906 Bacteria 2469
227 Ga0496104_0084421 3300048907 Bacteria 3030
228 Ga0496105_0082968 3300048908 Bacteria 2647
229 Ga0496108_1748442 3300048911 Bacteria 510
230 Ga0496109_0378032 3300048912 Bacteria 1338
231 Ga0496110_0139407 3300048913 Bacteria 2192
232 Ga0496111_0057124 3300048914 Bacteria 2825
233 Ga0496112_0454580 3300048915 Bacteria 1218
234 Ga0496113_0217783 3300048916 Bacteria 1521
235 Ga0496115_0685929 3300048918 Bacteria 807
236 Ga0496116_0020877 3300048919 Bacteria 4957
237 Ga0496116_0060576 3300048919 Bacteria 2454
238 Ga0496116_0110724 3300048919 Bacteria 1614
239 Ga0496117_0026928 3300048920 Bacteria 4489
240 Ga0496118_0068364 3300048921 Bacteria 2580
241 Ga0496118_0105684 3300048921 Bacteria 1886
242 Ga0496118_0269244 3300048921 Bacteria 956
243 Ga0496119_0039524 3300048922 Bacteria 3030
244 Ga0496120_0079677 3300048923 Bacteria 1777
245 Ga0496120_0094784 3300048923 Bacteria 1588
246 Ga0496121_0024057 3300048924 Bacteria 5836
247 Ga0496121_0028690 3300048924 Bacteria 5174
248 Ga0496121_0038602 3300048924 Bacteria 4223
249 Ga0496121_0081855 3300048924 Bacteria 2554
250 Ga0496121_0088860 3300048924 Bacteria 2421
251 Ga0496121_0104276 3300048924 Bacteria 2179
252 Ga0496121_0355269 3300048924 Bacteria 975
253 Ga0496122_0026230 3300048925 Bacteria 5032
254 Ga0496122_0027609 3300048925 Bacteria 4845
255 Ga0496122_0038819 3300048925 Bacteria 3806
256 Ga0496122_0057655 3300048925 Bacteria 2882
257 Ga0496122_0097831 3300048925 Bacteria 1973
258 Ga0496123_0005995 3300048926 Bacteria 11950
259 Ga0496123_0023274 3300048926 Bacteria 4745
260 Ga0496123_0025295 3300048926 Bacteria 4480
261 Ga0496123_0059454 3300048926 Bacteria 2471
262 Ga0496123_0197808 3300048926 Bacteria 1033
263 Ga0496123_0279103 3300048926 Bacteria 808
264 Ga0496124_0019949 3300048927 Bacteria 6216
265 Ga0496124_0045577 3300048927 Bacteria 3759
266 Ga0496124_0070903 3300048927 Bacteria 2889
267 Ga0496124_0075782 3300048927 Bacteria 2778
268 Ga0496124_0188554 3300048927 Bacteria 1580
269 Ga0496124_0268771 3300048927 Bacteria 1250
270 Ga0496124_0344724 3300048927 Bacteria 1056
271 Ga0496124_0683978 3300048927 Bacteria 653
272 Ga0496125_0000318 3300048928 Bacteria 93900
273 Ga0496125_0019563 3300048928 Bacteria 6380
274 Ga0496125_0115154 3300048928 Bacteria 1934
275 Ga0496125_0134631 3300048928 Bacteria 1731
276 Ga0496125_0161494 3300048928 Bacteria 1521
277 Ga0496126_0017025 3300048929 Bacteria 7252
278 Ga0496126_0077794 3300048929 Bacteria 2940
279 Ga0496126_0436298 3300048929 Bacteria 1056
280 Ga0501032_0176545 3300049569 Bacteria 1399
281 Ga0501033_0006502 3300049570 Bacteria 9144
282 Ga0501037_0192823 3300049573 Bacteria 1442
283 Ga0501047_0075431 3300049581 Bacteria 3245
284 Ga0501047_0462858 3300049581 Bacteria 1097
285 Ga0501067_0394433 3300049583 Bacteria 772
286 Ga0501070_0001675 3300049586 Bacteria 19651
287 Ga0501070_0084945 3300049586 Bacteria 2621
288 Ga0501071_0137206 3300049587 Bacteria 1821
289 Ga0501073_0066926 3300049589 Bacteria 2504
290 Ga0501074_0005211 3300049590 Bacteria 9347
291 Ga0501080_0007218 3300049742 Bacteria 10030
292 Ga0501035_0105693 3300049822 Bacteria 2468
293 Ga0501044_0035864 3300049823 Bacteria 5191
294 nmdc:mga03683_66602_c1 3300050489 Bacteria 1532
295 nmdc:mga03n38_625902_c1 3300050490 Bacteria 615
296 nmdc:mga03n38_85050_c1 3300050490 Bacteria 1495
297 nmdc:mga0yw44_117684_c1 3300050492 Bacteria 1709
298 nmdc:mga0yw44_596147_c1 3300050492 Bacteria 751
299 nmdc:mga0yw44_976391_c1 3300050492 Bacteria 574
300 nmdc:mga0k408_51941_c1 3300050493 Bacteria 2375
301 nmdc:mga0k408_524154_c1 3300050493 Bacteria 701
302 nmdc:mga06z11_264461_c1 3300050494 Bacteria 1016
303 nmdc:mga06z11_329147_c1 3300050494 Bacteria 912
304 nmdc:mga04h51_155413_c1 3300050495 Bacteria 877
305 nmdc:mga04h51_204948_c1 3300050495 Bacteria 776
306 nmdc:mga07m45_117972_c1 3300050496 Bacteria 1532
307 nmdc:mga07m45_210949_c1 3300050496 Bacteria 1130
308 nmdc:mga07m45_259921_c1 3300050496 Bacteria 1010
309 nmdc:mga07m45_585696_c1 3300050496 Bacteria 644
310 nmdc:mga05p37_11609_c1 3300050507 Bacteria 10497
311 nmdc:mga0sz30_28963_c1 3300050516 Bacteria 2280
312 Ga0495601_0482419 3300053077 Bacteria 801
313 Ga0500578_0164305 3300053086 Bacteria 1375
314 Ga0500578_0180636 3300053086 Bacteria 1300
315 Ga0500651_0464947 3300053093 Bacteria 702
