F456263

General Info

Members Datasets Scaffolds Average Seq Length
504 336 1008 235

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0012629|Ga0501034_0012629_1471_2298
Length 275
Sequence LRLAASLEANRRAAKALRSVTLTFRRAGFYANGILFPIGGFMKKVYPNAKAALDGIVKDGMMVLAAGFGLCGMPATLIEALRDSGVKNLTCVSNNAGIDGAGLGLLLETRQIKKMIASYVGENKLFAAQYLAGELEIEFNPQGTLAERMRAGGAGIPAFFTKTGVGTEIAKGKEERTFNGQRYIMETGLVGDIALVHAWKGDTEGNLVYRKTARNFNPVMATAAKITVAEVEHLVQPGELDGDMIHTPGVFVQRIIHTTAEKRIEVRTLRKRNAA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
226 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
227 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
228 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
229 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
235 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
314 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
315 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
316 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
317 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
318 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
319 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
320 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
327 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
328 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
329 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
330 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
331 2643221733 Bosea sp. Root381 Isolate Unclassified
332 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
333 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
334 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
335 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
336 2919085039 Luteibacter sp. 1214 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.2
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 0.6
Rhizoplane 3.37
Rhizosphere 83.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0012629 3300049571 Bacteria 8715
2 JGI24746J21847_1000187 3300001977 Bacteria 8222
3 JGI24747J21853_1005659 3300001978 Bacteria 1161
4 JGI24739J22299_10000841 3300001989 Bacteria 11280
5 JGI24737J22298_10000354 3300001990 Bacteria 15482
6 JGI24750J21931_1000271 3300002070 Bacteria 8864
7 JGI24745J21846_1000158 3300002073 Bacteria 5345
8 JGI24749J21850_1000812 3300002076 Bacteria 4489
9 JGI24744J21845_10006674 3300002077 Bacteria 2389
10 JGI24035J26624_1000301 3300002126 Bacteria 4584
11 JGI24033J26618_1016020 3300002155 Bacteria 929
12 JGI24751J29686_10011272 3300002459 Bacteria 1844
13 JGI24751J29686_10033145 3300002459 Bacteria 1071
14 JGI25406J46586_10010387 3300003203 Bacteria 4133
15 JGI26145J50221_1001271 3300003371 Bacteria 1998
16 Ga0055536_1012680 3300003781 Bacteria 3106
17 JGI25405J52794_10034128 3300003911 Bacteria 1063
18 Ga0065715_10089022 3300005293 Bacteria 16633
19 Ga0065715_10169532 3300005293 Bacteria 1558
20 Ga0070658_10159734 3300005327 Bacteria 1890
21 Ga0070676_10003948 3300005328 Bacteria 7786
22 Ga0070683_100008259 3300005329 Bacteria 8848
23 Ga0070690_100000577 3300005330 Bacteria 18482
24 Ga0070690_100134746 3300005330 Bacteria 1672
25 Ga0070670_100216634 3300005331 Bacteria 1665
26 Ga0070670_100228110 3300005331 Bacteria 1621
27 Ga0070677_10001438 3300005333 Bacteria 7555
28 Ga0070677_10217322 3300005333 Bacteria 931
29 Ga0068869_100006582 3300005334 Bacteria 7372
30 Ga0070666_10012088 3300005335 Bacteria 5436
31 Ga0070666_10147827 3300005335 Bacteria 1639
32 Ga0070680_100006307 3300005336 Bacteria 9007
33 Ga0070680_100226179 3300005336 Bacteria 1580
34 Ga0070682_100003225 3300005337 Bacteria 9046
35 Ga0068868_100405302 3300005338 Bacteria 1177
36 Ga0068868_100451612 3300005338 Bacteria 1118
37 Ga0070660_100004146 3300005339 Bacteria 10010
38 Ga0070689_100014858 3300005340 Bacteria 5665
39 Ga0070689_100091327 3300005340 Bacteria 2400
40 Ga0070689_100138102 3300005340 Bacteria 1958
41 Ga0070691_10005385 3300005341 Bacteria 5819
42 Ga0070691_10286075 3300005341 Bacteria 896
43 Ga0070687_100001224 3300005343 Bacteria 8906
44 Ga0070687_100044320 3300005343 Bacteria 2266
45 Ga0070661_100000804 3300005344 Bacteria 22558
46 Ga0070661_100268522 3300005344 Bacteria 1320
47 Ga0070692_10000837 3300005345 Bacteria 10325
48 Ga0070668_100006098 3300005347 Bacteria 8940
49 Ga0070669_100006161 3300005353 Bacteria 8659
50 Ga0070669_100412682 3300005353 Bacteria 1107
51 Ga0070675_100017427 3300005354 Bacteria 5707
52 Ga0070671_100009037 3300005355 Bacteria 7995
53 Ga0070671_100048819 3300005355 Bacteria 3521
54 Ga0070674_100004299 3300005356 Bacteria 8105
55 Ga0070673_100006345 3300005364 Bacteria 7683
56 Ga0070688_100000558 3300005365 Bacteria 18862
57 Ga0070688_100251936 3300005365 Bacteria 1257
58 Ga0070659_100024392 3300005366 Bacteria 4636
59 Ga0070667_100008212 3300005367 Bacteria 8653
60 Ga0070703_10011177 3300005406 Bacteria 2535
