F456271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 504 | 245 | 504 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_16708_c1|nmdc:mga05p37_16708_c1_3687_4733 |
| Length | 348 |
| Sequence | MPSQSGPESAFVADKPFGGGPLGAPGTVEGRALARKVLETEAAAILALVDRLDARFDCAVQLLLQCKGRVILTGMGKSGIICQKIAATLSSTGTASFFLHPAEAMHGDLGVIRGDDVVIALSYSGETDELLRLLESIRRLGAKLIAITGGPASTLAQAADVALDCSVAEEACPMNLVPTASTTAALAIGDALAMTLLVEKGFRQEDFANLHPGGKIGKRLMRVSALMHSGKQCPIVRTETRMRDVIYEMSSKGLGMTCVVDGDDVLLGIITDGDLRRRMERGTEILDLTAADVMTRNPIAVSPDTLAAEALNIMEQRKITAIVVADADQAPRVAGVVHLHDLWRLEMF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 140 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 141 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 142 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 143 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 144 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 149 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 152 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 160 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 167 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 168 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 169 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 205 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 227 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 243 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.79 |
| Nodule | 0 |
| Rhizoplane | 2.58 |
| Rhizosphere | 95.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10116129 | 3300005290 | Bacteria | 1740 |
| 2 | Ga0065712_10136681 | 3300005290 | Bacteria | 1491 |
| 3 | Ga0065715_10041229 | 3300005293 | Bacteria | 1092 |
| 4 | Ga0070658_10125321 | 3300005327 | Bacteria | 2137 |
| 5 | Ga0070676_10127162 | 3300005328 | Bacteria | 1607 |
| 6 | Ga0070683_100201845 | 3300005329 | Bacteria | 1888 |
| 7 | Ga0068869_100070458 | 3300005334 | Bacteria | 2587 |
| 8 | Ga0068869_100348737 | 3300005334 | Bacteria | 1206 |
| 9 | Ga0070666_10016739 | 3300005335 | Bacteria | 4694 |
| 10 | Ga0070680_100068639 | 3300005336 | Bacteria | 2910 |
| 11 | Ga0068868_100119246 | 3300005338 | Bacteria | 2151 |
| 12 | Ga0068868_100134555 | 3300005338 | Bacteria | 2025 |
| 13 | Ga0068868_100191021 | 3300005338 | Bacteria | 1703 |
| 14 | Ga0070660_100032966 | 3300005339 | Bacteria | 3901 |
| 15 | Ga0070691_10001081 | 3300005341 | Bacteria | 11289 |
| 16 | Ga0070668_100259686 | 3300005347 | Bacteria | 1444 |
| 17 | Ga0070669_100073654 | 3300005353 | Bacteria | 2530 |
| 18 | Ga0070675_100001125 | 3300005354 | Bacteria | 19310 |
| 19 | Ga0070675_100030018 | 3300005354 | Bacteria | 4387 |
| 20 | Ga0070671_100012471 | 3300005355 | Bacteria | 6843 |
| 21 | Ga0070671_100049537 | 3300005355 | Bacteria | 3494 |
| 22 | Ga0070674_100002729 | 3300005356 | Bacteria | 9764 |
