F456255

General Info

Members Datasets Scaffolds Average Seq Length
504 187 1008 261

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0369913|Ga0496101_0369913_253_1107
Length 284
Sequence MAPDAPCPRSEETELFIRKELTSMAWKDVFSYVKAVAANNGVTKGDVRADDAVPLGARIGSVVQLQCSPIIRAQASGSLIGMPDAGDTRILAVSQIRLVPDTELYRLYLDKGDDDAKEKFLQVFCGDDGKVAEVLYCTQLARVIPETADDQDAYTGAAGYGLGDAGYTLWREQLADMLDKETLATVFGTADRLDYTRDAGARDAAFVTPFKGREIRIDDAAGTHGLRQEMFFMPYVRTLPDGGREYLLITTEIVESVDGDANRRGIHVDFVVGIPIEQERIVIQ

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
38 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
64 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
65 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
66 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
67 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
80 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
95 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
170 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
176 2643221556 Massilia sp. Root1485 Isolate Unclassified
177 2643221638 Duganella sp. Root336D2 Isolate Unclassified
178 2643221645 Massilia sp. Root351 Isolate Unclassified
179 2643221664 Massilia sp. Root418 Isolate Unclassified
180 2643221684 Massilia sp. Root133 Isolate Unclassified
181 2738541280 Massilia sp. GV090 Isolate Unclassified
182 2738541300 Massilia sp. GV016 Isolate Unclassified
183 2738543018 Massilia sp. GV045 Isolate Unclassified
184 2738543030 Massilia sp. GV097 Isolate Unclassified
185 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
186 2904424332 Duganella sp. 1411 Isolate Rhizosphere
187 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 0.79
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.31
Nodule 0
Rhizoplane 4.17
Rhizosphere 79.76
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0369913 3300048904 Bacteria 1127
2 JGI25154J39366_1006334 3300002738 Bacteria 1748
3 JGI25158J39367_1018553 3300002739 Bacteria 860
4 JGI25152J39213_1000723 3300002773 Bacteria 16987
5 JGI25152J39213_1013050 3300002773 Bacteria 1749
6 JGI25150J39212_1000767 3300002774 Bacteria 11091
7 JGI25150J39212_1013558 3300002774 Bacteria 1407
8 JGI25159J45721_1007183 3300002987 Bacteria 3228
9 JGI25153J46596_10005346 3300003215 Bacteria 6744
10 rootH2_10325251 3300003320 Bacteria 1175
11 rootL2_10010637 3300003322 Bacteria 7774
12 rootL2_10028855 3300003322 Bacteria 14866
13 JGI25160J50197_1007343 3300003354 Bacteria 4327
14 JGI25161J50226_1003893 3300003374 Bacteria 3255
15 JGI25161J50226_1006769 3300003374 Bacteria 2019
16 Ga0055529_1000015 3300003763 Bacteria 366950
17 Ga0055526_1000007 3300003771 Bacteria 321998
18 Ga0055537_1011898 3300003773 Bacteria 1731
19 Ga0055524_1005870 3300003775 Bacteria 5416
20 Ga0055524_1007246 3300003775 Bacteria 4736
21 Ga0055524_1007679 3300003775 Bacteria 4556
22 Ga0055534_1010752 3300003784 Bacteria 1895
23 Ga0055534_1013871 3300003784 Bacteria 1531
24 Ga0055528_1008085 3300003790 Bacteria 4562
25 Ga0055530_10003208 3300003791 Bacteria 9581
26 Ga0055530_10021760 3300003791 Bacteria 1881
27 Ga0055531_10028731 3300003794 Bacteria 1910
28 Ga0055531_10037971 3300003794 Bacteria 1454
29 Ga0055543_1003159 3300004625 Bacteria 5027
30 Ga0065165_1008059 3300005262 Bacteria 5027
31 Ga0070658_10081373 3300005327 Bacteria 2660
32 Ga0070658_10204379 3300005327 Bacteria 1667
33 Ga0070658_10411989 3300005327 Bacteria 1161
34 Ga0070660_100025765 3300005339 Bacteria 4373
35 Ga0070660_100064279 3300005339 Bacteria 2854
36 Ga0070661_100066485 3300005344 Bacteria 2648
37 Ga0070659_100189372 3300005366 Bacteria 1690
38 Ga0068853_100934244 3300005539 Bacteria 834
39 Ga0068855_100219731 3300005563 Bacteria 2131
40 Ga0068855_100334363 3300005563 Bacteria 1671
41 Ga0068857_100312540 3300005577 Bacteria 1450
42 Ga0068852_100413956 3300005616 Bacteria 1328
43 Ga0075362_10164043 3300006177 Bacteria 1071
44 Ga0105244_10000345 3300009036 Bacteria 43661
45 Ga0105246_10323594 3300011119 Bacteria 1254
46 Ga0157373_10242932 3300013100 Bacteria 1273
47 Ga0206356_11371903 3300020070 Bacteria 2679
48 Ga0206351_10402272 3300020077 Bacteria 1980
49 Ga0213872_10002282 3300021361 Bacteria 11420
50 Ga0213872_10008151 3300021361 Bacteria 5084
51 Ga0209436_100505 3300025208 Bacteria 17076
52 Ga0209563_100003 3300025230 Bacteria 1932942
53 Ga0209437_103153 3300025233 Bacteria 3027
54 Ga0207425_1000009 3300025245 Bacteria 593135
55 Ga0207425_1000036 3300025245 Bacteria 225783
56 Ga0207425_1000441 3300025245 Bacteria 27232
57 Ga0209646_1000042 3300025246 Bacteria 343923
58 Ga0209129_1000051 3300025258 Bacteria 267104
59 Ga0209129_1006078 3300025258 Bacteria 4036
60 Ga0209565_1000662 3300025263 Bacteria 21980
61 Ga0209565_1009395 3300025263 Bacteria 2485
62 Ga0209455_1000031 3300025272 Bacteria 519952