316 Ga0500569_053447 3300053109 Bacteria 1225
317 Ga0500594_0086893 3300053118 Bacteria 944
318 Ga0500658_0000767 3300053134 Bacteria 13217
319 Ga0500616_0124928 3300053153 Bacteria 1223
320 Ga0500622_0047761 3300053156 Bacteria 2210
321 Ga0500622_0243980 3300053156 Bacteria 792
322 Ga0500627_0166745 3300053158 Bacteria 993
323 Ga0500611_075573 3300053727 Bacteria 830
324 Ga0587069_027885 3300059642 Bacteria 894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025304 Ga0209257_1085937 Ga0209257_10859372 101
2 iso_pu_bacteria 2932401849 2932404268 103
3 3300049587 Ga0501071_0137206 Ga0501071_0137206_463_843 104
4 iso_pu_bacteria 2529292951 2530647722 105
5 iso_pu_bacteria 2718217882 2719179649 106
6 iso_pu_bacteria 2718218009 2719730319 106
7 iso_pu_bacteria 2718218363 2721145742 106
8 iso_pu_bacteria 2718218366 2721162621 106
9 iso_pu_bacteria 2721755514 2722838791 106
10 iso_pu_bacteria 2721755810 2724043075 106
11 iso_pu_bacteria 2728369365 2730162886 106
12 iso_pu_bacteria 2842192696 2842192982 106
13 iso_pu_bacteria 2842395702 2842401249 106
14 iso_pu_bacteria 8005695170 8005700293 106
15 iso_pu_bacteria 2509276021 2509388338 107
16 iso_pu_bacteria 2510461076 2510897857 107
17 iso_pu_bacteria 2510917028 2511185617 107
18 iso_pu_bacteria 2513237085 2513579314 107
19 iso_pu_bacteria 2513237093 2513632234 107
20 iso_pu_bacteria 2513237103 2513713280 107
21 iso_pu_bacteria 2513237162 2514020937 107
22 iso_pu_bacteria 2515154113 2515636914 107
23 iso_pu_bacteria 2515154114 2515646781 107
24 iso_pu_bacteria 2515154116 2515659531 107
25 iso_pu_bacteria 2515154134 2515743004 107
26 iso_pu_bacteria 2516653077 2517039185 107
27 iso_pu_bacteria 2516653085 2517079431 107
28 iso_pu_bacteria 2517093000 2517093375 107
29 iso_pu_bacteria 2517287029 2517409601 107
30 iso_pu_bacteria 2519899620 2520380018 107
31 iso_pu_bacteria 2534681796 2535515165 107
32 iso_pu_bacteria 2582581294 2585203743 107
33 iso_pu_bacteria 2585427526 2585528388 107
34 iso_pu_bacteria 2585427528 2585539779 107
35 iso_pu_bacteria 2585427593 2585837762 107
36 iso_pu_bacteria 2643221634 2644190670 107
37 iso_pu_bacteria 2643221643 2644241471 107
38 iso_pu_bacteria 2718217927 2719384261 107
39 iso_pu_bacteria 2718218365 2721157274 107
40 iso_pu_bacteria 2718218423 2721397975 107
41 iso_pu_bacteria 2721755809 2724036785 107
42 iso_pu_bacteria 2724679232 2725950165 107
43 iso_pu_bacteria 2728369397 2730296906 107
44 iso_pu_bacteria 2738541333 2739034638 107
45 iso_pu_bacteria 2765235942 2766065617 107
46 iso_pu_bacteria 2791355261 2793326071 107
47 iso_pu_bacteria 2791355262 2793332511 107
48 iso_pu_bacteria 2791355264 2793351044 107
49 iso_pu_bacteria 2791355267 2793364758 107
50 iso_pu_bacteria 2802429633 2806043935 107
51 iso_pu_bacteria 2802429634 2806052247 107
52 iso_pu_bacteria 2802429635 2806058548 107
53 iso_pu_bacteria 2802429636 2806067044 107
54 iso_pu_bacteria 2802429637 2806074789 107
55 iso_pu_bacteria 2838022645 2838024565 107
56 iso_pu_bacteria 2838042994 2838044336 107
57 iso_pu_bacteria 2838680041 2838680676 107
58 iso_pu_bacteria 2838686498 2838692665 107
59 iso_pu_bacteria 2838694306 2838695291 107
60 iso_pu_bacteria 2838707686 2838708667 107
61 iso_pu_bacteria 2838729681 2838732737 107
62 iso_pu_bacteria 2838742623 2838745632 107
63 iso_pu_bacteria 2841851746 2841855276 107
64 iso_pu_bacteria 2842077413 2842080098 107
65 iso_pu_bacteria 2842110456 2842112290 107
66 iso_pu_bacteria 2842118031 2842120718 107
67 iso_pu_bacteria 2842156927 2842161694 107
68 iso_pu_bacteria 2842163707 2842170097 107
69 iso_pu_bacteria 2842180545 2842185311 107
70 iso_pu_bacteria 2842198810 2842200330 107
71 iso_pu_bacteria 2842217011 2842218709 107
72 iso_pu_bacteria 2842229732 2842233249 107
73 iso_pu_bacteria 2842237096 2842238079 107
74 iso_pu_bacteria 2842243621 2842248747 107
75 iso_pu_bacteria 2842257432 2842261890 107
76 iso_pu_bacteria 2842271015 2842277046 107
77 iso_pu_bacteria 2842285085 2842289405 107
78 iso_pu_bacteria 2842291075 2842293758 107
79 iso_pu_bacteria 2842304105 2842306399 107
80 iso_pu_bacteria 2842370503 2842371139 107
81 iso_pu_bacteria 2842377471 2842380155 107
82 iso_pu_bacteria 2842384541 2842387226 107
83 iso_pu_bacteria 2842402390 2842406753 107
84 iso_pu_bacteria 2842409023 2842413751 107
85 iso_pu_bacteria 2842415677 2842420287 107
86 iso_pu_bacteria 2844454524 2844455891 107