| 23 | Ga0070673_100102408 | 3300005364 | Bacteria | 2361 |
| 24 | Ga0070673_100122252 | 3300005364 | Bacteria | 2174 |
| 25 | Ga0070673_100346856 | 3300005364 | Bacteria | 1317 |
| 26 | Ga0070673_100455276 | 3300005364 | Bacteria | 1152 |
| 27 | Ga0070688_100041542 | 3300005365 | Bacteria | 2824 |
| 28 | Ga0070688_100138921 | 3300005365 | Bacteria | 1648 |
| 29 | Ga0070659_100127559 | 3300005366 | Bacteria | 2065 |
| 30 | Ga0070667_100004898 | 3300005367 | Bacteria | 11215 |
| 31 | Ga0070667_100194485 | 3300005367 | Bacteria | 1798 |
| 32 | Ga0070709_10017425 | 3300005434 | Bacteria | 4120 |
| 33 | Ga0070713_100028496 | 3300005436 | Bacteria | 4410 |
| 34 | Ga0070701_10001830 | 3300005438 | Bacteria | 8046 |
| 35 | Ga0070711_100074170 | 3300005439 | Bacteria | 2406 |
| 36 | Ga0070705_100001314 | 3300005440 | Bacteria | 13321 |
| 37 | Ga0070705_100029176 | 3300005440 | Bacteria | 3031 |
| 38 | Ga0070700_100001496 | 3300005441 | Bacteria | 11632 |
| 39 | Ga0070694_100003841 | 3300005444 | Bacteria | 8975 |
| 40 | Ga0070708_100025380 | 3300005445 | Bacteria | 5066 |
| 41 | Ga0070708_100142447 | 3300005445 | Bacteria | 2224 |
| 42 | Ga0070678_100150675 | 3300005456 | Bacteria | 1873 |
| 43 | Ga0070662_100083365 | 3300005457 | Bacteria | 2386 |
| 44 | Ga0070662_100149275 | 3300005457 | Bacteria | 1818 |
| 45 | Ga0068867_100024164 | 3300005459 | Bacteria | 4355 |
| 46 | Ga0068867_100092604 | 3300005459 | Bacteria | 2296 |
| 47 | Ga0068867_100324171 | 3300005459 | Bacteria | 1277 |
| 48 | Ga0070706_100188670 | 3300005467 | Bacteria | 1926 |
| 49 | Ga0070707_100046718 | 3300005468 | Bacteria | 4144 |
| 50 | Ga0070707_100575084 | 3300005468 | Bacteria | 1089 |
| 51 | Ga0070698_100058391 | 3300005471 | Bacteria | 3901 |
| 52 | Ga0070698_100229144 | 3300005471 | Bacteria | 1791 |
| 53 | Ga0070679_100025481 | 3300005530 | Bacteria | 5805 |
| 54 | Ga0070679_100043229 | 3300005530 | Bacteria | 4488 |
| 55 | Ga0070684_100105093 | 3300005535 | Bacteria | 2527 |
| 56 | Ga0070684_100290842 | 3300005535 | Bacteria | 1498 |
| 57 | Ga0070697_100210647 | 3300005536 | Bacteria | 1654 |
| 58 | Ga0070672_100056015 | 3300005543 | Bacteria | 3090 |
| 59 | Ga0070672_100211092 | 3300005543 | Bacteria | 1626 |
| 60 | Ga0070686_100001857 | 3300005544 | Bacteria | 11778 |
| 61 | Ga0070695_100007402 | 3300005545 | Bacteria | 6512 |
| 62 | Ga0070696_100009529 | 3300005546 | Bacteria | 6500 |
| 63 | Ga0070696_100197976 | 3300005546 | Bacteria | 1498 |
| 64 | Ga0070665_100000114 | 3300005548 | Bacteria | 151271 |
| 65 | Ga0070665_100014083 | 3300005548 | Bacteria | 8038 |
| 66 | Ga0070665_100138593 | 3300005548 | Bacteria | 2436 |
| 67 | Ga0070704_100046941 | 3300005549 | Bacteria | 3016 |
| 68 | Ga0070704_100220743 | 3300005549 | Bacteria | 1541 |