63 Ga0209673_1015785 3300025273 Bacteria 2851
64 Ga0209130_1000827 3300025284 Bacteria 26056
65 Ga0209130_1002733 3300025284 Bacteria 8355
66 Ga0209675_1000839 3300025291 Bacteria 20131
67 Ga0209675_1006241 3300025291 Bacteria 4822
68 Ga0209025_1007424 3300025294 Bacteria 8180
69 Ga0209564_1000010 3300025295 Bacteria 885399
70 Ga0209564_1000172 3300025295 Bacteria 155715
71 Ga0209564_1002005 3300025295 Bacteria 17786
72 Ga0209564_1040763 3300025295 Bacteria 1256
73 Ga0209758_1000054 3300025297 Bacteria 337655
74 Ga0209758_1002821 3300025297 Bacteria 16907
75 Ga0209050_1000309 3300025298 Bacteria 99432
76 Ga0209050_1025928 3300025298 Bacteria 1977
77 Ga0209256_1000307 3300025299 Bacteria 85852
78 Ga0209256_1000553 3300025299 Bacteria 53682
79 Ga0209256_1001318 3300025299 Bacteria 26552
80 Ga0207426_1001267 3300025302 Bacteria 22033
81 Ga0209257_1000054 3300025304 Bacteria 416957
82 Ga0209257_1008490 3300025304 Bacteria 5820
83 Ga0207705_10011290 3300025909 Bacteria 6472
84 Ga0207705_10092341 3300025909 Bacteria 2218
85 Ga0207654_10021315 3300025911 Bacteria 3444
86 Ga0207657_10005662 3300025919 Bacteria 13036
87 Ga0207657_10091202 3300025919 Bacteria 2542
88 Ga0207649_10102021 3300025920 Bacteria 1901
89 Ga0207706_10219431 3300025933 Bacteria 1665
90 Ga0207679_10024733 3300025945 Bacteria 4120
91 Ga0207679_10582952 3300025945 Bacteria 1006
92 Ga0207667_10046955 3300025949 Bacteria 4572
93 Ga0207667_10263416 3300025949 Bacteria 1763
94 Ga0207674_10253410 3300026116 Bacteria 1707
95 Ga0316177_1141274 3300030731 Bacteria 3332
96 Ga0316178_1165775 3300030735 Bacteria 1432
97 Ga0316180_1004149 3300030736 Bacteria 3946
98 Ga0316181_1039056 3300030744 Bacteria 1600
99 Ga0316182_1044098 3300030745 Bacteria 912
100 Ga0307408_100001520 3300031548 Bacteria 17258
101 Ga0307408_100010579 3300031548 Bacteria 6083
102 Ga0307408_100089106 3300031548 Bacteria 2325
103 Ga0307408_100139637 3300031548 Unclassified 1900
104 Ga0265314_10036878 3300031711 Bacteria 3548
105 Ga0307416_100004603 3300032002 Bacteria 8342
106 Ga0395899_0000449 3300037312 Bacteria 47070
107 Ga0395899_0001277 3300037312 Bacteria 21884
108 Ga0395899_0002494 3300037312 Bacteria 14939
109 Ga0395899_0008439 3300037312 Bacteria 7935
110 Ga0395899_0026777 3300037312 Bacteria 4350
111 Ga0395899_0046408 3300037312 Bacteria 3236
112 Ga0395899_0243626 3300037312 Bacteria 1236
113 Ga0395900_0000426 3300037418 Bacteria 60657
114 Ga0395900_0000525 3300037418 Bacteria 54176
115 Ga0395900_0006981 3300037418 Bacteria 11701
116 Ga0395900_0037040 3300037418 Bacteria 5029
117 Ga0395900_0039245 3300037418 Bacteria 4878
118 Ga0395900_0171228 3300037418 Bacteria 2210
119 Ga0395900_0218055 3300037418 Bacteria 1924
120 Ga0395900_0486781 3300037418 Bacteria 1185
121 Ga0395900_0546488 3300037418 Bacteria 1103
122 Ga0395898_0002552 3300037466 Bacteria 21364
123 Ga0395898_0082359 3300037466 Bacteria 3102
124 Ga0395898_0094190 3300037466 Bacteria 2878
125 Ga0395898_0144218 3300037466 Bacteria 2279
126 Ga0395898_0223169 3300037466 Bacteria 1797
127 Ga0395898_0507679 3300037466 Bacteria 1146
128 Ga0395905_0025529 3300037471 Bacteria 5572
129 Ga0395905_0038879 3300037471 Bacteria 4463
130 Ga0395905_0063561 3300037471 Bacteria 3453
131 Ga0395905_0114201 3300037471 Bacteria 2537
132 Ga0395905_0411513 3300037471 Bacteria 1248
133 Ga0395905_0485168 3300037471 Bacteria 1135
134 Ga0395901_0000159 3300038443 Bacteria 87998
135 Ga0395901_0001862 3300038443 Bacteria 21812
136 Ga0395901_0050607 3300038443 Bacteria 4315
137 Ga0395901_0090770 3300038443 Bacteria 3197
138 Ga0395901_0243182 3300038443 Bacteria 1876
139 Ga0395901_0279285 3300038443 Bacteria 1735
140 Ga0395901_0421150 3300038443 Bacteria 1369
141 Ga0436361_0302074 3300039447 Bacteria 152020
142 Ga0436361_0888604 3300039447 Bacteria 23958
143 Ga0439448_0000513 3300042005 Bacteria 8957
144 Ga0439449_0008382 3300042007 Bacteria 3930
145 Ga0439450_038336 3300042008 Bacteria 1104
146 Ga0439458_0011339 3300042157 Bacteria 1992
147 Ga0466969_0029508 3300044656 Bacteria 2800
148 Ga0466969_0132298 3300044656 Bacteria 1156
149 Ga0466969_0165726 3300044656 Bacteria 1014
150 Ga0466972_0001092 3300044658 Bacteria 12998
151 Ga0466965_0003998 3300044683 Bacteria 6536
152 Ga0466965_0023265 3300044683 Bacteria 2991
153 Ga0466965_0051023 3300044683 Bacteria 2052
154 Ga0466965_0094780 3300044683 Bacteria 1521
155 Ga0466966_0064839 3300044684 Bacteria 2298
156 Ga0466966_0200199 3300044684 Bacteria 1208
157 Ga0466961_0013281 3300044693 Bacteria 5270
158 Ga0466964_0000040 3300044706 Bacteria 26586
159 Ga0466964_0000537 3300044706 Bacteria 11882
160 Ga0466971_0070912 3300044719 Bacteria 1582
161 Ga0466968_0002280 3300044735 Bacteria 7015
162 Ga0466957_0001161 3300044842 Bacteria 13638
163 Ga0466957_0007135 3300044842 Bacteria 6318