61 Ga0070709_10098327 3300005434 Bacteria 1945
62 Ga0070714_100031220 3300005435 Bacteria 4444
63 Ga0070713_100077384 3300005436 Bacteria 2828
64 Ga0070713_100164081 3300005436 Bacteria 1985
65 Ga0070710_10053652 3300005437 Bacteria 2272
66 Ga0070710_10207862 3300005437 Bacteria 1239
67 Ga0070701_10001856 3300005438 Bacteria 8013
68 Ga0070701_10405603 3300005438 Bacteria 865
69 Ga0070711_100027090 3300005439 Bacteria 3760
70 Ga0070711_100111410 3300005439 Bacteria 2009
71 Ga0070705_100005648 3300005440 Bacteria 6105
72 Ga0070700_100003794 3300005441 Bacteria 7825
73 Ga0070700_100101699 3300005441 Bacteria 1894
74 Ga0070694_100041579 3300005444 Bacteria 3067
75 Ga0070708_100021889 3300005445 Bacteria 5416
76 Ga0070663_100003833 3300005455 Bacteria 8754
77 Ga0070678_100002855 3300005456 Bacteria 9561
78 Ga0070678_100095481 3300005456 Bacteria 2291
79 Ga0070662_100070943 3300005457 Bacteria 2567
80 Ga0070662_100126604 3300005457 Bacteria 1964
81 Ga0070681_10008839 3300005458 Bacteria 9895
82 Ga0068867_100012098 3300005459 Bacteria 6094
83 Ga0070685_10048175 3300005466 Bacteria 2453
84 Ga0070685_10061880 3300005466 Bacteria 2193
85 Ga0070685_10139263 3300005466 Bacteria 1526
86 Ga0070679_100010504 3300005530 Bacteria 8785
87 Ga0070684_100001753 3300005535 Bacteria 15811
88 Ga0070697_100341652 3300005536 Bacteria 1292
89 Ga0068853_100008092 3300005539 Bacteria 8437
90 Ga0070672_100004614 3300005543 Bacteria 9024
91 Ga0070686_100001565 3300005544 Bacteria 12859
92 Ga0070695_100217315 3300005545 Bacteria 1375
93 Ga0070696_100198575 3300005546 Bacteria 1496
94 Ga0070693_100002143 3300005547 Bacteria 9046
95 Ga0070665_100536717 3300005548 Bacteria 1182
96 Ga0070704_100004087 3300005549 Bacteria 8421
97 Ga0068855_100074740 3300005563 Bacteria 3935
98 Ga0070664_100028636 3300005564 Bacteria 4636
99 Ga0068857_100004864 3300005577 Bacteria 11393
100 Ga0068854_100005702 3300005578 Bacteria 7869
101 Ga0068856_100014335 3300005614 Bacteria 7665
102 Ga0068856_100061308 3300005614 Bacteria 3715
103 Ga0068856_100731318 3300005614 Bacteria 1010
104 Ga0070702_100007505 3300005615 Bacteria 5225
105 Ga0068852_100002326 3300005616 Bacteria 13065
106 Ga0068852_100147280 3300005616 Bacteria 2185
107 Ga0068859_100040171 3300005617 Bacteria 4696
108 Ga0068864_100006005 3300005618 Bacteria 9968
109 Ga0068864_100439536 3300005618 Bacteria 1246
110 Ga0068866_10000301 3300005718 Bacteria 23583
111 Ga0068866_10228290 3300005718 Bacteria 1127
112 Ga0068861_100005394 3300005719 Bacteria 8652
113 Ga0068851_10449435 3300005834 Bacteria 766
114 Ga0068870_10000419 3300005840 Bacteria 15983
115 Ga0068863_100000340 3300005841 Bacteria 47641
116 Ga0068858_100036890 3300005842 Bacteria 4531
117 Ga0068858_100625117 3300005842 Bacteria 1046
118 Ga0068860_100037560 3300005843 Bacteria 4636
119 Ga0068860_100151051 3300005843 Bacteria 2237
120 Ga0068862_100009969 3300005844 Bacteria 7849
121 Ga0081455_10010585 3300005937 Bacteria 9338
122 Ga0081455_10111172 3300005937 Bacteria 2177
123 Ga0081540_1076063 3300005983 Bacteria 1531
124 Ga0081540_1159726 3300005983 Bacteria 876
125 Ga0081539_10016778 3300005985 Bacteria 5198
126 Ga0070717_10040793 3300006028 Bacteria 3783
127 Ga0075363_100022049 3300006048 Bacteria 3216
128 Ga0075364_10020890 3300006051 Bacteria 4122
129 Ga0070712_100256184 3300006175 Bacteria 1400
130 Ga0075362_10049429 3300006177 Bacteria 1878
131 Ga0075369_10077093 3300006186 Bacteria 1474
132 Ga0075366_10012093 3300006195 Bacteria 4888
133 Ga0097621_100000880 3300006237 Bacteria 21059
134 Ga0075370_10096540 3300006353 Bacteria 1708
135 Ga0075370_10113281 3300006353 Bacteria 1576
136 Ga0075370_10169307 3300006353 Bacteria 1284
137 Ga0068871_100000301 3300006358 Bacteria 34368
138 Ga0068871_100526067 3300006358 Bacteria 1068
139 Ga0075433_10006405 3300006852 Bacteria 9308
140 Ga0075434_100007954 3300006871 Bacteria 9826
141 Ga0068865_100003905 3300006881 Bacteria 8939
142 Ga0097620_100040169 3300006931 Bacteria 4696
143 Ga0105250_10027060 3300009092 Bacteria 2310
144 Ga0105240_10043237 3300009093 Bacteria 5734
145 Ga0105240_10266730 3300009093 Bacteria 1973
146 Ga0111539_10020700 3300009094 Bacteria 8100
147 Ga0105245_10018996 3300009098 Bacteria 6016
148 Ga0105247_10002113 3300009101 Bacteria 13737
149 Ga0105243_10012907 3300009148 Bacteria 6313
150 Ga0105241_10001943 3300009174 Bacteria 15638
151 Ga0105248_10003102 3300009177 Bacteria 18407
152 Ga0105248_10126415 3300009177 Bacteria 2884
153 Ga0105237_10017102 3300009545 Bacteria 7523
154 Ga0105249_10001599 3300009553 Bacteria 19830
155 Ga0105249_10506316 3300009553 Bacteria 1253
156 Ga0105239_10024058 3300010375 Bacteria 6709
157 Ga0105239_10390121 3300010375 Bacteria 1575
158 Ga0105246_10017880 3300011119 Bacteria 4511
159 Ga0157373_10007508 3300013100 Bacteria 8107
160 Ga0157371_10008631 3300013102 Bacteria 8095
161 Ga0157370_10002130 3300013104 Bacteria 24167