| 69 | Ga0070704_100234113 | 3300005549 | Bacteria | 1500 |
| 70 | Ga0068855_100007855 | 3300005563 | Bacteria | 12890 |
| 71 | Ga0068855_100527750 | 3300005563 | Bacteria | 1280 |
| 72 | Ga0068854_100010165 | 3300005578 | Bacteria | 6097 |
| 73 | Ga0068854_100024065 | 3300005578 | Bacteria | 4166 |
| 74 | Ga0068854_100266721 | 3300005578 | Bacteria | 1373 |
| 75 | Ga0070702_100040715 | 3300005615 | Bacteria | 2601 |
| 76 | Ga0070702_100091819 | 3300005615 | Bacteria | 1843 |
| 77 | Ga0068852_100162054 | 3300005616 | Bacteria | 2089 |
| 78 | Ga0068859_100014186 | 3300005617 | Bacteria | 7991 |
| 79 | Ga0068859_100313296 | 3300005617 | Bacteria | 1663 |
| 80 | Ga0068859_100345753 | 3300005617 | Bacteria | 1582 |
| 81 | Ga0068864_100030833 | 3300005618 | Bacteria | 4546 |
| 82 | Ga0068866_10010088 | 3300005718 | Bacteria | 4039 |
| 83 | Ga0068866_10153419 | 3300005718 | Bacteria | 1336 |
| 84 | Ga0068861_100001397 | 3300005719 | Bacteria | 15173 |
| 85 | Ga0068861_100036631 | 3300005719 | Bacteria | 3643 |
| 86 | Ga0068861_100097598 | 3300005719 | Bacteria | 2331 |
| 87 | Ga0068861_100106119 | 3300005719 | Bacteria | 2243 |
| 88 | Ga0068861_100347536 | 3300005719 | Bacteria | 1300 |
| 89 | Ga0068861_100457237 | 3300005719 | Bacteria | 1145 |
| 90 | Ga0068863_100003994 | 3300005841 | Bacteria | 14562 |
| 91 | Ga0068863_100120582 | 3300005841 | Bacteria | 2500 |
| 92 | Ga0068863_100350835 | 3300005841 | Bacteria | 1437 |
| 93 | Ga0068858_100000761 | 3300005842 | Bacteria | 33790 |
| 94 | Ga0068858_100007567 | 3300005842 | Bacteria | 10492 |
| 95 | Ga0068858_100048637 | 3300005842 | Bacteria | 3928 |
| 96 | Ga0068858_100589638 | 3300005842 | Bacteria | 1078 |
| 97 | Ga0068860_100120173 | 3300005843 | Bacteria | 2515 |
| 98 | Ga0068860_100176456 | 3300005843 | Bacteria | 2065 |
| 99 | Ga0068862_100000343 | 3300005844 | Bacteria | 50391 |
| 100 | Ga0068862_100025130 | 3300005844 | Bacteria | 5000 |
| 101 | Ga0068862_100054545 | 3300005844 | Bacteria | 3422 |
| 102 | Ga0068862_100108009 | 3300005844 | Bacteria | 2440 |
| 103 | Ga0081539_10011075 | 3300005985 | Bacteria | 7207 |
| 104 | Ga0070717_10059812 | 3300006028 | Bacteria | 3154 |
| 105 | Ga0070717_10470118 | 3300006028 | Bacteria | 1135 |
| 106 | Ga0075368_10103880 | 3300006042 | Bacteria | 1168 |
| 107 | Ga0070716_100017576 | 3300006173 | Bacteria | 3710 |
| 108 | Ga0070716_100042379 | 3300006173 | Bacteria | 2541 |
| 109 | Ga0075367_10011253 | 3300006178 | Bacteria | 4726 |
| 110 | Ga0075367_10215139 | 3300006178 | Bacteria | 1202 |
| 111 | Ga0075366_10010282 | 3300006195 | Bacteria | 5250 |
| 112 | Ga0097621_100000066 | 3300006237 | Bacteria | 54619 |
| 113 | Ga0097621_100003865 | 3300006237 | Bacteria | 10377 |
| 114 | Ga0097621_100011699 | 3300006237 | Bacteria | 6477 |