164 Ga0466957_0007500 3300044842 Bacteria 6164
165 Ga0466957_0304829 3300044842 Bacteria 1071
166 Ga0466960_0087210 3300044901 Bacteria 1584
167 Ga0466959_0022467 3300045049 Bacteria 4664
168 Ga0466959_0053243 3300045049 Bacteria 2959
169 Ga0466959_0155592 3300045049 Bacteria 1609
170 Ga0466958_0008286 3300045836 Bacteria 5755
171 Ga0466958_0027946 3300045836 Bacteria 3341
172 Ga0466967_0005003 3300045976 Bacteria 9079
173 Ga0466967_0021524 3300045976 Bacteria 5241
174 Ga0466967_0057516 3300045976 Bacteria 3433
175 Ga0495617_055512 3300046452 Bacteria 1314
176 Ga0495627_006427 3300046453 Bacteria 4608
177 Ga0495590_0000012 3300046457 Bacteria 303377
178 Ga0495590_0000070 3300046457 Bacteria 71704
179 Ga0495590_0066370 3300046457 Bacteria 1263
180 Ga0495591_001252 3300046458 Bacteria 16261
181 Ga0495591_002786 3300046458 Bacteria 9425
182 Ga0495638_0000047 3300046460 Bacteria 216004
183 Ga0495638_0005663 3300046460 Bacteria 9206
184 Ga0495638_0143065 3300046460 Bacteria 1394
185 Ga0495650_0000062 3300046471 Bacteria 277977
186 Ga0495650_0000128 3300046471 Bacteria 177256
187 Ga0495650_0000239 3300046471 Bacteria 109891
188 Ga0495650_0000868 3300046471 Bacteria 35989
189 Ga0495650_0003364 3300046471 Bacteria 11726
190 Ga0495650_0022287 3300046471 Bacteria 3042
191 Ga0495605_0000021 3300046474 Bacteria 248512
192 Ga0495605_0000104 3300046474 Bacteria 105745
193 Ga0495605_0015610 3300046474 Bacteria 4126
194 Ga0495605_0015999 3300046474 Bacteria 4070
195 Ga0495605_0019701 3300046474 Bacteria 3598
196 Ga0495605_0022186 3300046474 Bacteria 3355
197 Ga0495605_0089956 3300046474 Bacteria 1424
198 Ga0495639_0006284 3300046475 Bacteria 5102
199 Ga0495584_0000223 3300046491 Bacteria 40932
200 Ga0495584_0002877 3300046491 Bacteria 9610
201 Ga0495584_0005861 3300046491 Bacteria 6475
202 Ga0495584_0006551 3300046491 Bacteria 6086
203 Ga0495584_0011518 3300046491 Bacteria 4530
204 Ga0495584_0034795 3300046491 Bacteria 2546
205 Ga0495584_0048038 3300046491 Bacteria 2152
206 Ga0495584_0227771 3300046491 Bacteria 947
207 Ga0495585_0009484 3300046492 Bacteria 5835
208 Ga0495585_0027879 3300046492 Bacteria 3223
209 Ga0495585_0051720 3300046492 Bacteria 2275
210 Ga0495585_0111580 3300046492 Bacteria 1453
211 Ga0495585_0114473 3300046492 Bacteria 1431
212 Ga0495594_0004872 3300046499 Bacteria 6910
213 Ga0495596_0001875 3300046500 Bacteria 11669
214 Ga0495596_0010908 3300046500 Bacteria 3938
215 Ga0495596_0012630 3300046500 Bacteria 3609
216 Ga0495596_0012795 3300046500 Bacteria 3579
217 Ga0495596_0019299 3300046500 Bacteria 2802
218 Ga0495596_0019856 3300046500 Bacteria 2755
219 Ga0495596_0020889 3300046500 Bacteria 2676
220 Ga0495596_0029098 3300046500 Bacteria 2216
221 Ga0495596_0037403 3300046500 Bacteria 1919
222 Ga0495607_0000407 3300046501 Bacteria 43562
223 Ga0495607_0000602 3300046501 Bacteria 35012
224 Ga0495607_0006073 3300046501 Bacteria 8545
225 Ga0495607_0007097 3300046501 Bacteria 7790
226 Ga0495607_0010265 3300046501 Bacteria 6300
227 Ga0495607_0031486 3300046501 Bacteria 3247
228 Ga0495607_0075657 3300046501 Bacteria 1865
229 Ga0495607_0147357 3300046501 Bacteria 1208
230 Ga0495583_0000092 3300046506 Bacteria 158865
231 Ga0495583_0000367 3300046506 Bacteria 70310
232 Ga0495583_0001306 3300046506 Bacteria 25929
233 Ga0495583_0002950 3300046506 Bacteria 13674
234 Ga0495583_0007390 3300046506 Bacteria 6920
235 Ga0495583_0014951 3300046506 Bacteria 4248
236 Ga0495583_0083531 3300046506 Bacteria 1384
237 Ga0495606_0000716 3300046507 Bacteria 51314
238 Ga0495606_0000826 3300046507 Bacteria 47010
239 Ga0495606_0001490 3300046507 Bacteria 31125
240 Ga0495606_0023208 3300046507 Bacteria 4502
241 Ga0495606_0036456 3300046507 Bacteria 3349
242 Ga0495606_0037170 3300046507 Bacteria 3308
243 Ga0495606_0091324 3300046507 Bacteria 1872
244 Ga0495610_0005983 3300046512 Bacteria 8506
245 Ga0495616_0000319 3300046513 Bacteria 38478
246 Ga0495616_0005159 3300046513 Bacteria 8099
247 Ga0495616_0017171 3300046513 Bacteria 3993
248 Ga0495616_0021842 3300046513 Bacteria 3460
249 Ga0495616_0024236 3300046513 Bacteria 3256
250 Ga0495616_0035770 3300046513 Bacteria 2567
251 Ga0495616_0036439 3300046513 Bacteria 2538
252 Ga0495616_0064016 3300046513 Bacteria 1795
253 Ga0495620_0068084 3300046515 Bacteria 1463
254 Ga0495631_0001413 3300046518 Bacteria 14588
255 Ga0495631_0003885 3300046518 Bacteria 8080
256 Ga0495631_0008491 3300046518 Bacteria 5177
257 Ga0495631_0012323 3300046518 Bacteria 4181
258 Ga0495631_0018016 3300046518 Bacteria 3331
259 Ga0495631_0028569 3300046518 Bacteria 2543
260 Ga0495631_0052304 3300046518 Bacteria 1784
261 Ga0495631_0073992 3300046518 Bacteria 1471
262 Ga0495631_0151957 3300046518 Bacteria 993
263 Ga0495632_0000090 3300046519 Bacteria 93838
264 Ga0495632_0000107 3300046519 Bacteria 85396
265 Ga0495632_0000184 3300046519 Bacteria 63861