87 iso_pu_bacteria 2857516855 2857522173 107
88 iso_pu_bacteria 2933570622 2933573468 107
89 iso_pu_bacteria 2933586486 2933587619 107
90 iso_pu_bacteria 2935894831 2935895814 107
91 iso_pu_bacteria 2935901341 2935907736 107
92 iso_pu_bacteria 2936381700 2936388336 107
93 iso_pu_bacteria 2996887358 2996892110 107
94 iso_pu_bacteria 2996893221 2996893537 107
95 iso_pu_bacteria 8005258706 8005263563 107
96 iso_pu_bacteria 8005275841 8005278975 107
97 iso_pu_bacteria 8005307578 8005308749 107
98 iso_pu_bacteria 8005321885 8005326637 107
99 iso_pu_bacteria 8005382845 8005387210 107
100 iso_pu_bacteria 8005430974 8005433013 107
101 iso_pu_bacteria 8005542996 8005543841 107
102 iso_pu_bacteria 8005556819 8005560723 107
103 iso_pu_bacteria 8005563573 8005569705 107
104 iso_pu_bacteria 8005570704 8005577014 107
105 iso_pu_bacteria 8018163183 8018167807 107
106 iso_pu_bacteria 8018176218 8018180232 107
107 iso_pu_bacteria 8023680758 8023684129 107
108 iso_pu_bacteria 8024479707 8024480380 107
109 iso_pu_bacteria 8056375014 8056375715 107
110 3300005341 Ga0070691_10988704 Ga0070691_109887041 108
111 3300005441 Ga0070700_101706168 Ga0070700_1017061681 108
112 3300009101 Ga0105247_11381415 Ga0105247_113814151 108
113 3300013104 Ga0157370_10717756 Ga0157370_107177562 108
114 3300014968 Ga0157379_10427209 Ga0157379_104272093 108
115 3300025297 Ga0209758_1158312 Ga0209758_11583121 108
116 3300025299 Ga0209256_1065023 Ga0209256_10650231 108
117 3300025936 Ga0207670_10681060 Ga0207670_106810602 108
118 3300028379 Ga0268266_10590135 Ga0268266_105901352 108
119 3300048090 Ga0495615_0150860 Ga0495615_0150860_251_661 108
120 3300048924 Ga0496121_0081855 Ga0496121_0081855_2147_2485 108
121 3300048924 Ga0496121_0104276 Ga0496121_0104276_1298_1648 108
122 3300048925 Ga0496122_0057655 Ga0496122_0057655_617_967 108
123 3300048926 Ga0496123_0279103 Ga0496123_0279103_127_465 108
124 3300048927 Ga0496124_0188554 Ga0496124_0188554_253_603 108
125 3300048929 Ga0496126_0436298 Ga0496126_0436298_146_496 108
126 3300050496 nmdc:mga07m45_585696_c1 nmdc:mga07m45_585696_c1_233_571 108
127 3300053727 Ga0500611_075573 Ga0500611_075573_359_724 108
128 3300003187 JGI25151J46595_10063649 JGI25151J46595_100636492 109
129 3300003187 JGI25151J46595_10074764 JGI25151J46595_100747642 109
130 3300003215 JGI25153J46596_10097637 JGI25153J46596_100976372 109
131 3300003354 JGI25160J50197_1008324 JGI25160J50197_10083244 109
132 3300003354 JGI25160J50197_1009725 JGI25160J50197_10097251 109
133 3300003374 JGI25161J50226_1002065 JGI25161J50226_10020658 109
134 3300003771 Ga0055526_1004833 Ga0055526_10048339 109
135 3300003771 Ga0055526_1018263 Ga0055526_10182632 109
136 3300003771 Ga0055526_1029848 Ga0055526_10298482 109
137 3300003775 Ga0055524_1003205 Ga0055524_100320510 109
138 3300003775 Ga0055524_1017605 Ga0055524_10176052 109
139 3300003790 Ga0055528_1014436 Ga0055528_10144361 109
140 3300003791 Ga0055530_10040087 Ga0055530_100400872 109
141 3300003792 Ga0055540_1000111 Ga0055540_100011183 109
142 3300003792 Ga0055540_1016199 Ga0055540_10161992 109
143 3300004625 Ga0055543_1003374 Ga0055543_10033743 109
144 3300005262 Ga0065165_1036333 Ga0065165_10363332 109
145 3300005347 Ga0070668_100075203 Ga0070668_1000752034 109
146 3300005353 Ga0070669_100563220 Ga0070669_1005632202 109
147 3300005355 Ga0070671_100188140 Ga0070671_1001881403 109
148 3300005367 Ga0070667_101991147 Ga0070667_1019911471 109
149 3300005457 Ga0070662_100334823 Ga0070662_1003348233 109
150 3300005466 Ga0070685_10593479 Ga0070685_105934792 109
151 3300005844 Ga0068862_100278888 Ga0068862_1002788882 109
152 3300006038 Ga0075365_10009533 Ga0075365_100095334 109
153 3300006038 Ga0075365_10232085 Ga0075365_102320852 109
154 3300006038 Ga0075365_10478139 Ga0075365_104781392 109
155 3300006042 Ga0075368_10035500 Ga0075368_100355002 109
156 3300006042 Ga0075368_10053025 Ga0075368_100530252 109
157 3300006048 Ga0075363_100133088 Ga0075363_1001330883 109
158 3300006058 Ga0075432_10491274 Ga0075432_104912741 109
159 3300006177 Ga0075362_10004716 Ga0075362_100047162 109
160 3300006178 Ga0075367_10019652 Ga0075367_100196525 109
161 3300006178 Ga0075367_10063099 Ga0075367_100630994 109
162 3300006178 Ga0075367_10077154 Ga0075367_100771542 109
163 3300006186 Ga0075369_10002530 Ga0075369_100025305 109