162 Ga0157370_10442135 3300013104 Bacteria 1196
163 Ga0157374_10001695 3300013296 Bacteria 18451
164 Ga0157378_10003374 3300013297 Bacteria 14202
165 Ga0157378_10199685 3300013297 Bacteria 1891
166 Ga0163162_10055943 3300013306 Bacteria 3973
167 Ga0163162_10801502 3300013306 Bacteria 1059
168 Ga0157372_10004321 3300013307 Bacteria 15190
169 Ga0157372_10768335 3300013307 Bacteria 1120
170 Ga0157375_10019602 3300013308 Bacteria 6156
171 Ga0163163_10229268 3300014325 Bacteria 1906
172 Ga0163163_10539003 3300014325 Bacteria 1229
173 Ga0157380_10006382 3300014326 Bacteria 8300
174 Ga0157379_10006391 3300014968 Bacteria 10151
175 Ga0182005_1000055 3300015265 Bacteria 111824
176 Ga0163161_10009345 3300017792 Bacteria 6784
177 Ga0206356_11653084 3300020070 Bacteria 868
178 Ga0213876_10011887 3300021384 Bacteria 4640
179 Ga0213876_10036527 3300021384 Bacteria 2591
180 Ga0213876_10117761 3300021384 Bacteria 1410
181 Ga0213875_10002533 3300021388 Bacteria 10899
182 Ga0207666_1000059 3300025271 Bacteria 19909
183 Ga0207673_1009757 3300025290 Bacteria 1229
184 Ga0209675_1000970 3300025291 Bacteria 18131
185 Ga0209676_1000089 3300025292 Bacteria 260196
186 Ga0209050_1008016 3300025298 Bacteria 5759
187 Ga0207697_10002326 3300025315 Bacteria 9897
188 Ga0207696_1021692 3300025711 Bacteria 2053
189 Ga0207653_10009705 3300025885 Bacteria 3001
190 Ga0207682_10002173 3300025893 Bacteria 8857
191 Ga0207682_10023530 3300025893 Bacteria 2434
192 Ga0207642_10012159 3300025899 Bacteria 3098
193 Ga0207710_10004879 3300025900 Bacteria 5815
194 Ga0207688_10000167 3300025901 Bacteria 28809
195 Ga0207688_10024680 3300025901 Bacteria 3299
196 Ga0207680_10025573 3300025903 Bacteria 3258
197 Ga0207647_10002561 3300025904 Bacteria 13747
198 Ga0207699_10283810 3300025906 Bacteria 1151
199 Ga0207645_10005337 3300025907 Bacteria 9341
200 Ga0207643_10000007 3300025908 Bacteria 171706
201 Ga0207654_10002202 3300025911 Bacteria 9986
202 Ga0207707_10014147 3300025912 Bacteria 6952
203 Ga0207707_10176301 3300025912 Bacteria 1867
204 Ga0207671_10173593 3300025914 Bacteria 1675
205 Ga0207693_10000563 3300025915 Bacteria 33538
206 Ga0207693_10405164 3300025915 Bacteria 1066
207 Ga0207660_10002332 3300025917 Bacteria 12496
208 Ga0207662_10000195 3300025918 Bacteria 28315
209 Ga0207662_10016418 3300025918 Bacteria 4179
210 Ga0207662_10101989 3300025918 Bacteria 1779
211 Ga0207657_10002386 3300025919 Bacteria 20326
212 Ga0207657_10373847 3300025919 Bacteria 1123
213 Ga0207649_10000944 3300025920 Bacteria 18174
214 Ga0207652_10009630 3300025921 Bacteria 7771
215 Ga0207681_10056284 3300025923 Bacteria 2682
216 Ga0207694_10090984 3300025924 Bacteria 2408
217 Ga0207650_10012289 3300025925 Bacteria 5908
218 Ga0207650_10226048 3300025925 Bacteria 1508
219 Ga0207650_10565010 3300025925 Bacteria 954
220 Ga0207659_10002481 3300025926 Bacteria 10998
221 Ga0207687_10000072 3300025927 Bacteria 76222
222 Ga0207664_10161248 3300025929 Bacteria 1913
223 Ga0207644_10022392 3300025931 Bacteria 4318
224 Ga0207644_10125661 3300025931 Bacteria 1957
225 Ga0207690_10029980 3300025932 Bacteria 3464
226 Ga0207706_10008634 3300025933 Bacteria 9387
227 Ga0207706_10009459 3300025933 Bacteria 8953
228 Ga0207706_10437140 3300025933 Bacteria 1133
229 Ga0207686_10009296 3300025934 Bacteria 5334
230 Ga0207709_10002480 3300025935 Bacteria 11563
231 Ga0207670_10000792 3300025936 Bacteria 16529
232 Ga0207670_10094500 3300025936 Bacteria 2121
233 Ga0207669_10001742 3300025937 Bacteria 9239
234 Ga0207669_10044599 3300025937 Bacteria 2606
235 Ga0207704_10003278 3300025938 Bacteria 7351
236 Ga0207704_10285417 3300025938 Bacteria 1257
237 Ga0207665_10400739 3300025939 Bacteria 1045
238 Ga0207691_10009483 3300025940 Bacteria 9347
239 Ga0207691_10085978 3300025940 Bacteria 2822
240 Ga0207711_10001106 3300025941 Bacteria 25759
241 Ga0207711_10349899 3300025941 Bacteria 1368
242 Ga0207689_10000366 3300025942 Bacteria 42711
243 Ga0207689_10177914 3300025942 Bacteria 1754
244 Ga0207661_10010227 3300025944 Bacteria 6746
245 Ga0207661_10214140 3300025944 Bacteria 1699
246 Ga0207679_10000029 3300025945 Bacteria 183002
247 Ga0207667_10111576 3300025949 Bacteria 2820
248 Ga0207651_10000292 3300025960 Bacteria 21406
249 Ga0207651_10416019 3300025960 Bacteria 1146
250 Ga0207712_10010471 3300025961 Bacteria 5887
251 Ga0207668_10010650 3300025972 Bacteria 5563
252 Ga0207640_10001667 3300025981 Bacteria 11922
253 Ga0207658_10038839 3300025986 Bacteria 3432
254 Ga0207677_10042618 3300026023 Bacteria 3011
255 Ga0207703_10009816 3300026035 Bacteria 7509
256 Ga0207639_10013289 3300026041 Bacteria 5758
257 Ga0207678_10006759 3300026067 Bacteria 10172
258 Ga0207678_10763844 3300026067 Bacteria 852
259 Ga0207708_10004100 3300026075 Bacteria 10722
260 Ga0207702_10011803 3300026078 Bacteria 7274
261 Ga0207702_10016294 3300026078 Bacteria 6151
262 Ga0207641_10004156 3300026088 Bacteria 12612