266 Ga0495632_0006534 3300046519 Bacteria 7481
267 Ga0495632_0031986 3300046519 Bacteria 2714
268 Ga0495637_0000286 3300046520 Bacteria 39443
269 Ga0495637_0074003 3300046520 Bacteria 1369
270 Ga0495637_0153620 3300046520 Bacteria 867
271 Ga0495643_0000237 3300046522 Bacteria 82853
272 Ga0495643_0001506 3300046522 Bacteria 21094
273 Ga0495643_0006236 3300046522 Bacteria 7904
274 Ga0495643_0041752 3300046522 Bacteria 2500
275 Ga0495643_0067181 3300046522 Bacteria 1890
276 Ga0495643_0067325 3300046522 Bacteria 1887
277 Ga0495644_0011537 3300046523 Bacteria 3401
278 Ga0495644_0049533 3300046523 Bacteria 1576
279 Ga0495648_0000019 3300046524 Bacteria 276407
280 Ga0495648_0005028 3300046524 Bacteria 11110
281 Ga0495648_0007162 3300046524 Bacteria 8961
282 Ga0495648_0009371 3300046524 Bacteria 7598
283 Ga0495648_0036125 3300046524 Bacteria 3193
284 Ga0495648_0126301 3300046524 Bacteria 1366
285 Ga0495642_0000046 3300046528 Bacteria 74298
286 Ga0495642_0000227 3300046528 Bacteria 32156
287 Ga0495642_0002402 3300046528 Bacteria 7623
288 Ga0495642_0007934 3300046528 Bacteria 4065
289 Ga0495642_0010286 3300046528 Bacteria 3583
290 Ga0495642_0015098 3300046528 Bacteria 2998
291 Ga0495642_0019998 3300046528 Bacteria 2626
292 Ga0495642_0050144 3300046528 Bacteria 1716
293 Ga0495642_0063945 3300046528 Bacteria 1530
294 Ga0495654_0003066 3300046530 Bacteria 10405
295 Ga0495654_0005476 3300046530 Bacteria 7362
296 Ga0495654_0038490 3300046530 Bacteria 2391
297 Ga0495609_0000095 3300046538 Bacteria 104807
298 Ga0495609_0000269 3300046538 Bacteria 48750
299 Ga0495609_0003600 3300046538 Bacteria 8808
300 Ga0495609_0005109 3300046538 Bacteria 6993
301 Ga0495609_0007187 3300046538 Bacteria 5591
302 Ga0495609_0012457 3300046538 Bacteria 4035
303 Ga0495609_0038855 3300046538 Bacteria 2144
304 Ga0495609_0096113 3300046538 Bacteria 1285
305 Ga0495609_0120619 3300046538 Bacteria 1127
306 Ga0495597_0000075 3300046542 Bacteria 86570
307 Ga0495597_0000108 3300046542 Bacteria 73202
308 Ga0495597_0000138 3300046542 Bacteria 65518
309 Ga0495597_0000224 3300046542 Bacteria 51403
310 Ga0495597_0008980 3300046542 Bacteria 4980
311 Ga0495645_0034590 3300046543 Bacteria 3685
312 Ga0495622_0000019 3300046557 Bacteria 169931
313 Ga0495622_0000037 3300046557 Bacteria 119690
314 Ga0495622_0011509 3300046557 Bacteria 4088
315 Ga0495633_0000086 3300046558 Bacteria 124357
316 Ga0495633_0005365 3300046558 Bacteria 7861
317 Ga0495633_0007642 3300046558 Bacteria 6189
318 Ga0495633_0025625 3300046558 Bacteria 2902
319 Ga0495656_0021582 3300046615 Bacteria 2509
320 Ga0495656_0075574 3300046615 Bacteria 1507
321 Ga0495656_0227211 3300046615 Bacteria 935
322 Ga0495668_0000066 3300046616 Bacteria 178533
323 Ga0495668_0000535 3300046616 Bacteria 47216
324 Ga0495668_0000884 3300046616 Bacteria 33758
325 Ga0495668_0001041 3300046616 Bacteria 29392
326 Ga0495668_0002397 3300046616 Bacteria 15531
327 Ga0495668_0009255 3300046616 Bacteria 6059
328 Ga0495668_0018587 3300046616 Bacteria 4016
329 Ga0495668_0060384 3300046616 Bacteria 2092
330 Ga0495668_0094512 3300046616 Bacteria 1636
331 Ga0495611_0001433 3300046648 Bacteria 11872
332 Ga0495611_0003158 3300046648 Bacteria 7305
333 Ga0495611_0017450 3300046648 Bacteria 3070
334 Ga0495611_0074133 3300046648 Bacteria 1558
335 Ga0495611_0122090 3300046648 Bacteria 1215
336 Ga0495625_0000208 3300046660 Bacteria 93861
337 Ga0495625_0003971 3300046660 Bacteria 14184
338 Ga0495625_0022128 3300046660 Bacteria 4879
339 Ga0495625_0065858 3300046660 Bacteria 2553
340 Ga0495625_0076601 3300046660 Bacteria 2338
341 Ga0495625_0241632 3300046660 Bacteria 1175
342 Ga0495625_0438558 3300046660 Bacteria 809
343 Ga0495659_0000277 3300046664 Bacteria 20966
344 Ga0495659_0001072 3300046664 Bacteria 9522
345 Ga0495661_0000012 3300046665 Bacteria 276804
346 Ga0495661_0000623 3300046665 Bacteria 36079
347 Ga0495661_0000848 3300046665 Bacteria 28480
348 Ga0495661_0001245 3300046665 Bacteria 21981
349 Ga0495661_0006957 3300046665 Bacteria 7906
350 Ga0495661_0019717 3300046665 Bacteria 4414
351 Ga0495661_0035986 3300046665 Bacteria 3103
352 Ga0495661_0046490 3300046665 Bacteria 2649
353 Ga0495661_0050090 3300046665 Bacteria 2530
354 Ga0495661_0097679 3300046665 Bacteria 1658
355 Ga0495661_0101027 3300046665 Bacteria 1623
356 Ga0495588_0000118 3300046674 Bacteria 134942
357 Ga0495588_0052610 3300046674 Bacteria 2099
358 Ga0495588_0053583 3300046674 Bacteria 2080
359 Ga0495669_0000125 3300046684 Bacteria 48968
360 Ga0495669_0001362 3300046684 Bacteria 10082
361 Ga0495669_0017440 3300046684 Bacteria 3082
362 Ga0495669_0027682 3300046684 Bacteria 2480
363 Ga0495669_0047797 3300046684 Bacteria 1912
364 Ga0495669_0139742 3300046684 Bacteria 1143
365 Ga0495613_0152529 3300046689 Bacteria 1647