164 3300006195 Ga0075366_10035395 Ga0075366_100353955 109
165 3300006195 Ga0075366_10783063 Ga0075366_107830631 109
166 3300006353 Ga0075370_10023191 Ga0075370_100231914 109
167 3300006353 Ga0075370_10075928 Ga0075370_100759283 109
168 3300009011 Ga0105251_10069842 Ga0105251_100698422 109
169 3300009036 Ga0105244_10389782 Ga0105244_103897822 109
170 3300009148 Ga0105243_12476713 Ga0105243_124767131 109
171 3300009177 Ga0105248_10005517 Ga0105248_1000551710 109
172 3300009553 Ga0105249_10149760 Ga0105249_101497604 109
173 3300009766 Ga0123342_1014969 Ga0123342_10149698 109
174 3300025245 Ga0207425_1007985 Ga0207425_10079852 109
175 3300025258 Ga0209129_1000472 Ga0209129_10004728 109
176 3300025258 Ga0209129_1045314 Ga0209129_10453142 109
177 3300025273 Ga0209673_1017059 Ga0209673_10170591 109
178 3300025284 Ga0209130_1053686 Ga0209130_10536862 109
179 3300025292 Ga0209676_1028150 Ga0209676_10281501 109
180 3300025292 Ga0209676_1103450 Ga0209676_11034502 109
181 3300025294 Ga0209025_1000407 Ga0209025_100040711 109
182 3300025294 Ga0209025_1014042 Ga0209025_10140425 109
183 3300025294 Ga0209025_1033478 Ga0209025_10334783 109
184 3300025295 Ga0209564_1002399 Ga0209564_100239910 109
185 3300025295 Ga0209564_1005352 Ga0209564_10053522 109
186 3300025295 Ga0209564_1009840 Ga0209564_10098404 109
187 3300025297 Ga0209758_1000336 Ga0209758_100033677 109
188 3300025297 Ga0209758_1008444 Ga0209758_10084448 109
189 3300025297 Ga0209758_1017685 Ga0209758_10176851 109
190 3300025298 Ga0209050_1004756 Ga0209050_10047567 109
191 3300025299 Ga0209256_1009845 Ga0209256_10098456 109
192 3300025299 Ga0209256_1010628 Ga0209256_10106282 109
193 3300025302 Ga0207426_1000063 Ga0207426_1000063130 109
194 3300025302 Ga0207426_1004140 Ga0207426_10041407 109
195 3300025303 Ga0209051_1000084 Ga0209051_100008453 109
196 3300025303 Ga0209051_1038123 Ga0209051_10381233 109
197 3300025735 Ga0207713_1056292 Ga0207713_10562922 109
198 3300025923 Ga0207681_10717764 Ga0207681_107177642 109
199 3300025931 Ga0207644_10307894 Ga0207644_103078942 109
200 3300025933 Ga0207706_10252551 Ga0207706_102525513 109
201 3300025941 Ga0207711_10199656 Ga0207711_101996563 109
202 3300025961 Ga0207712_10461632 Ga0207712_104616323 109
203 3300025972 Ga0207668_10052704 Ga0207668_100527044 109
204 3300026067 Ga0207678_10045153 Ga0207678_100451532 109
205 3300027866 Ga0209813_10016647 Ga0209813_100166471 109
206 3300027866 Ga0209813_10121747 Ga0209813_101217471 109
207 3300028794 Ga0307515_10180451 Ga0307515_101804513 109
208 3300031456 Ga0307513_10232953 Ga0307513_102329533 109
209 3300041441 Ga0451787_188412 Ga0451787_188412_1364_1777 109
210 3300041451 Ga0451791_0258176 Ga0451791_0258176_419_778 109
211 3300041456 Ga0451795_0120547 Ga0451795_0120547_546_959 109
212 3300041458 Ga0451798_0330937 Ga0451798_0330937_588_1001 109
213 3300041463 Ga0451804_0502585 Ga0451804_0502585_32_445 109
214 3300041491 Ga0451833_0664051 Ga0451833_0664051_139_552 109
215 3300041491 Ga0451833_0676543 Ga0451833_0676543_39_398 109
216 3300041492 Ga0451835_0262066 Ga0451835_0262066_160_573 109
217 3300041492 Ga0451835_1107060 Ga0451835_1107060_95_454 109
218 3300041494 Ga0451837_0910510 Ga0451837_0910510_31_390 109
219 3300041494 Ga0451837_1325476 Ga0451837_1325476_1460_1819 109
220 3300041496 Ga0451839_0493762 Ga0451839_0493762_385_798 109
221 3300041496 Ga0451839_0666940 Ga0451839_0666940_167_526 109
222 3300041496 Ga0451839_1045664 Ga0451839_1045664_1272_1685 109
223 3300041498 Ga0451841_0435581 Ga0451841_0435581_481_840 109
224 3300041498 Ga0451841_0693720 Ga0451841_0693720_385_798 109
225 3300041501 Ga0451845_0404306 Ga0451845_0404306_1902_2315 109
226 3300041502 Ga0451846_27480 Ga0451846_27480_39_398 109
227 3300041503 Ga0451847_0124849 Ga0451847_0124849_2201_2560 109
228 3300041505 Ga0451849_0382172 Ga0451849_0382172_631_990 109
229 3300041505 Ga0451849_1234730 Ga0451849_1234730_72_431 109
230 3300041507 Ga0451851_0200564 Ga0451851_0200564_425_838 109
231 3300041509 Ga0451843_0716281 Ga0451843_0716281_428_787 109
232 3300041511 Ga0451855_0087596 Ga0451855_0087596_1324_1737 109
233 3300041511 Ga0451855_0112266 Ga0451855_0112266_2741_3100 109
234 3300041511 Ga0451855_0893854 Ga0451855_0893854_1359_1718 109
235 3300041512 Ga0451853_1769866 Ga0451853_1769866_428_787 109
236 3300041916 Ga0452271_25868 Ga0452271_25868_345_704 109