| 115 | Ga0097621_100135923 | 3300006237 | Bacteria | 2097 |
| 116 | Ga0068871_100000170 | 3300006358 | Bacteria | 43522 |
| 117 | Ga0068871_100016674 | 3300006358 | Bacteria | 5541 |
| 118 | Ga0075428_100000108 | 3300006844 | Bacteria | 70319 |
| 119 | Ga0075428_100032880 | 3300006844 | Bacteria | 5727 |
| 120 | Ga0075428_100062654 | 3300006844 | Bacteria | 4071 |
| 121 | Ga0075428_100103786 | 3300006844 | Bacteria | 3100 |
| 122 | Ga0075430_100043470 | 3300006846 | Bacteria | 3797 |
| 123 | Ga0075430_100094261 | 3300006846 | Bacteria | 2503 |
| 124 | Ga0075431_100052275 | 3300006847 | Bacteria | 4212 |
| 125 | Ga0075431_100055778 | 3300006847 | Bacteria | 4076 |
| 126 | Ga0075431_100200466 | 3300006847 | Bacteria | 2042 |
| 127 | Ga0075433_10033716 | 3300006852 | Bacteria | 4391 |
| 128 | Ga0075433_10039685 | 3300006852 | Bacteria | 4072 |
| 129 | Ga0075433_10094658 | 3300006852 | Bacteria | 2643 |
| 130 | Ga0075434_100013487 | 3300006871 | Bacteria | 7781 |
| 131 | Ga0075434_100056443 | 3300006871 | Bacteria | 3902 |
| 132 | Ga0075434_100061081 | 3300006871 | Bacteria | 3748 |
| 133 | Ga0075434_100106969 | 3300006871 | Bacteria | 2807 |
| 134 | Ga0075434_100193581 | 3300006871 | Bacteria | 2054 |
| 135 | Ga0075436_100001888 | 3300006914 | Bacteria | 14395 |
| 136 | Ga0075436_100005597 | 3300006914 | Bacteria | 8621 |
| 137 | Ga0075436_100039290 | 3300006914 | Bacteria | 3266 |
| 138 | Ga0075436_100143058 | 3300006914 | Bacteria | 1681 |
| 139 | Ga0075436_100166813 | 3300006914 | Bacteria | 1554 |
| 140 | Ga0097620_100014186 | 3300006931 | Bacteria | 7991 |
| 141 | Ga0097620_100313295 | 3300006931 | Bacteria | 1663 |
| 142 | Ga0097620_100345752 | 3300006931 | Bacteria | 1582 |
| 143 | Ga0075435_100001969 | 3300007076 | Bacteria | 13393 |
| 144 | Ga0075435_100002082 | 3300007076 | Bacteria | 13131 |
| 145 | Ga0075435_100068091 | 3300007076 | Bacteria | 2899 |
| 146 | Ga0075435_100309533 | 3300007076 | Bacteria | 1351 |
| 147 | Ga0105240_10360214 | 3300009093 | Bacteria | 1648 |
| 148 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 149 | Ga0111539_10001440 | 3300009094 | Bacteria | 31737 |
| 150 | Ga0111539_10004657 | 3300009094 | Bacteria | 17928 |
| 151 | Ga0111539_10008383 | 3300009094 | Bacteria | 13151 |
| 152 | Ga0111539_10022916 | 3300009094 | Bacteria | 7668 |
| 153 | Ga0111539_10043543 | 3300009094 | Bacteria | 5380 |
| 154 | Ga0111539_10230546 | 3300009094 | Bacteria | 2156 |
| 155 | Ga0111539_10387939 | 3300009094 | Bacteria | 1626 |
| 156 | Ga0111539_10712853 | 3300009094 | Bacteria | 1168 |
| 157 | Ga0105247_10007600 | 3300009101 | Bacteria | 6638 |
| 158 | Ga0105247_10037110 | 3300009101 | Bacteria | 2973 |
| 159 | Ga0114129_10001367 | 3300009147 | Bacteria | 32804 |
| 160 | Ga0114129_10008634 | 3300009147 | Bacteria | 14527 |