366 Ga0495670_0006222 3300046691 Bacteria 5859
367 Ga0495670_0037021 3300046691 Bacteria 2431
368 Ga0495670_0073615 3300046691 Bacteria 1731
369 Ga0495671_0000245 3300046692 Bacteria 46833
370 Ga0495671_0000924 3300046692 Bacteria 20803
371 Ga0495671_0001464 3300046692 Bacteria 15839
372 Ga0495671_0006267 3300046692 Bacteria 6892
373 Ga0495671_0060307 3300046692 Bacteria 1873
374 Ga0495649_0000093 3300046694 Bacteria 77036
375 Ga0495649_0005345 3300046694 Bacteria 8191
376 Ga0495649_0037236 3300046694 Bacteria 2671
377 Ga0495589_0000007 3300046794 Bacteria 276444
378 Ga0495589_0000082 3300046794 Bacteria 87068
379 Ga0495589_0000182 3300046794 Bacteria 55624
380 Ga0495589_0019087 3300046794 Bacteria 3517
381 Ga0495589_0022250 3300046794 Bacteria 3235
382 Ga0495589_0031817 3300046794 Bacteria 2655
383 Ga0495589_0147217 3300046794 Bacteria 1125
384 Ga0495660_0000297 3300046810 Bacteria 45575
385 Ga0495660_0000419 3300046810 Bacteria 35881
386 Ga0495660_0005291 3300046810 Bacteria 7732
387 Ga0495660_0039205 3300046810 Bacteria 2631
388 Ga0495660_0067509 3300046810 Bacteria 1904
389 Ga0495660_0073862 3300046810 Bacteria 1802
390 Ga0495660_0174505 3300046810 Bacteria 1044
391 Ga0495581_0154968 3300047315 Bacteria 1339
392 Ga0495636_0005611 3300047318 Bacteria 4921
393 Ga0495672_0000026 3300047320 Bacteria 340319
394 Ga0495672_0000217 3300047320 Bacteria 82349
395 Ga0495672_0000978 3300047320 Bacteria 29595
396 Ga0495672_0001203 3300047320 Bacteria 26107
397 Ga0495672_0002190 3300047320 Bacteria 18196
398 Ga0495672_0006396 3300047320 Bacteria 9145
399 Ga0495672_0079930 3300047320 Bacteria 1825
400 Ga0495676_0000082 3300047321 Bacteria 68690
401 Ga0495683_0000257 3300047323 Bacteria 47846
402 Ga0495683_0007369 3300047323 Bacteria 5961
403 Ga0495683_0044200 3300047323 Bacteria 2240
404 Ga0495683_0049515 3300047323 Bacteria 2104
405 Ga0495683_0051172 3300047323 Bacteria 2066
406 Ga0495683_0053365 3300047323 Bacteria 2016
407 Ga0495683_0053374 3300047323 Bacteria 2016
408 Ga0495687_000003 3300047443 Bacteria 859509
409 Ga0495687_000016 3300047443 Bacteria 359237
410 Ga0495687_000108 3300047443 Bacteria 126739
411 Ga0495687_000661 3300047443 Bacteria 39602
412 Ga0495687_000962 3300047443 Bacteria 29464
413 Ga0495687_044421 3300047443 Bacteria 1931
414 Ga0495677_0000005 3300047445 Bacteria 243336
415 Ga0495677_0000303 3300047445 Bacteria 21414
416 Ga0495677_0001334 3300047445 Bacteria 9868
417 Ga0495677_0001356 3300047445 Bacteria 9776
418 Ga0495677_0006615 3300047445 Bacteria 4373
419 Ga0495677_0009804 3300047445 Bacteria 3529
420 Ga0495677_0122043 3300047445 Bacteria 994
421 Ga0495679_005414 3300047446 Bacteria 5656
422 Ga0495679_015878 3300047446 Bacteria 2738
423 Ga0495679_031713 3300047446 Bacteria 1702
424 Ga0495685_011141 3300047447 Bacteria 3028
425 Ga0495685_015180 3300047447 Bacteria 2625
426 Ga0495681_0000407 3300047470 Bacteria 33294
427 Ga0495681_0000868 3300047470 Bacteria 23284
428 Ga0495681_0002292 3300047470 Bacteria 13757
429 Ga0495681_0006289 3300047470 Bacteria 7825
430 Ga0495681_0006765 3300047470 Bacteria 7461
431 Ga0495681_0024929 3300047470 Bacteria 3136
432 Ga0495686_0000142 3300047472 Bacteria 143655
433 Ga0495686_0002019 3300047472 Bacteria 20049
434 Ga0495686_0005828 3300047472 Bacteria 9610
435 Ga0495626_0000081 3300048091 Bacteria 128894
436 Ga0495626_0001760 3300048091 Bacteria 16482
437 Ga0495626_0004920 3300048091 Bacteria 8022
438 Ga0495626_0012763 3300048091 Bacteria 4390
439 Ga0495626_0013403 3300048091 Bacteria 4259
440 Ga0495626_0034689 3300048091 Bacteria 2412
441 Ga0495626_0065628 3300048091 Bacteria 1642
442 Ga0495626_0083020 3300048091 Bacteria 1420
443 Ga0496102_0000312 3300048905 Bacteria 61195
444 Ga0496102_0031161 3300048905 Bacteria 4781
445 Ga0496102_0231056 3300048905 Bacteria 1744
446 Ga0496102_0263346 3300048905 Bacteria 1625
447 Ga0496102_0283523 3300048905 Bacteria 1561
448 Ga0496102_0518457 3300048905 Bacteria 1114
449 Ga0496102_0635191 3300048905 Bacteria 991
450 Ga0496102_0705956 3300048905 Bacteria 931
451 Ga0496103_0001949 3300048906 Bacteria 13341
452 Ga0496103_0292100 3300048906 Bacteria 1048
453 Ga0496104_0151624 3300048907 Bacteria 2225
454 Ga0496106_0624179 3300048909 Bacteria 862
455 Ga0496107_0271857 3300048910 Bacteria 1261
456 Ga0496110_0000083 3300048913 Bacteria 49307
457 Ga0496110_0133677 3300048913 Bacteria 2241
458 Ga0496111_0031790 3300048914 Bacteria 3761
459 Ga0496111_0167539 3300048914 Bacteria 1632
460 Ga0496112_0197841 3300048915 Bacteria 1970
461 Ga0496113_0002631 3300048916 Bacteria 10509
462 Ga0496113_0034390 3300048916 Bacteria 3698
463 Ga0496122_0001305 3300048925 Bacteria 41082
464 Ga0496122_0001426 3300048925 Bacteria 38722
465 Ga0496122_0181190 3300048925 Bacteria 1256
466 Ga0496123_0075176 3300048926 Bacteria 2086