237 3300046452 Ga0495617_033346 Ga0495617_033346_372_731 109
238 3300046460 Ga0495638_0189123 Ga0495638_0189123_765_1124 109
239 3300046474 Ga0495605_0056738 Ga0495605_0056738_644_1003 109
240 3300046492 Ga0495585_0023476 Ga0495585_0023476_1621_1980 109
241 3300046492 Ga0495585_0043884 Ga0495585_0043884_1030_1443 109
242 3300046501 Ga0495607_0068245 Ga0495607_0068245_1328_1687 109
243 3300046501 Ga0495607_0110691 Ga0495607_0110691_536_895 109
244 3300046506 Ga0495583_0209671 Ga0495583_0209671_57_416 109
245 3300046507 Ga0495606_0228791 Ga0495606_0228791_544_903 109
246 3300046507 Ga0495606_0273737 Ga0495606_0273737_384_743 109
247 3300046512 Ga0495610_0033892 Ga0495610_0033892_96_455 109
248 3300046515 Ga0495620_0040363 Ga0495620_0040363_1548_1907 109
249 3300046518 Ga0495631_0169520 Ga0495631_0169520_439_798 109
250 3300046522 Ga0495643_0036604 Ga0495643_0036604_40_399 109
251 3300046523 Ga0495644_0250343 Ga0495644_0250343_306_665 109
252 3300046524 Ga0495648_0426873 Ga0495648_0426873_146_505 109
253 3300046525 Ga0495663_0209198 Ga0495663_0209198_104_463 109
254 3300046530 Ga0495654_0438567 Ga0495654_0438567_101_460 109
255 3300046538 Ga0495609_0043721 Ga0495609_0043721_65_478 109
256 3300046542 Ga0495597_0034648 Ga0495597_0034648_1482_1841 109
257 3300046558 Ga0495633_0033463 Ga0495633_0033463_1292_1705 109
258 3300046615 Ga0495656_0152765 Ga0495656_0152765_316_675 109
259 3300046616 Ga0495668_0194529 Ga0495668_0194529_451_810 109
260 3300046616 Ga0495668_0196240 Ga0495668_0196240_312_671 109
261 3300046648 Ga0495611_0127304 Ga0495611_0127304_119_478 109
262 3300046660 Ga0495625_0044036 Ga0495625_0044036_42_401 109
263 3300046660 Ga0495625_0071458 Ga0495625_0071458_1412_1771 109
264 3300046660 Ga0495625_0655830 Ga0495625_0655830_255_614 109
265 3300046674 Ga0495588_0489788 Ga0495588_0489788_51_467 109
266 3300046691 Ga0495670_0091791 Ga0495670_0091791_756_1115 109
267 3300046691 Ga0495670_0162402 Ga0495670_0162402_600_959 109
268 3300046692 Ga0495671_0082971 Ga0495671_0082971_522_881 109
269 3300046694 Ga0495649_0139438 Ga0495649_0139438_569_928 109
270 3300046794 Ga0495589_0419795 Ga0495589_0419795_138_497 109
271 3300046810 Ga0495660_0209159 Ga0495660_0209159_29_388 109
272 3300047443 Ga0495687_018432 Ga0495687_018432_305_664 109
273 3300047446 Ga0495679_032258 Ga0495679_032258_18_377 109
274 3300047447 Ga0495685_117222 Ga0495685_117222_35_394 109
275 3300047470 Ga0495681_0292730 Ga0495681_0292730_109_468 109
276 3300047472 Ga0495686_0110836 Ga0495686_0110836_1123_1482 109
277 3300048091 Ga0495626_0097742 Ga0495626_0097742_176_535 109
278 3300048904 Ga0496101_0203477 Ga0496101_0203477_206_565 109
279 3300048905 Ga0496102_0108776 Ga0496102_0108776_1482_1841 109
280 3300048906 Ga0496103_0054932 Ga0496103_0054932_1138_1497 109
281 3300048907 Ga0496104_0084421 Ga0496104_0084421_1146_1505 109
282 3300048908 Ga0496105_0082968 Ga0496105_0082968_939_1298 109
283 3300048911 Ga0496108_1748442 Ga0496108_1748442_132_491 109
284 3300048912 Ga0496109_0378032 Ga0496109_0378032_722_1081 109
285 3300048913 Ga0496110_0139407 Ga0496110_0139407_426_785 109
286 3300048914 Ga0496111_0057124 Ga0496111_0057124_1171_1530 109
287 3300048915 Ga0496112_0454580 Ga0496112_0454580_676_1035 109
288 3300048916 Ga0496113_0217783 Ga0496113_0217783_967_1326 109
289 3300048919 Ga0496116_0060576 Ga0496116_0060576_814_1173 109
290 3300048921 Ga0496118_0269244 Ga0496118_0269244_447_806 109
291 3300048922 Ga0496119_0039524 Ga0496119_0039524_1489_1848 109
292 3300048923 Ga0496120_0094784 Ga0496120_0094784_754_1113 109
293 3300048924 Ga0496121_0088860 Ga0496121_0088860_814_1173 109
294 3300048924 Ga0496121_0355269 Ga0496121_0355269_106_456 109
295 3300048925 Ga0496122_0097831 Ga0496122_0097831_1215_1574 109
296 3300048926 Ga0496123_0059454 Ga0496123_0059454_922_1281 109
297 3300048927 Ga0496124_0070903 Ga0496124_0070903_1173_1532 109
298 3300048927 Ga0496124_0344724 Ga0496124_0344724_539_889 109
299 3300048927 Ga0496124_0683978 Ga0496124_0683978_286_636 109
300 3300048928 Ga0496125_0000318 Ga0496125_0000318_19328_19678 109
301 3300048928 Ga0496125_0115154 Ga0496125_0115154_193_552 109
302 3300048929 Ga0496126_0077794 Ga0496126_0077794_1232_1591 109
303 3300050489 nmdc:mga03683_66602_c1 nmdc:mga03683_66602_c1_565_924 109