| 161 | Ga0114129_10029691 | 3300009147 | Bacteria | 7742 |
| 162 | Ga0114129_10035583 | 3300009147 | Bacteria | 7035 |
| 163 | Ga0114129_10052953 | 3300009147 | Bacteria | 5694 |
| 164 | Ga0114129_10091638 | 3300009147 | Bacteria | 4211 |
| 165 | Ga0114129_10141969 | 3300009147 | Bacteria | 3291 |
| 166 | Ga0114129_10185611 | 3300009147 | Bacteria | 2827 |
| 167 | Ga0114129_10196086 | 3300009147 | Bacteria | 2738 |
| 168 | Ga0114129_10200768 | 3300009147 | Bacteria | 2701 |
| 169 | Ga0114129_10272558 | 3300009147 | Bacteria | 2264 |
| 170 | Ga0114129_10513233 | 3300009147 | Bacteria | 1564 |
| 171 | Ga0114129_10747665 | 3300009147 | Bacteria | 1252 |
| 172 | Ga0105243_10011387 | 3300009148 | Bacteria | 6731 |
| 173 | Ga0105243_10029935 | 3300009148 | Bacteria | 4189 |
| 174 | Ga0105243_10454146 | 3300009148 | Bacteria | 1203 |
| 175 | Ga0105242_10015839 | 3300009176 | Bacteria | 5857 |
| 176 | Ga0105242_10045751 | 3300009176 | Bacteria | 3548 |
| 177 | Ga0105242_10059278 | 3300009176 | Bacteria | 3140 |
| 178 | Ga0105242_10356893 | 3300009176 | Bacteria | 1352 |
| 179 | Ga0105242_10555040 | 3300009176 | Bacteria | 1102 |
| 180 | Ga0105248_10021247 | 3300009177 | Bacteria | 7192 |
| 181 | Ga0105248_10027819 | 3300009177 | Bacteria | 6295 |
| 182 | Ga0105248_10125247 | 3300009177 | Bacteria | 2898 |
| 183 | Ga0105248_10132324 | 3300009177 | Bacteria | 2814 |
| 184 | Ga0105248_10150831 | 3300009177 | Bacteria | 2622 |
| 185 | Ga0105248_10160333 | 3300009177 | Bacteria | 2537 |
| 186 | Ga0105248_10226985 | 3300009177 | Bacteria | 2102 |
| 187 | Ga0105248_10266627 | 3300009177 | Bacteria | 1928 |
| 188 | Ga0105248_10269290 | 3300009177 | Bacteria | 1918 |
| 189 | Ga0105248_10697422 | 3300009177 | Bacteria | 1145 |
| 190 | Ga0105237_10132969 | 3300009545 | Bacteria | 2482 |
| 191 | Ga0105249_10191582 | 3300009553 | Bacteria | 1996 |
| 192 | Ga0105249_10313208 | 3300009553 | Bacteria | 1578 |
| 193 | Ga0163162_10044785 | 3300013306 | Bacteria | 4432 |
| 194 | Ga0163162_10241941 | 3300013306 | Bacteria | 1935 |
| 195 | Ga0157372_10182681 | 3300013307 | Bacteria | 2428 |
| 196 | Ga0163163_10005222 | 3300014325 | Bacteria | 11201 |
| 197 | Ga0163163_10054390 | 3300014325 | Bacteria | 3955 |
| 198 | Ga0163163_10199311 | 3300014325 | Bacteria | 2050 |
| 199 | Ga0157380_10170408 | 3300014326 | Bacteria | 1902 |
| 200 | Ga0157380_10197531 | 3300014326 | Bacteria | 1782 |
| 201 | Ga0157380_10312766 | 3300014326 | Bacteria | 1452 |
| 202 | Ga0157379_10083672 | 3300014968 | Bacteria | 2860 |
| 203 | Ga0157376_10019477 | 3300014969 | Bacteria | 5232 |
| 204 | Ga0157376_10038828 | 3300014969 | Bacteria | 3877 |
| 205 | Ga0157376_10063002 | 3300014969 | Bacteria | 3122 |
| 206 | Ga0157376_10076491 | 3300014969 | Bacteria | 2860 |
| 207 | Ga0157376_10216419 | 3300014969 | Bacteria | 1771 |