467 Ga0496123_0232735 3300048926 Bacteria 920
468 Ga0496124_0002290 3300048927 Bacteria 25312
469 Ga0496124_0031593 3300048927 Bacteria 4686
470 Ga0496124_0114175 3300048927 Bacteria 2169
471 Ga0496125_0129685 3300048928 Bacteria 1778
472 Ga0495678_000163 3300049459 Bacteria 78292
473 Ga0495678_000349 3300049459 Bacteria 47682
474 Ga0495678_000611 3300049459 Bacteria 33515
475 Ga0495678_001409 3300049459 Bacteria 19049
476 Ga0495678_011945 3300049459 Bacteria 4136
477 Ga0495678_019485 3300049459 Bacteria 3026
478 Ga0495682_0000137 3300049460 Bacteria 63454
479 Ga0495682_0008292 3300049460 Bacteria 4102
480 Ga0495682_0008707 3300049460 Bacteria 3994
481 Ga0495682_0047251 3300049460 Bacteria 1570
482 Ga0501315_014880 3300049531 Unclassified 991
483 Ga0501034_0266458 3300049571 Bacteria 1655
484 Ga0501047_0268987 3300049581 Bacteria 1551
485 Ga0501269_000427 3300049766 Bacteria 9482
486 Ga0501279_000689 3300049775 Bacteria 4428
487 Ga0501035_0000507 3300049822 Bacteria 43979
488 Ga0501044_0132401 3300049823 Bacteria 2487
489 Ga0587083_0004196 3300059505 Bacteria 1981
490 Ga0466962_0076080 3300061719 Bacteria 1604
491 Ga0466962_0155861 3300061719 Bacteria 1109
492 2643792468 2643221554 Bacteria 6603920
493 2643800753 2643221556 Bacteria 7251154
494 2644217015 2643221638 Bacteria 6579467
495 2644250631 2643221645 Bacteria 7207331
496 2644358943 2643221664 Bacteria 7272945
497 2644470983 2643221684 Bacteria 7145183
498 2738738609 2738541280 Bacteria 6630198
499 2738842581 2738541300 Bacteria 6675882
500 2739273328 2738543018 Bacteria 6718814
501 2739342372 2738543030 Bacteria 6719714
502 2809142843 2808606418 Bacteria 6724496
503 2904428256 2904424332 Bacteria 7633521
504 8047677365 8047673197 Bacteria 7395230
505 Ga0496101_0369913
506 JGI25154J39366_1006334
507 JGI25158J39367_1018553
508 JGI25152J39213_1000723
509 JGI25152J39213_1013050
510 JGI25150J39212_1000767
511 JGI25150J39212_1013558
512 JGI25159J45721_1007183
513 JGI25153J46596_10005346
514 rootH2_10325251
515 rootL2_10010637
516 rootL2_10028855
517 JGI25160J50197_1007343
518 JGI25161J50226_1003893
519 JGI25161J50226_1006769
520 Ga0055529_1000015
521 Ga0055526_1000007
522 Ga0055537_1011898
523 Ga0055524_1005870
524 Ga0055524_1007246
525 Ga0055524_1007679
526 Ga0055534_1010752
527 Ga0055534_1013871
528 Ga0055528_1008085
529 Ga0055530_10003208
530 Ga0055530_10021760
531 Ga0055531_10028731
532 Ga0055531_10037971
533 Ga0055543_1003159
534 Ga0065165_1008059
535 Ga0070658_10081373
536 Ga0070658_10204379
537 Ga0070658_10411989
538 Ga0070660_100025765
539 Ga0070660_100064279
540 Ga0070661_100066485
541 Ga0070659_100189372
542 Ga0068853_100934244
543 Ga0068855_100219731
544 Ga0068855_100334363
545 Ga0068857_100312540
546 Ga0068852_100413956
547 Ga0075362_10164043
548 Ga0105244_10000345
549 Ga0105246_10323594
550 Ga0157373_10242932
551 Ga0206356_11371903
552 Ga0206351_10402272
553 Ga0213872_10002282
554 Ga0213872_10008151
555 Ga0209436_100505
556 Ga0209563_100003
557 Ga0209437_103153
558 Ga0207425_1000009
559 Ga0207425_1000036
560 Ga0207425_1000441
561 Ga0209646_1000042
562 Ga0209129_1000051
563 Ga0209129_1006078
564 Ga0209565_1000662
565 Ga0209565_1009395
566 Ga0209455_1000031
567 Ga0209673_1015785
568 Ga0209130_1000827
569 Ga0209130_1002733
570 Ga0209675_1000839
571 Ga0209675_1006241
572 Ga0209025_1007424
573 Ga0209564_1000010
574 Ga0209564_1000172
575 Ga0209564_1002005
576 Ga0209564_1040763
577 Ga0209758_1000054
578 Ga0209758_1002821
579 Ga0209050_1000309
580 Ga0209050_1025928
581 Ga0209256_1000307
582 Ga0209256_1000553
583 Ga0209256_1001318
584 Ga0207426_1001267
585 Ga0209257_1000054
586 Ga0209257_1008490
587 Ga0207705_10011290
588 Ga0207705_10092341
589 Ga0207654_10021315
590 Ga0207657_10005662
591 Ga0207657_10091202
592 Ga0207649_10102021
593 Ga0207706_10219431
594 Ga0207679_10024733
595 Ga0207679_10582952
596 Ga0207667_10046955
597 Ga0207667_10263416
598 Ga0207674_10253410
599 Ga0316177_1141274
600 Ga0316178_1165775
601 Ga0316180_1004149
602 Ga0316181_1039056
603 Ga0316182_1044098
604 Ga0307408_100001520
605 Ga0307408_100010579
606 Ga0307408_100089106
607 Ga0307408_100139637
608 Ga0265314_10036878
609 Ga0307416_100004603
610 Ga0395899_0000449
611 Ga0395899_0001277
612 Ga0395899_0002494
613 Ga0395899_0008439
614 Ga0395899_0026777
615 Ga0395899_0046408
616 Ga0395899_0243626
617 Ga0395900_0000426
618 Ga0395900_0000525
619 Ga0395900_0006981
620 Ga0395900_0037040
621 Ga0395900_0039245
622 Ga0395900_0171228
623 Ga0395900_0218055
624 Ga0395900_0486781
625 Ga0395900_0546488
626 Ga0395898_0002552
627 Ga0395898_0082359
628 Ga0395898_0094190
629 Ga0395898_0144218
630 Ga0395898_0223169
631 Ga0395898_0507679
632 Ga0395905_0025529
633 Ga0395905_0038879
634 Ga0395905_0063561
635 Ga0395905_0114201
636 Ga0395905_0411513
637 Ga0395905_0485168
638 Ga0395901_0000159