304 3300050490 nmdc:mga03n38_625902_c1 nmdc:mga03n38_625902_c1_219_578 109
305 3300050492 nmdc:mga0yw44_596147_c1 nmdc:mga0yw44_596147_c1_235_594 109
306 3300050492 nmdc:mga0yw44_976391_c1 nmdc:mga0yw44_976391_c1_32_391 109
307 3300050493 nmdc:mga0k408_51941_c1 nmdc:mga0k408_51941_c1_1103_1462 109
308 3300050493 nmdc:mga0k408_524154_c1 nmdc:mga0k408_524154_c1_98_457 109
309 3300050494 nmdc:mga06z11_264461_c1 nmdc:mga06z11_264461_c1_608_967 109
310 3300050495 nmdc:mga04h51_155413_c1 nmdc:mga04h51_155413_c1_485_844 109
311 3300050495 nmdc:mga04h51_204948_c1 nmdc:mga04h51_204948_c1_143_502 109
312 3300050496 nmdc:mga07m45_210949_c1 nmdc:mga07m45_210949_c1_700_1059 109
313 3300050496 nmdc:mga07m45_259921_c1 nmdc:mga07m45_259921_c1_509_868 109
314 3300050516 nmdc:mga0sz30_28963_c1 nmdc:mga0sz30_28963_c1_1604_1963 109
315 3300053086 Ga0500578_0164305 Ga0500578_0164305_280_639 109
316 3300053086 Ga0500578_0180636 Ga0500578_0180636_79_438 109
317 3300053093 Ga0500651_0464947 Ga0500651_0464947_83_442 109
318 3300053109 Ga0500569_053447 Ga0500569_053447_567_926 109
319 3300053118 Ga0500594_0086893 Ga0500594_0086893_25_384 109
320 3300053134 Ga0500658_0000767 Ga0500658_0000767_1215_1574 109
321 3300053153 Ga0500616_0124928 Ga0500616_0124928_738_1097 109
322 3300053156 Ga0500622_0047761 Ga0500622_0047761_738_1091 109
323 3300053156 Ga0500622_0243980 Ga0500622_0243980_86_445 109
324 3300053158 Ga0500627_0166745 Ga0500627_0166745_608_967 109
325 3300059642 Ga0587069_027885 Ga0587069_027885_168_527 109
326 iso_pu_bacteria 639633055 639646756 109
327 3300046500 Ga0495596_0169775 Ga0495596_0169775_408_788 110
328 3300046522 Ga0495643_0252099 Ga0495643_0252099_242_622 110
329 iso_pu_bacteria 2524023209 2524457587 110
330 iso_pu_bacteria 2643221551 2643777349 110
331 iso_pu_bacteria 2643221555 2643795797 110
332 iso_pu_bacteria 2667528174 2671112439 110
333 iso_pu_bacteria 2842298080 2842300799 110
334 iso_pu_bacteria 2842357229 2842358082 110
335 iso_pu_bacteria 2852387548 2852388568 110
336 iso_pu_bacteria 2869162929 2869168630 110
337 3300001979 JGI24740J21852_10005203 JGI24740J21852_100052032 111
338 3300002737 JGI25162J39368_1000788 JGI25162J39368_100078815 111
339 3300003214 JGI25165J46597_1000415 JGI25165J46597_100041536 111
340 3300003354 JGI25160J50197_1000046 JGI25160J50197_100004634 111
341 3300003374 JGI25161J50226_1000031 JGI25161J50226_100003134 111
342 3300005262 Ga0065165_1000693 Ga0065165_100069335 111
343 3300005614 Ga0068856_100122752 Ga0068856_1001227524 111
344 3300025233 Ga0209437_100036 Ga0209437_100036101 111
345 3300025246 Ga0209646_1011056 Ga0209646_10110562 111
346 3300025261 Ga0209233_1000166 Ga0209233_1000166101 111
347 3300025272 Ga0209455_1024515 Ga0209455_10245151 111
348 3300025284 Ga0209130_1000312 Ga0209130_100031235 111
349 3300025302 Ga0207426_1000012 Ga0207426_100001235 111
350 3300026078 Ga0207702_10094329 Ga0207702_100943292 111
351 3300048923 Ga0496120_0079677 Ga0496120_0079677_941_1309 111
352 3300048924 Ga0496121_0038602 Ga0496121_0038602_1116_1628 111
353 3300048925 Ga0496122_0026230 Ga0496122_0026230_3216_3584 111
354 3300048926 Ga0496123_0197808 Ga0496123_0197808_636_1004 111
355 3300048927 Ga0496124_0268771 Ga0496124_0268771_374_742 111
356 3300048928 Ga0496125_0161494 Ga0496125_0161494_518_886 111
357 iso_pu_bacteria 2508501123 2509114559 111
358 iso_pu_bacteria 2509276022 2509393114 111
359 iso_pu_bacteria 2513237305 2514423456 111
360 iso_pu_bacteria 2721755686 2723572712 111
361 iso_pu_bacteria 2841734538 2841735964 111
362 iso_pu_bacteria 2856320880 2856321819 111
363 iso_pu_bacteria 2856356410 2856363867 111
364 iso_pu_bacteria 2869278585 2869279995 111
365 iso_pu_bacteria 2871474448 2871479602 111
366 iso_pu_bacteria 2871488783 2871490938 111
367 iso_pu_bacteria 2874102143 2874103706 111
368 iso_pu_bacteria 2874123672 2874131317 111
369 iso_pu_bacteria 2874139085 2874145831 111
370 iso_pu_bacteria 2878738818 2878740479 111
371 iso_pu_bacteria 2878753008 2878755342 111
372 iso_pu_bacteria 2881845957 2881849865 111
373 iso_pu_bacteria 2881861095 2881862163 111
374 iso_pu_bacteria 2882632389 2882634936 111
375 iso_pu_bacteria 2882912400 2882916077 111
376 iso_pu_bacteria 2885312484 2885314576 111
377 iso_pu_bacteria 2885318864 2885325603 111
378 iso_pu_bacteria 2888337043 2888342855 111
379 iso_pu_bacteria 2903492973 2903499177 111