263 Ga0207648_10008435 3300026089 Bacteria 9983
264 Ga0207648_10020005 3300026089 Bacteria 6038
265 Ga0207676_10000182 3300026095 Bacteria 55544
266 Ga0207676_10248790 3300026095 Bacteria 1599
267 Ga0207674_10007304 3300026116 Bacteria 12874
268 Ga0207674_10116041 3300026116 Bacteria 2649
269 Ga0207675_100011726 3300026118 Bacteria 8195
270 Ga0207675_100712662 3300026118 Bacteria 1013
271 Ga0207683_10007517 3300026121 Bacteria 9341
272 Ga0207698_10005197 3300026142 Bacteria 8003
273 Ga0207698_10027150 3300026142 Bacteria 4061
274 Ga0209967_1016452 3300027364 Bacteria 1063
275 Ga0209970_1027402 3300027614 Bacteria 981
276 Ga0209998_10000962 3300027717 Bacteria 7298
277 Ga0209813_10067392 3300027866 Bacteria 1156
278 Ga0209974_10000736 3300027876 Bacteria 11197
279 Ga0207428_10001793 3300027907 Bacteria 21978
280 Ga0268265_10004249 3300028380 Bacteria 10001
281 Ga0268264_10013946 3300028381 Bacteria 6607
282 Ga0307517_10020056 3300028786 Bacteria 8540
283 Ga0265332_10000732 3300031238 Bacteria 20494
284 Ga0265325_10001518 3300031241 Bacteria 16310
285 Ga0265325_10005918 3300031241 Bacteria 7494
286 Ga0265325_10071293 3300031241 Bacteria 1744
287 Ga0265325_10100954 3300031241 Bacteria 1412
288 Ga0265329_10010307 3300031242 Bacteria 3438
289 Ga0265340_10003622 3300031247 Bacteria 8687
290 Ga0265340_10095553 3300031247 Bacteria 1385
291 Ga0265339_10001116 3300031249 Bacteria 20311
292 Ga0265339_10011954 3300031249 Bacteria 5320
293 Ga0265331_10006555 3300031250 Bacteria 6866
294 Ga0265331_10109471 3300031250 Bacteria 1267
295 Ga0265316_10137477 3300031344 Bacteria 1838
296 Ga0265316_10161230 3300031344 Bacteria 1676
297 Ga0307513_10176719 3300031456 Bacteria 2004
298 Ga0307408_100210532 3300031548 Bacteria 1580
299 Ga0265313_10003835 3300031595 Bacteria 11864
300 Ga0265313_10007507 3300031595 Bacteria 7427
301 Ga0265313_10055829 3300031595 Bacteria 1869
302 Ga0265314_10003835 3300031711 Bacteria 14352
303 Ga0265342_10000258 3300031712 Bacteria 59570
304 Ga0265342_10025712 3300031712 Bacteria 3696
305 Ga0307413_10405823 3300031824 Bacteria 1069
306 Ga0307407_10067094 3300031903 Bacteria 2119
307 Ga0307409_100262057 3300031995 Bacteria 1587
308 Ga0307411_10212861 3300032005 Bacteria 1494
309 Ga0307415_100272701 3300032126 Bacteria 1387
310 Ga0373930_0010963 3300034816 Bacteria 1629
311 Ga0373950_0009099 3300034818 Bacteria 1577
312 Ga0373959_0006771 3300034820 Bacteria 1912
313 Ga0373938_0001079 3300034957 Bacteria 4392
314 Ga0373929_0002864 3300035085 Bacteria 3152
315 Ga0373940_0002243 3300035088 Bacteria 3718
316 Ga0373949_0002153 3300035090 Bacteria 5166
317 Ga0373952_0002050 3300035092 Bacteria 3628
318 Ga0373936_0190380 3300035113 Bacteria 903
319 Ga0373939_0001680 3300035114 Bacteria 5354
320 Ga0373941_0008396 3300035115 Bacteria 2562
321 Ga0373945_0030446 3300035116 Bacteria 1903
322 Ga0373960_0011101 3300035121 Bacteria 2212
323 Ga0373943_0324557 3300035170 Bacteria 878
324 Ga0373935_0316604 3300035692 Bacteria 1106
325 Ga0373935_0544383 3300035692 Bacteria 846
326 Ga0373927_0108287 3300035695 Bacteria 1810
327 Ga0373937_0881888 3300036401 Bacteria 843
328 Ga0373925_0271086 3300037068 Bacteria 1365
329 Ga0395900_0016660 3300037418 Bacteria 7496
330 Ga0395905_0000704 3300037471 Bacteria 44377
331 Ga0436364_0167179 3300037853 Bacteria 17951
332 Ga0436364_0317277 3300037853 Bacteria 900
333 Ga0436364_0335253 3300037853 Bacteria 76277
334 Ga0436364_1247966 3300037853 Bacteria 12498
335 Ga0395901_0010912 3300038443 Bacteria 9206
336 Ga0436365_0240233 3300039437 Bacteria 6675
337 Ga0436365_0302959 3300039437 Bacteria 2544
338 Ga0436365_0665259 3300039437 Bacteria 1025
339 Ga0436365_1069579 3300039437 Bacteria 1530
340 Ga0436365_1114955 3300039437 Bacteria 4490
341 Ga0436365_1646101 3300039437 Bacteria 1139
342 Ga0436360_0020476 3300039438 Bacteria 3853
343 Ga0436361_0136044 3300039447 Bacteria 7469
344 Ga0436363_0251431 3300039450 Bacteria 1885
345 Ga0436363_0490009 3300039450 Bacteria 2638
346 Ga0436363_1384763 3300039450 Bacteria 3301
347 Ga0436362_0280123 3300039453 Bacteria 1492
348 Ga0451576_0732102 3300045051 Bacteria 1039
349 Ga0495638_0041000 3300046460 Bacteria 2931
350 Ga0495638_0046573 3300046460 Bacteria 2724
351 Ga0495605_0056087 3300046474 Bacteria 1901
352 Ga0495605_0243317 3300046474 Bacteria 772
353 Ga0495630_0481330 3300046517 Bacteria 952
354 Ga0495621_0080442 3300046539 Bacteria 1214
355 Ga0495659_0125286 3300046664 Bacteria 1015
356 Ga0495658_0502899 3300046683 Bacteria 775
357 Ga0495669_0082359 3300046684 Bacteria 1478
358 Ga0495680_0094552 3300047322 Bacteria 2236
359 Ga0495685_079103 3300047447 Bacteria 1096
360 Ga0496100_0037625 3300048903 Bacteria 3060
361 Ga0496100_0084811 3300048903 Bacteria 2148
362 Ga0496101_0108779 3300048904 Bacteria 2084
363 Ga0496103_0002596 3300048906 Bacteria 11311
364 Ga0496104_0166362 3300048907 Bacteria 2115