639 Ga0395901_0001862
640 Ga0395901_0050607
641 Ga0395901_0090770
642 Ga0395901_0243182
643 Ga0395901_0279285
644 Ga0395901_0421150
645 Ga0436361_0302074
646 Ga0436361_0888604
647 Ga0439448_0000513
648 Ga0439449_0008382
649 Ga0439450_038336
650 Ga0439458_0011339
651 Ga0466969_0029508
652 Ga0466969_0132298
653 Ga0466969_0165726
654 Ga0466972_0001092
655 Ga0466965_0003998
656 Ga0466965_0023265
657 Ga0466965_0051023
658 Ga0466965_0094780
659 Ga0466966_0064839
660 Ga0466966_0200199
661 Ga0466961_0013281
662 Ga0466964_0000040
663 Ga0466964_0000537
664 Ga0466971_0070912
665 Ga0466968_0002280
666 Ga0466957_0001161
667 Ga0466957_0007135
668 Ga0466957_0007500
669 Ga0466957_0304829
670 Ga0466960_0087210
671 Ga0466959_0022467
672 Ga0466959_0053243
673 Ga0466959_0155592
674 Ga0466958_0008286
675 Ga0466958_0027946
676 Ga0466967_0005003
677 Ga0466967_0021524
678 Ga0466967_0057516
679 Ga0495617_055512
680 Ga0495627_006427
681 Ga0495590_0000012
682 Ga0495590_0000070
683 Ga0495590_0066370
684 Ga0495591_001252
685 Ga0495591_002786
686 Ga0495638_0000047
687 Ga0495638_0005663
688 Ga0495638_0143065
689 Ga0495650_0000062
690 Ga0495650_0000128
691 Ga0495650_0000239
692 Ga0495650_0000868
693 Ga0495650_0003364
694 Ga0495650_0022287
695 Ga0495605_0000021
696 Ga0495605_0000104
697 Ga0495605_0015610
698 Ga0495605_0015999
699 Ga0495605_0019701
700 Ga0495605_0022186
701 Ga0495605_0089956
702 Ga0495639_0006284
703 Ga0495584_0000223
704 Ga0495584_0002877
705 Ga0495584_0005861
706 Ga0495584_0006551
707 Ga0495584_0011518
708 Ga0495584_0034795
709 Ga0495584_0048038
710 Ga0495584_0227771
711 Ga0495585_0009484
712 Ga0495585_0027879
713 Ga0495585_0051720
714 Ga0495585_0111580
715 Ga0495585_0114473
716 Ga0495594_0004872
717 Ga0495596_0001875
718 Ga0495596_0010908
719 Ga0495596_0012630
720 Ga0495596_0012795
721 Ga0495596_0019299
722 Ga0495596_0019856
723 Ga0495596_0020889
724 Ga0495596_0029098
725 Ga0495596_0037403
726 Ga0495607_0000407
727 Ga0495607_0000602
728 Ga0495607_0006073
729 Ga0495607_0007097
730 Ga0495607_0010265
731 Ga0495607_0031486
732 Ga0495607_0075657
733 Ga0495607_0147357
734 Ga0495583_0000092
735 Ga0495583_0000367
736 Ga0495583_0001306
737 Ga0495583_0002950
738 Ga0495583_0007390
739 Ga0495583_0014951
740 Ga0495583_0083531
741 Ga0495606_0000716
742 Ga0495606_0000826
743 Ga0495606_0001490
744 Ga0495606_0023208
745 Ga0495606_0036456
746 Ga0495606_0037170
747 Ga0495606_0091324
748 Ga0495610_0005983
749 Ga0495616_0000319
750 Ga0495616_0005159
751 Ga0495616_0017171
752 Ga0495616_0021842
753 Ga0495616_0024236
754 Ga0495616_0035770
755 Ga0495616_0036439
756 Ga0495616_0064016
757 Ga0495620_0068084
758 Ga0495631_0001413
759 Ga0495631_0003885
760 Ga0495631_0008491
761 Ga0495631_0012323
762 Ga0495631_0018016
763 Ga0495631_0028569
764 Ga0495631_0052304
765 Ga0495631_0073992
766 Ga0495631_0151957
767 Ga0495632_0000090
768 Ga0495632_0000107
769 Ga0495632_0000184
770 Ga0495632_0006534
771 Ga0495632_0031986
772 Ga0495637_0000286
773 Ga0495637_0074003
774 Ga0495637_0153620
775 Ga0495643_0000237
776 Ga0495643_0001506
777 Ga0495643_0006236
778 Ga0495643_0041752
779 Ga0495643_0067181
780 Ga0495643_0067325
781 Ga0495644_0011537
782 Ga0495644_0049533
783 Ga0495648_0000019
784 Ga0495648_0005028
785 Ga0495648_0007162
786 Ga0495648_0009371
787 Ga0495648_0036125
788 Ga0495648_0126301
789 Ga0495642_0000046
790 Ga0495642_0000227
791 Ga0495642_0002402
792 Ga0495642_0007934
793 Ga0495642_0010286
794 Ga0495642_0015098
795 Ga0495642_0019998
796 Ga0495642_0050144
797 Ga0495642_0063945
798 Ga0495654_0003066
799 Ga0495654_0005476
800 Ga0495654_0038490
801 Ga0495609_0000095
802 Ga0495609_0000269
803 Ga0495609_0003600
804 Ga0495609_0005109
805 Ga0495609_0007187
806 Ga0495609_0012457
807 Ga0495609_0038855
808 Ga0495609_0096113
809 Ga0495609_0120619
810 Ga0495597_0000075
811 Ga0495597_0000108
812 Ga0495597_0000138
813 Ga0495597_0000224
814 Ga0495597_0008980
815 Ga0495645_0034590
816 Ga0495622_0000019
817 Ga0495622_0000037
818 Ga0495622_0011509
819 Ga0495633_0000086
820 Ga0495633_0005365
821 Ga0495633_0007642
822 Ga0495633_0025625
823 Ga0495656_0021582
824 Ga0495656_0075574
825 Ga0495656_0227211
826 Ga0495668_0000066
827 Ga0495668_0000535
828 Ga0495668_0000884
829 Ga0495668_0001041
830 Ga0495668_0002397
831 Ga0495668_0009255
832 Ga0495668_0018587
833 Ga0495668_0060384
834 Ga0495668_0094512
835 Ga0495611_0001433
836 Ga0495611_0003158
837 Ga0495611_0017450
838 Ga0495611_0074133
839 Ga0495611_0122090
840 Ga0495625_0000208
841 Ga0495625_0003971
842 Ga0495625_0022128
843 Ga0495625_0065858
844 Ga0495625_0076601
845 Ga0495625_0241632
846 Ga0495625_0438558
847 Ga0495659_0000277
848 Ga0495659_0001072
849 Ga0495661_0000012
850 Ga0495661_0000623
851 Ga0495661_0000848
852 Ga0495661_0001245
853 Ga0495661_0006957
854 Ga0495661_0019717
855 Ga0495661_0035986
856 Ga0495661_0046490