380 iso_pu_bacteria 2906328253 2906334416 111
381 iso_pu_bacteria 2924718760 2924723154 111
382 iso_pu_bacteria 2924776078 2924778080 111
383 iso_pu_bacteria 2924784321 2924791675 111
384 iso_pu_bacteria 2937822353 2937826127 111
385 iso_pu_bacteria 2937836603 2937836803 111
386 iso_pu_bacteria 2937877337 2937877873 111
387 iso_pu_bacteria 2937891427 2937897388 111
388 iso_pu_bacteria 2937972304 2937973866 111
389 iso_pu_bacteria 2958034702 2958035861 111
390 iso_pu_bacteria 2958041894 2958045167 111
391 iso_pu_bacteria 2958064165 2958068161 111
392 iso_pu_bacteria 2958071322 2958076170 111
393 iso_pu_bacteria 2958084443 2958084983 111
394 iso_pu_bacteria 2958092219 2958099014 111
395 iso_pu_bacteria 2958115193 2958119545 111
396 iso_pu_bacteria 2958144490 2958144953 111
397 iso_pu_bacteria 2961170736 2961172345 111
398 iso_pu_bacteria 2967996073 2968001276 111
399 iso_pu_bacteria 2968003550 2968007329 111
400 iso_pu_bacteria 2968016561 2968016949 111
401 iso_pu_bacteria 2968091066 2968093972 111
402 iso_pu_bacteria 2968097103 2968100561 111
403 iso_pu_bacteria 2970469710 2970470106 111
404 iso_pu_bacteria 2970503327 2970504940 111
405 iso_pu_bacteria 2970593180 2970594592 111
406 iso_pu_bacteria 2977821940 2977824482 111
407 iso_pu_bacteria 2977828996 2977836349 111
408 iso_pu_bacteria 2977858184 2977864239 111
409 iso_pu_bacteria 2979779861 2979782911 111
410 iso_pu_bacteria 2979808191 2979809578 111
411 iso_pu_bacteria 2996348954 2996349105 111
412 iso_pu_bacteria 3004275668 3004275817 111
413 iso_pu_bacteria 3004289098 3004296110 111
414 iso_pu_bacteria 8004374579 8004376922 111
415 iso_pu_bacteria 8004445564 8004450459 111
416 iso_pu_bacteria 8004633249 8004633495 111
417 iso_pu_bacteria 8004703790 8004707130 111
418 iso_pu_bacteria 8055617313 8055617457 111
419 3300002773 JGI25152J39213_1002564 JGI25152J39213_10025649 112
420 3300002774 JGI25150J39212_1000042 JGI25150J39212_100004289 112
421 3300003187 JGI25151J46595_10000565 JGI25151J46595_1000056525 112
422 3300003215 JGI25153J46596_10005251 JGI25153J46596_100052515 112
423 3300003578 Ga0006562J51391_1031567 Ga0006562J51391_10315676 112
424 3300003790 Ga0055528_1038679 Ga0055528_10386792 112
425 3300005548 Ga0070665_100070373 Ga0070665_1000703732 112
426 3300005548 Ga0070665_100769601 Ga0070665_1007696012 112
427 3300005617 Ga0068859_101983226 Ga0068859_1019832261 112
428 3300006038 Ga0075365_10422829 Ga0075365_104228292 112
429 3300006042 Ga0075368_10210313 Ga0075368_102103132 112
430 3300006048 Ga0075363_100126782 Ga0075363_1001267822 112
431 3300006051 Ga0075364_10374908 Ga0075364_103749082 112
432 3300006358 Ga0068871_101933539 Ga0068871_1019335392 112
433 3300006881 Ga0068865_101757401 Ga0068865_1017574011 112
434 3300006931 Ga0097620_101983177 Ga0097620_1019831771 112
435 3300009093 Ga0105240_11445932 Ga0105240_114459321 112
436 3300009098 Ga0105245_11761960 Ga0105245_117619602 112
437 3300009176 Ga0105242_11246849 Ga0105242_112468491 112
438 3300010375 Ga0105239_11581552 Ga0105239_115815522 112
439 3300014969 Ga0157376_10594599 Ga0157376_105945992 112
440 3300025245 Ga0207425_1000012 Ga0207425_1000012409 112
441 3300025258 Ga0209129_1000086 Ga0209129_1000086132 112
442 3300025273 Ga0209673_1008627 Ga0209673_10086276 112
443 3300025294 Ga0209025_1000024 Ga0209025_1000024409 112
444 3300025297 Ga0209758_1000046 Ga0209758_1000046132 112
445 3300025299 Ga0209256_1053637 Ga0209256_10536372 112
446 3300025923 Ga0207681_11727073 Ga0207681_117270731 112
447 3300025927 Ga0207687_11216946 Ga0207687_112169462 112
448 3300025935 Ga0207709_10512016 Ga0207709_105120162 112
449 3300025938 Ga0207704_11081843 Ga0207704_110818431 112
450 3300026121 Ga0207683_10195836 Ga0207683_101958363 112
451 3300028379 Ga0268266_10387147 Ga0268266_103871472 112
452 3300028794 Ga0307515_10661515 Ga0307515_106615151 112
453 3300031911 Ga0307412_10001828 Ga0307412_1000182812 112
454 3300041441 Ga0451787_690327 Ga0451787_690327_91_474 112
455 3300046460 Ga0495638_0220019 Ga0495638_0220019_232_624 112
456 3300048903 Ga0496100_0624916 Ga0496100_0624916_34_411 112
457 3300048918 Ga0496115_0685929 Ga0496115_0685929_215_604 112
458 3300048919 Ga0496116_0020877 Ga0496116_0020877_2189_2566 112
459 3300048919 Ga0496116_0110724 Ga0496116_0110724_114_491 112
460 3300048920 Ga0496117_0026928 Ga0496117_0026928_1999_2376 112