365 Ga0496104_0301403 3300048907 Bacteria 1515
366 Ga0496105_0185260 3300048908 Bacteria 1704
367 Ga0496106_0035717 3300048909 Bacteria 3716
368 Ga0496107_0040869 3300048910 Bacteria 3329
369 Ga0496108_0028028 3300048911 Bacteria 4658
370 Ga0496109_0008888 3300048912 Bacteria 8555
371 Ga0496110_0176925 3300048913 Bacteria 1937
372 Ga0496110_0350514 3300048913 Bacteria 1345
373 Ga0496111_0294123 3300048914 Bacteria 1204
374 Ga0496114_0005989 3300048917 Bacteria 9574
375 Ga0496115_0031731 3300048918 Bacteria 4164
376 Ga0496115_0091671 3300048918 Bacteria 2484
377 Ga0496125_0034764 3300048928 Bacteria 4436
378 Ga0501031_0018531 3300049568 Bacteria 4531
379 Ga0501032_0003564 3300049569 Bacteria 11867
380 Ga0501032_0030094 3300049569 Bacteria 3724
381 Ga0501032_0032988 3300049569 Bacteria 3548
382 Ga0501032_0198538 3300049569 Bacteria 1309
383 Ga0501033_0022180 3300049570 Bacteria 4791
384 Ga0501033_0061658 3300049570 Bacteria 2763
385 Ga0501033_0260458 3300049570 Bacteria 1227
386 Ga0501034_0000516 3300049571 Bacteria 62005
387 Ga0501034_0000850 3300049571 Bacteria 45243
388 Ga0501034_0007739 3300049571 Bacteria 11422
389 Ga0501034_0025429 3300049571 Bacteria 6027
390 Ga0501034_0195360 3300049571 Bacteria 1983
391 Ga0501034_0242712 3300049571 Bacteria 1747
392 Ga0501034_0418243 3300049571 Bacteria 1262
393 Ga0501036_0000547 3300049572 Bacteria 26976
394 Ga0501036_0017164 3300049572 Bacteria 6051
395 Ga0501036_0038161 3300049572 Bacteria 4065
396 Ga0501036_0129334 3300049572 Bacteria 2132
397 Ga0501036_0319429 3300049572 Bacteria 1297
398 Ga0501036_0348534 3300049572 Bacteria 1236
399 Ga0501037_0017976 3300049573 Bacteria 5204
400 Ga0501037_0024616 3300049573 Bacteria 4451
401 Ga0501037_0082125 3300049573 Bacteria 2335
402 Ga0501037_0150685 3300049573 Bacteria 1662
403 Ga0501037_0289992 3300049573 Bacteria 1138
404 Ga0501037_0318904 3300049573 Bacteria 1076
405 Ga0501038_0045667 3300049574 Bacteria 3801
406 Ga0501038_0131386 3300049574 Bacteria 2055
407 Ga0501038_0315661 3300049574 Bacteria 1223
408 Ga0501039_0003067 3300049575 Bacteria 12495
409 Ga0501039_0076329 3300049575 Bacteria 2605
410 Ga0501040_0278221 3300049576 Bacteria 1195
411 Ga0501043_0003257 3300049579 Bacteria 13387
412 Ga0501043_0003673 3300049579 Bacteria 12604
413 Ga0501043_0018936 3300049579 Bacteria 5403
414 Ga0501043_0091383 3300049579 Bacteria 2393
415 Ga0501046_0092974 3300049580 Bacteria 2318
416 Ga0501046_0386307 3300049580 Bacteria 1012
417 Ga0501047_0000455 3300049581 Bacteria 45200
418 Ga0501047_0024148 3300049581 Bacteria 5839
419 Ga0501047_0128575 3300049581 Bacteria 2413
420 Ga0501047_0142177 3300049581 Bacteria 2277
421 Ga0501047_0801627 3300049581 Bacteria 757
422 Ga0501048_0002034 3300049582 Bacteria 15361
423 Ga0501048_0158484 3300049582 Bacteria 1601
424 Ga0501068_0118921 3300049584 Bacteria 1646
425 Ga0501068_0137882 3300049584 Bacteria 1528
426 Ga0501068_0328061 3300049584 Bacteria 982
427 Ga0501069_0005711 3300049585 Bacteria 6483
428 Ga0501070_0003722 3300049586 Bacteria 13172
429 Ga0501070_0020920 3300049586 Bacteria 5488
430 Ga0501070_0038661 3300049586 Bacteria 3981
431 Ga0501070_0076879 3300049586 Bacteria 2763
432 Ga0501071_0195691 3300049587 Bacteria 1517
433 Ga0501072_0003523 3300049588 Bacteria 11791
434 Ga0501073_0011899 3300049589 Bacteria 6352
435 Ga0501073_0036690 3300049589 Bacteria 3481
436 Ga0501073_0305903 3300049589 Bacteria 1097
437 Ga0501073_0521637 3300049589 Bacteria 821
438 Ga0501074_0024490 3300049590 Bacteria 4387
439 Ga0501076_0319178 3300049592 Bacteria 1274
440 Ga0501079_0334186 3300049741 Bacteria 1187
441 Ga0501080_0001026 3300049742 Bacteria 22970
442 Ga0501080_0012079 3300049742 Bacteria 7910
443 Ga0501080_0094108 3300049742 Bacteria 2782
444 Ga0501083_0010516 3300049744 Bacteria 6511
445 Ga0501083_0026213 3300049744 Bacteria 4031
446 Ga0501083_0030240 3300049744 Bacteria 3721
447 Ga0501083_0066710 3300049744 Bacteria 2396
448 Ga0501083_0457591 3300049744 Bacteria 830
449 Ga0501035_0001156 3300049822 Bacteria 27546
450 Ga0501035_0029743 3300049822 Bacteria 4981
451 Ga0501035_0315892 3300049822 Bacteria 1313
452 Ga0501035_0428939 3300049822 Bacteria 1096
453 Ga0501044_0024576 3300049823 Bacteria 6393
454 Ga0501044_0057824 3300049823 Bacteria 3978
455 Ga0501044_0237298 3300049823 Bacteria 1768
456 Ga0501044_0242762 3300049823 Bacteria 1744
457 Ga0501044_0551295 3300049823 Bacteria 1050
458 Ga0501044_0576450 3300049823 Bacteria 1020
459 Ga0501045_0347879 3300049824 Bacteria 1103
460 nmdc:mga00v17_82170_c1 3300050491 Bacteria 2013
461 nmdc:mga0yw44_107588_c1 3300050492 Bacteria 1784
462 nmdc:mga06z11_182691_c1 3300050494 Bacteria 1210
463 nmdc:mga06z11_372957_c1 3300050494 Bacteria 856
464 nmdc:mga04h51_148759_c1 3300050495 Bacteria 893
465 nmdc:mga07m45_165553_c1 3300050496 Bacteria 1284
466 nmdc:mga07m45_32490_c1 3300050496 Bacteria 2706
467 nmdc:mga07m45_85170_c1 3300050496 Bacteria 1807