857 Ga0495661_0050090
858 Ga0495661_0097679
859 Ga0495661_0101027
860 Ga0495588_0000118
861 Ga0495588_0052610
862 Ga0495588_0053583
863 Ga0495669_0000125
864 Ga0495669_0001362
865 Ga0495669_0017440
866 Ga0495669_0027682
867 Ga0495669_0047797
868 Ga0495669_0139742
869 Ga0495613_0152529
870 Ga0495670_0006222
871 Ga0495670_0037021
872 Ga0495670_0073615
873 Ga0495671_0000245
874 Ga0495671_0000924
875 Ga0495671_0001464
876 Ga0495671_0006267
877 Ga0495671_0060307
878 Ga0495649_0000093
879 Ga0495649_0005345
880 Ga0495649_0037236
881 Ga0495589_0000007
882 Ga0495589_0000082
883 Ga0495589_0000182
884 Ga0495589_0019087
885 Ga0495589_0022250
886 Ga0495589_0031817
887 Ga0495589_0147217
888 Ga0495660_0000297
889 Ga0495660_0000419
890 Ga0495660_0005291
891 Ga0495660_0039205
892 Ga0495660_0067509
893 Ga0495660_0073862
894 Ga0495660_0174505
895 Ga0495581_0154968
896 Ga0495636_0005611
897 Ga0495672_0000026
898 Ga0495672_0000217
899 Ga0495672_0000978
900 Ga0495672_0001203
901 Ga0495672_0002190
902 Ga0495672_0006396
903 Ga0495672_0079930
904 Ga0495676_0000082
905 Ga0495683_0000257
906 Ga0495683_0007369
907 Ga0495683_0044200
908 Ga0495683_0049515
909 Ga0495683_0051172
910 Ga0495683_0053365
911 Ga0495683_0053374
912 Ga0495687_000003
913 Ga0495687_000016
914 Ga0495687_000108
915 Ga0495687_000661
916 Ga0495687_000962
917 Ga0495687_044421
918 Ga0495677_0000005
919 Ga0495677_0000303
920 Ga0495677_0001334
921 Ga0495677_0001356
922 Ga0495677_0006615
923 Ga0495677_0009804
924 Ga0495677_0122043
925 Ga0495679_005414
926 Ga0495679_015878
927 Ga0495679_031713
928 Ga0495685_011141
929 Ga0495685_015180
930 Ga0495681_0000407
931 Ga0495681_0000868
932 Ga0495681_0002292
933 Ga0495681_0006289
934 Ga0495681_0006765
935 Ga0495681_0024929
936 Ga0495686_0000142
937 Ga0495686_0002019
938 Ga0495686_0005828
939 Ga0495626_0000081
940 Ga0495626_0001760
941 Ga0495626_0004920
942 Ga0495626_0012763
943 Ga0495626_0013403
944 Ga0495626_0034689
945 Ga0495626_0065628
946 Ga0495626_0083020
947 Ga0496102_0000312
948 Ga0496102_0031161
949 Ga0496102_0231056
950 Ga0496102_0263346
951 Ga0496102_0283523
952 Ga0496102_0518457
953 Ga0496102_0635191
954 Ga0496102_0705956
955 Ga0496103_0001949
956 Ga0496103_0292100
957 Ga0496104_0151624
958 Ga0496106_0624179
959 Ga0496107_0271857
960 Ga0496110_0000083
961 Ga0496110_0133677
962 Ga0496111_0031790
963 Ga0496111_0167539
964 Ga0496112_0197841
965 Ga0496113_0002631
966 Ga0496113_0034390
967 Ga0496122_0001305
968 Ga0496122_0001426
969 Ga0496122_0181190
970 Ga0496123_0075176
971 Ga0496123_0232735
972 Ga0496124_0002290
973 Ga0496124_0031593
974 Ga0496124_0114175
975 Ga0496125_0129685
976 Ga0495678_000163
977 Ga0495678_000349
978 Ga0495678_000611
979 Ga0495678_001409
980 Ga0495678_011945
981 Ga0495678_019485
982 Ga0495682_0000137
983 Ga0495682_0008292
984 Ga0495682_0008707
985 Ga0495682_0047251
986 Ga0501315_014880
987 Ga0501034_0266458
988 Ga0501047_0268987
989 Ga0501269_000427
990 Ga0501279_000689
991 Ga0501035_0000507
992 Ga0501044_0132401
993 Ga0587083_0004196
994 Ga0466962_0076080
995 Ga0466962_0155861
996 2643792468
997 2643800753
998 2644217015
999 2644250631
1000 2644358943
1001 2644470983
1002 2738738609
1003 2738842581
1004 2739273328
1005 2739342372
1006 2809142843
1007 2904428256
1008 8047677365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hz4-assembly1.cif.gz_D the structural and biochemical characterization of acyl-coa hydrolase mutant thr60ala from staphylococcus aureus. 0.6051 201 257
1ozb-assembly2.cif.gz_G crystal structure of secb complexed with seca c-terminus 0.5946 207 255
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.5845 205 256
1ozb-assembly1.cif.gz_A crystal structure of secb complexed with seca c-terminus 0.579 207 257
5egl-assembly1.cif.gz_A the structural and biochemical characterization of acyl-coa hydrolase from staphylococcus aureus in complex with butyryl coenzyme a, coenzyme a, and coenzyme a disulfide 0.4951 201 257
ID Description Score Start End Superfamily
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.562 205 257 3.10.420.10
af_Q2FXN7_206_320_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.5484 207 247 3.30.450.20
af_P32074_820_932_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.5458 207 256 3.30.310.10
af_Q98TW1_253_374_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.5243 207 253 3.30.450.20
af_Q551X9_170_281_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.5172 207 247 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A0X8GQ59-F1-model_v4 DUF2491 domain-containing protein 0.8704 1 261
AF-A0A0X8GQ59-F1-model_v4 DUF2491 domain-containing protein 0.8671 1 261
AF-A0A124WS69-F1-model_v4 deleted 0.8472 3 261
AF-A0A0F6L6J1-F1-model_v4 deleted 0.8432 1 261
AF-A0A1Y2ZZS6-F1-model_v4 DUF2491 domain-containing protein 0.8432 9 261

Map