461 3300048921 Ga0496118_0068364 Ga0496118_0068364_280_657 112
462 3300048921 Ga0496118_0105684 Ga0496118_0105684_897_1286 112
463 3300048924 Ga0496121_0024057 Ga0496121_0024057_3386_3763 112
464 3300048924 Ga0496121_0028690 Ga0496121_0028690_2793_3170 112
465 3300048925 Ga0496122_0027609 Ga0496122_0027609_2392_2769 112
466 3300048925 Ga0496122_0038819 Ga0496122_0038819_904_1281 112
467 3300048926 Ga0496123_0005995 Ga0496123_0005995_2037_2414 112
468 3300048926 Ga0496123_0025295 Ga0496123_0025295_2946_3323 112
469 3300048927 Ga0496124_0019949 Ga0496124_0019949_2392_2769 112
470 3300048927 Ga0496124_0045577 Ga0496124_0045577_16_405 112
471 3300048927 Ga0496124_0075782 Ga0496124_0075782_1220_1597 112
472 3300048928 Ga0496125_0019563 Ga0496125_0019563_3264_3641 112
473 3300048928 Ga0496125_0134631 Ga0496125_0134631_284_661 112
474 3300048929 Ga0496126_0017025 Ga0496126_0017025_6441_6818 112
475 3300049581 Ga0501047_0462858 Ga0501047_0462858_97_489 112
476 3300049583 Ga0501067_0394433 Ga0501067_0394433_12_404 112
477 3300049586 Ga0501070_0084945 Ga0501070_0084945_1717_2109 112
478 3300050490 nmdc:mga03n38_85050_c1 nmdc:mga03n38_85050_c1_1096_1479 112
479 3300050492 nmdc:mga0yw44_117684_c1 nmdc:mga0yw44_117684_c1_1158_1550 112
480 3300050494 nmdc:mga06z11_329147_c1 nmdc:mga06z11_329147_c1_98_487 112
481 3300050496 nmdc:mga07m45_117972_c1 nmdc:mga07m45_117972_c1_567_950 112
482 3300053077 Ga0495601_0482419 Ga0495601_0482419_399_788 112
483 iso_pu_bacteria 2585427594 2585844581 112
484 iso_pu_bacteria 2818991439 2819556427 112
485 3300031824 Ga0307413_10249613 Ga0307413_102496132 113
486 3300049569 Ga0501032_0176545 Ga0501032_0176545_48_422 113
487 3300049570 Ga0501033_0006502 Ga0501033_0006502_6880_7254 113
488 3300049573 Ga0501037_0192823 Ga0501037_0192823_783_1157 113
489 3300049581 Ga0501047_0075431 Ga0501047_0075431_1932_2306 113
490 3300049586 Ga0501070_0001675 Ga0501070_0001675_11823_12197 113
491 3300049589 Ga0501073_0066926 Ga0501073_0066926_1260_1634 113
492 3300049590 Ga0501074_0005211 Ga0501074_0005211_4009_4383 113
493 3300049742 Ga0501080_0007218 Ga0501080_0007218_5325_5699 113
494 3300049822 Ga0501035_0105693 Ga0501035_0105693_1920_2294 113
495 3300049823 Ga0501044_0035864 Ga0501044_0035864_2838_3212 113
496 3300005455 Ga0070663_101190643 Ga0070663_1011906432 114
497 3300009147 Ga0114129_10001489 Ga0114129_1000148912 114
498 3300013102 Ga0157371_10008023 Ga0157371_100080233 114
499 3300048926 Ga0496123_0023274 Ga0496123_0023274_486_860 114
500 3300050507 nmdc:mga05p37_11609_c1 nmdc:mga05p37_11609_c1_9369_9866 114
501 3300001915 JGI24741J21665_1065497 JGI24741J21665_10654972 116
502 3300005327 Ga0070658_10601649 Ga0070658_106016492 116
503 3300005341 Ga0070691_10119996 Ga0070691_101199963 116
504 3300025909 Ga0207705_10241675 Ga0207705_102416751 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03713

DUF305

Domain of unknown function (DUF305)

20

132

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fej-assembly2.cif.gz_B copm in the cu(i)-bound form 0.9718 59 113
5ffe-assembly2.cif.gz_B copm in the ag-bound form (by soaking) 0.9595 57 113
5fej-assembly4.cif.gz_D copm in the cu(i)-bound form 0.9579 57 113
5ffc-assembly2.cif.gz_B copm in the cu(ii)-bound form 0.9443 59 113
7vw1-assembly1.cif.gz_B structure of a dimeric periplasmic protein bound with cuprous ions 0.9398 27 112
ID Description Score Start End Superfamily
5fejD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9579 57 113 1.20.1260.10
5fejA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9549 57 113 1.20.1260.10
5ffcB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9441 59 113 1.20.1260.10
5ffdA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8969 52 113 1.20.1260.10
5da5N00 Special;Helix non-globular;Helix Hairpins; 0.8869 53 114 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A541CL33-F1-model_v4 DUF305 domain-containing protein 1.002 33 113
AF-A0A5M8P7D8-F1-model_v4 DUF305 domain-containing protein 0.9966 33 114
AF-D7A4M1-F1-model_v4 DUF305 domain-containing protein 0.9953 30 116
AF-A0A5C7VZ93-F1-model_v4 DUF305 domain-containing protein 0.9948 30 115
AF-A0A848JZH1-F1-model_v4 Uncharacterized protein (DUF305 family) 0.9947 33 115

Feature Viewer

pLDDT pTM Quality
86.16 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map