468 nmdc:mga08y16_439554_c1 3300050511 Bacteria 1332
469 nmdc:mga0n895_1284_c1 3300050512 Bacteria 18562
470 nmdc:mga0n895_574709_c1 3300050512 Bacteria 1131
471 nmdc:mga0rr50_366859_c1 3300050513 Bacteria 1213
472 nmdc:mga0a205_1140_c1 3300050515 Bacteria 22064
473 Ga0500578_0247208 3300053086 Bacteria 1076
474 Ga0500644_0000616 3300053088 Bacteria 13364
475 Ga0500651_0032245 3300053093 Bacteria 3302
476 Ga0500566_0141170 3300053094 Bacteria 1278
477 Ga0500641_0015291 3300053096 Bacteria 2845
478 Ga0500641_0038549 3300053096 Bacteria 1921
479 Ga0500572_080261 3300053111 Bacteria 1021
480 Ga0500593_003255 3300053117 Bacteria 6114
481 Ga0500594_0046216 3300053118 Bacteria 1211
482 Ga0500595_000002 3300053119 Bacteria 1074388
483 Ga0500577_0246005 3300053142 Bacteria 777
484 Ga0500577_0261134 3300053142 Bacteria 753
485 Ga0500616_0000002 3300053153 Bacteria 1611257
486 Ga0500616_0049676 3300053153 Bacteria 2218
487 Ga0500625_045483 3300053729 Bacteria 2049
488 Ga0500645_000012 3300053730 Bacteria 168579
489 Ga0500601_001022 3300053737 Bacteria 3218
490 Ga0501082_0000016 3300060353 Bacteria 115081
491 Ga0501082_0070028 3300060353 Bacteria 3020
492 Ga0501082_0139293 3300060353 Bacteria 2106
493 Ga0501082_0172625 3300060353 Bacteria 1880
494 2643730102 2643221541 Bacteria 5498788
495 2643757154 2643221547 Bacteria 4740017
496 2644045588 2643221606 Bacteria 5588032
497 2644392786 2643221671 Bacteria 5496681
498 2644549578 2643221699 Bacteria 5731501
499 2644732516 2643221733 Bacteria 5690728
500 2830079190 2830075706 Bacteria 3855215
501 2841915662 2841911363 Bacteria 6173697
502 2841920864 2841917233 Bacteria 6173500
503 2869257047 2869256925 Bacteria 6981691
504 2919085884 2919085039 Bacteria 4532964
505 Ga0501034_0012629
506 JGI24746J21847_1000187
507 JGI24747J21853_1005659
508 JGI24739J22299_10000841
509 JGI24737J22298_10000354
510 JGI24750J21931_1000271
511 JGI24745J21846_1000158
512 JGI24749J21850_1000812
513 JGI24744J21845_10006674
514 JGI24035J26624_1000301
515 JGI24033J26618_1016020
516 JGI24751J29686_10011272
517 JGI24751J29686_10033145
518 JGI25406J46586_10010387
519 JGI26145J50221_1001271
520 Ga0055536_1012680
521 JGI25405J52794_10034128
522 Ga0065715_10089022
523 Ga0065715_10169532
524 Ga0070658_10159734
525 Ga0070676_10003948
526 Ga0070683_100008259
527 Ga0070690_100000577
528 Ga0070690_100134746
529 Ga0070670_100216634
530 Ga0070670_100228110
531 Ga0070677_10001438
532 Ga0070677_10217322
533 Ga0068869_100006582
534 Ga0070666_10012088
535 Ga0070666_10147827
536 Ga0070680_100006307
537 Ga0070680_100226179
538 Ga0070682_100003225
539 Ga0068868_100405302
540 Ga0068868_100451612
541 Ga0070660_100004146
542 Ga0070689_100014858
543 Ga0070689_100091327
544 Ga0070689_100138102
545 Ga0070691_10005385
546 Ga0070691_10286075
547 Ga0070687_100001224
548 Ga0070687_100044320
549 Ga0070661_100000804
550 Ga0070661_100268522
551 Ga0070692_10000837
552 Ga0070668_100006098
553 Ga0070669_100006161
554 Ga0070669_100412682
555 Ga0070675_100017427
556 Ga0070671_100009037
557 Ga0070671_100048819
558 Ga0070674_100004299
559 Ga0070673_100006345
560 Ga0070688_100000558
561 Ga0070688_100251936
562 Ga0070659_100024392
563 Ga0070667_100008212
564 Ga0070703_10011177
565 Ga0070709_10098327
566 Ga0070714_100031220
567 Ga0070713_100077384
568 Ga0070713_100164081
569 Ga0070710_10053652
570 Ga0070710_10207862
571 Ga0070701_10001856
572 Ga0070701_10405603
573 Ga0070711_100027090
574 Ga0070711_100111410
575 Ga0070705_100005648
576 Ga0070700_100003794
577 Ga0070700_100101699
578 Ga0070694_100041579
579 Ga0070708_100021889
580 Ga0070663_100003833
581 Ga0070678_100002855
582 Ga0070678_100095481
583 Ga0070662_100070943
584 Ga0070662_100126604
585 Ga0070681_10008839
586 Ga0068867_100012098
587 Ga0070685_10048175
588 Ga0070685_10061880
589 Ga0070685_10139263
590 Ga0070679_100010504
591 Ga0070684_100001753
592 Ga0070697_100341652
593 Ga0068853_100008092
594 Ga0070672_100004614
595 Ga0070686_100001565
596 Ga0070695_100217315
597 Ga0070696_100198575
598 Ga0070693_100002143
599 Ga0070665_100536717
600 Ga0070704_100004087
601 Ga0068855_100074740
602 Ga0070664_100028636
603 Ga0068857_100004864
604 Ga0068854_100005702
605 Ga0068856_100014335
606 Ga0068856_100061308
607 Ga0068856_100731318
608 Ga0070702_100007505
609 Ga0068852_100002326
610 Ga0068852_100147280
611 Ga0068859_100040171
612 Ga0068864_100006005
613 Ga0068864_100439536
614 Ga0068866_10000301
615 Ga0068866_10228290
616 Ga0068861_100005394
617 Ga0068851_10449435
618 Ga0068870_10000419
619 Ga0068863_100000340
620 Ga0068858_100036890
621 Ga0068858_100625117
622 Ga0068860_100037560
623 Ga0068860_100151051
624 Ga0068862_100009969
625 Ga0081455_10010585
626 Ga0081455_10111172
627 Ga0081540_1076063
628 Ga0081540_1159726
629 Ga0081539_10016778
630 Ga0070717_10040793
631 Ga0075363_100022049
632 Ga0075364_10020890
633 Ga0070712_100256184
634 Ga0075362_10049429
635 Ga0075369_10077093
636 Ga0075366_10012093
637 Ga0097621_100000880
638 Ga0075370_10096540
639 Ga0075370_10113281
640 Ga0075370_10169307
641 Ga0068871_100000301
642 Ga0068871_100526067
643 Ga0075433_10006405
644 Ga0075434_100007954
645 Ga0068865_100003905
646 Ga0097620_100040169
647 Ga0105250_10027060
648 Ga0105240_10043237
649 Ga0105240_10266730
650 Ga0111539_10020700
651 Ga0105245_10018996
652 Ga0105247_10002113
653 Ga0105243_10012907
654 Ga0105241_10001943
655 Ga0105248_10003102
656 Ga0105248_10126415
657 Ga0105237_10017102
658 Ga0105249_10001599
659 Ga0105249_10506316
660 Ga0105239_10024058
661 Ga0105239_10390121
662 Ga0105246_10017880
663 Ga0157373_10007508
664 Ga0157371_10008631
665 Ga0157370_10002130
666 Ga0157370_10442135
667 Ga0157374_10001695
668 Ga0157378_10003374
669 Ga0157378_10199685
670 Ga0163162_10055943
671 Ga0163162_10801502
672 Ga0157372_10004321
673 Ga0157372_10768335
674 Ga0157375_10019602
675 Ga0163163_10229268
676 Ga0163163_10539003
677 Ga0157380_10006382
678 Ga0157379_10006391
679 Ga0182005_1000055
680 Ga0163161_10009345
681 Ga0206356_11653084
682 Ga0213876_10011887
683 Ga0213876_10036527
684 Ga0213876_10117761
685 Ga0213875_10002533
686 Ga0207666_1000059
687 Ga0207673_1009757
688 Ga0209675_1000970
689 Ga0209676_1000089
690 Ga0209050_1008016
691 Ga0207697_10002326
692 Ga0207696_1021692
693 Ga0207653_10009705
694 Ga0207682_10002173
695 Ga0207682_10023530
696 Ga0207642_10012159
697 Ga0207710_10004879
698 Ga0207688_10000167
699 Ga0207688_10024680
700 Ga0207680_10025573
701 Ga0207647_10002561
702 Ga0207699_10283810
703 Ga0207645_10005337
704 Ga0207643_10000007
705 Ga0207654_10002202
706 Ga0207707_10014147
707 Ga0207707_10176301
708 Ga0207671_10173593
709 Ga0207693_10000563
710 Ga0207693_10405164
711 Ga0207660_10002332
712 Ga0207662_10000195
713 Ga0207662_10016418
714 Ga0207662_10101989
715 Ga0207657_10002386
716 Ga0207657_10373847
717 Ga0207649_10000944
718 Ga0207652_10009630
719 Ga0207681_10056284
720 Ga0207694_10090984
721 Ga0207650_10012289
722 Ga0207650_10226048
723 Ga0207650_10565010
724 Ga0207659_10002481
725 Ga0207687_10000072
726 Ga0207664_10161248
727 Ga0207644_10022392
728 Ga0207644_10125661
729 Ga0207690_10029980
730 Ga0207706_10008634
731 Ga0207706_10009459
732 Ga0207706_10437140
733 Ga0207686_10009296
734 Ga0207709_10002480
735 Ga0207670_10000792
736 Ga0207670_10094500
737 Ga0207669_10001742
738 Ga0207669_10044599
739 Ga0207704_10003278
740 Ga0207704_10285417
741 Ga0207665_10400739
742 Ga0207691_10009483
743 Ga0207691_10085978
744 Ga0207711_10001106
745 Ga0207711_10349899
746 Ga0207689_10000366
747 Ga0207689_10177914
748 Ga0207661_10010227
749 Ga0207661_10214140
750 Ga0207679_10000029
751 Ga0207667_10111576
752 Ga0207651_10000292
753 Ga0207651_10416019
754 Ga0207712_10010471
755 Ga0207668_10010650
756 Ga0207640_10001667
757 Ga0207658_10038839
758 Ga0207677_10042618
759 Ga0207703_10009816
760 Ga0207639_10013289
761 Ga0207678_10006759
762 Ga0207678_10763844
763 Ga0207708_10004100
764 Ga0207702_10011803
765 Ga0207702_10016294
766 Ga0207641_10004156
767 Ga0207648_10008435
768 Ga0207648_10020005
769 Ga0207676_10000182
770 Ga0207676_10248790
771 Ga0207674_10007304
772 Ga0207674_10116041
773 Ga0207675_100011726
774 Ga0207675_100712662
775 Ga0207683_10007517
776 Ga0207698_10005197
777 Ga0207698_10027150
778 Ga0209967_1016452
779 Ga0209970_1027402
780 Ga0209998_10000962
781 Ga0209813_10067392
782 Ga0209974_10000736
783 Ga0207428_10001793
784 Ga0268265_10004249
785 Ga0268264_10013946
786 Ga0307517_10020056
787 Ga0265332_10000732
788 Ga0265325_10001518
789 Ga0265325_10005918
790 Ga0265325_10071293
791 Ga0265325_10100954
792 Ga0265329_10010307
793 Ga0265340_10003622
794 Ga0265340_10095553
795 Ga0265339_10001116
796 Ga0265339_10011954
797 Ga0265331_10006555
798 Ga0265331_10109471
799 Ga0265316_10137477
800 Ga0265316_10161230
801 Ga0307513_10176719
802 Ga0307408_100210532
803 Ga0265313_10003835
804 Ga0265313_10007507
805 Ga0265313_10055829
806 Ga0265314_10003835
807 Ga0265342_10000258
808 Ga0265342_10025712
809 Ga0307413_10405823
810 Ga0307407_10067094
811 Ga0307409_100262057
812 Ga0307411_10212861
813 Ga0307415_100272701
814 Ga0373930_0010963
815 Ga0373950_0009099
816 Ga0373959_0006771
817 Ga0373938_0001079
818 Ga0373929_0002864
819 Ga0373940_0002243
820 Ga0373949_0002153
821 Ga0373952_0002050
822 Ga0373936_0190380
823 Ga0373939_0001680
824 Ga0373941_0008396
825 Ga0373945_0030446
826 Ga0373960_0011101
827 Ga0373943_0324557
828 Ga0373935_0316604
829 Ga0373935_0544383
830 Ga0373927_0108287
831 Ga0373937_0881888
832 Ga0373925_0271086
833 Ga0395900_0016660
834 Ga0395905_0000704
835 Ga0436364_0167179
836 Ga0436364_0317277
837 Ga0436364_0335253
838 Ga0436364_1247966
839 Ga0395901_0010912
840 Ga0436365_0240233
841 Ga0436365_0302959
842 Ga0436365_0665259
843 Ga0436365_1069579
844 Ga0436365_1114955
845 Ga0436365_1646101
846 Ga0436360_0020476
847 Ga0436361_0136044
848 Ga0436363_0251431
849 Ga0436363_0490009
850 Ga0436363_1384763
851 Ga0436362_0280123
852 Ga0451576_0732102
853 Ga0495638_0041000
854 Ga0495638_0046573
855 Ga0495605_0056087
856 Ga0495605_0243317
857 Ga0495630_0481330
858 Ga0495621_0080442
859 Ga0495659_0125286
860 Ga0495658_0502899
861 Ga0495669_0082359
862 Ga0495680_0094552
863 Ga0495685_079103
864 Ga0496100_0037625
865 Ga0496100_0084811
866 Ga0496101_0108779
867 Ga0496103_0002596
868 Ga0496104_0166362
869 Ga0496104_0301403
870 Ga0496105_0185260
871 Ga0496106_0035717
872 Ga0496107_0040869
873 Ga0496108_0028028
874 Ga0496109_0008888
875 Ga0496110_0176925
876 Ga0496110_0350514
877 Ga0496111_0294123
878 Ga0496114_0005989
879 Ga0496115_0031731
880 Ga0496115_0091671
881 Ga0496125_0034764
882 Ga0501031_0018531
883 Ga0501032_0003564
884 Ga0501032_0030094
885 Ga0501032_0032988
886 Ga0501032_0198538
887 Ga0501033_0022180
888 Ga0501033_0061658
889 Ga0501033_0260458
890 Ga0501034_0000516
891 Ga0501034_0000850
892 Ga0501034_0007739
893 Ga0501034_0025429
894 Ga0501034_0195360
895 Ga0501034_0242712
896 Ga0501034_0418243
897 Ga0501036_0000547
898 Ga0501036_0017164
899 Ga0501036_0038161
900 Ga0501036_0129334
901 Ga0501036_0319429
902 Ga0501036_0348534
903 Ga0501037_0017976
904 Ga0501037_0024616
905 Ga0501037_0082125
906 Ga0501037_0150685
907 Ga0501037_0289992
908 Ga0501037_0318904
909 Ga0501038_0045667
910 Ga0501038_0131386
911 Ga0501038_0315661
912 Ga0501039_0003067
913 Ga0501039_0076329
914 Ga0501040_0278221
915 Ga0501043_0003257
916 Ga0501043_0003673
917 Ga0501043_0018936
918 Ga0501043_0091383
919 Ga0501046_0092974
920 Ga0501046_0386307
921 Ga0501047_0000455
922 Ga0501047_0024148
923 Ga0501047_0128575
924 Ga0501047_0142177
925 Ga0501047_0801627
926 Ga0501048_0002034
927 Ga0501048_0158484
928 Ga0501068_0118921
929 Ga0501068_0137882
930 Ga0501068_0328061
931 Ga0501069_0005711
932 Ga0501070_0003722
933 Ga0501070_0020920
934 Ga0501070_0038661
935 Ga0501070_0076879
936 Ga0501071_0195691
937 Ga0501072_0003523
938 Ga0501073_0011899
939 Ga0501073_0036690
940 Ga0501073_0305903
941 Ga0501073_0521637
942 Ga0501074_0024490
943 Ga0501076_0319178
944 Ga0501079_0334186
945 Ga0501080_0001026
946 Ga0501080_0012079
947 Ga0501080_0094108
948 Ga0501083_0010516
949 Ga0501083_0026213
950 Ga0501083_0030240
951 Ga0501083_0066710
952 Ga0501083_0457591
953 Ga0501035_0001156
954 Ga0501035_0029743
955 Ga0501035_0315892
956 Ga0501035_0428939
957 Ga0501044_0024576
958 Ga0501044_0057824
959 Ga0501044_0237298
960 Ga0501044_0242762
961 Ga0501044_0551295
962 Ga0501044_0576450
963 Ga0501045_0347879
964 nmdc:mga00v17_82170_c1
965 nmdc:mga0yw44_107588_c1
966 nmdc:mga06z11_182691_c1
967 nmdc:mga06z11_372957_c1
968 nmdc:mga04h51_148759_c1
969 nmdc:mga07m45_165553_c1
970 nmdc:mga07m45_32490_c1
971 nmdc:mga07m45_85170_c1
972 nmdc:mga08y16_439554_c1
973 nmdc:mga0n895_1284_c1
974 nmdc:mga0n895_574709_c1
975 nmdc:mga0rr50_366859_c1
976 nmdc:mga0a205_1140_c1
977 Ga0500578_0247208
978 Ga0500644_0000616
979 Ga0500651_0032245
980 Ga0500566_0141170
981 Ga0500641_0015291
982 Ga0500641_0038549
983 Ga0500572_080261
984 Ga0500593_003255
985 Ga0500594_0046216
986 Ga0500595_000002
987 Ga0500577_0246005
988 Ga0500577_0261134
989 Ga0500616_0000002
990 Ga0500616_0049676
991 Ga0500625_045483
992 Ga0500645_000012
993 Ga0500601_001022
994 Ga0501082_0000016
995 Ga0501082_0070028
996 Ga0501082_0139293
997 Ga0501082_0172625
998 2643730102
999 2643757154
1000 2644045588
1001 2644392786
1002 2644549578
1003 2644732516
1004 2830079190
1005 2841915662
1006 2841920864
1007 2869257047
1008 2919085884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

46

258

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kgb-assembly1.cif.gz_A structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.9771 3 226
4kgb-assembly1.cif.gz_B structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.977 3 226
5dbn-assembly2.cif.gz_E crystal structure of atoda complex 0.974 3 215
1ooz-assembly1.cif.gz_A deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9739 3 226
1o9l-assembly2.cif.gz_C succinate:coenzyme-a transferase (pig heart) 0.9737 3 226
ID Description Score Start End Superfamily
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9764 1 215 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9745 3 217 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9669 1 229 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.963 1 215 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9513 4 231 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A3C0Y3Z3-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9974 1 79 GO:0008410
AF-A0A257PXQ8-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9973 1 107 GO:0008410
AF-A0A4V1QWY8-F1-model_v4 deleted 0.9958 26 102
AF-A0A5A7MRX1-F1-model_v4 merged 0.9946 1 155
AF-A0A2V6D029-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9938 1 93 GO:0008410

Map