| 208 | Ga0207710_10041597 | 3300025900 | Bacteria | 2039 |
| 209 | Ga0207699_10047251 | 3300025906 | Bacteria | 2523 |
| 210 | Ga0207645_10000802 | 3300025907 | Bacteria | 26290 |
| 211 | Ga0207645_10005752 | 3300025907 | Bacteria | 8947 |
| 212 | Ga0207645_10053489 | 3300025907 | Bacteria | 2580 |
| 213 | Ga0207705_10082523 | 3300025909 | Bacteria | 2344 |
| 214 | Ga0207707_10146346 | 3300025912 | Bacteria | 2065 |
| 215 | Ga0207695_10115098 | 3300025913 | Bacteria | 2664 |
| 216 | Ga0207695_10123157 | 3300025913 | Bacteria | 2559 |
| 217 | Ga0207695_10157746 | 3300025913 | Bacteria | 2203 |
| 218 | Ga0207662_10051424 | 3300025918 | Bacteria | 2452 |
| 219 | Ga0207662_10148810 | 3300025918 | Bacteria | 1488 |
| 220 | Ga0207657_10015006 | 3300025919 | Bacteria | 7523 |
| 221 | Ga0207652_10039804 | 3300025921 | Bacteria | 3990 |
| 222 | Ga0207652_10147658 | 3300025921 | Bacteria | 2105 |
| 223 | Ga0207646_10063295 | 3300025922 | Bacteria | 3303 |
| 224 | Ga0207646_10178232 | 3300025922 | Bacteria | 1919 |
| 225 | Ga0207646_10281606 | 3300025922 | Bacteria | 1502 |
| 226 | Ga0207681_10014159 | 3300025923 | Bacteria | 4949 |
| 227 | Ga0207681_10020674 | 3300025923 | Bacteria | 4175 |
| 228 | Ga0207681_10119095 | 3300025923 | Bacteria | 1933 |
| 229 | Ga0207681_10155509 | 3300025923 | Bacteria | 1718 |
| 230 | Ga0207659_10000918 | 3300025926 | Bacteria | 17553 |
| 231 | Ga0207687_10354120 | 3300025927 | Bacteria | 1197 |
| 232 | Ga0207664_10253004 | 3300025929 | Bacteria | 1538 |
| 233 | Ga0207644_10133194 | 3300025931 | Bacteria | 1905 |
| 234 | Ga0207690_10028639 | 3300025932 | Bacteria | 3532 |
| 235 | Ga0207706_10046548 | 3300025933 | Bacteria | 3840 |
| 236 | Ga0207706_10051795 | 3300025933 | Bacteria | 3625 |
| 237 | Ga0207706_10079599 | 3300025933 | Bacteria | 2881 |
| 238 | Ga0207706_10343396 | 3300025933 | Bacteria | 1298 |
| 239 | Ga0207706_10426166 | 3300025933 | Unclassified | 1149 |
| 240 | Ga0207686_10003167 | 3300025934 | Bacteria | 8856 |
| 241 | Ga0207686_10006109 | 3300025934 | Bacteria | 6470 |
| 242 | Ga0207709_10077339 | 3300025935 | Bacteria | 2133 |
| 243 | Ga0207670_10277892 | 3300025936 | Bacteria | 1304 |
| 244 | Ga0207669_10031547 | 3300025937 | Bacteria | 2962 |
| 245 | Ga0207669_10055761 | 3300025937 | Bacteria | 2395 |
| 246 | Ga0207669_10163940 | 3300025937 | Bacteria | 1574 |
| 247 | Ga0207704_10030247 | 3300025938 | Bacteria | 3033 |
| 248 | Ga0207704_10308660 | 3300025938 | Bacteria | 1215 |
| 249 | Ga0207665_10053476 | 3300025939 | Bacteria | 2722 |
| 250 | Ga0207691_10236552 | 3300025940 | Bacteria | 1580 |
| 251 | Ga0207711_10015131 | 3300025941 | Bacteria | 6407 |
| 252 | Ga0207711_10023851 | 3300025941 | Bacteria | 5122 |
| 253 | Ga0207711_10028851 | 3300025941 | Bacteria | 4674 |
| 254 | Ga0207711_10043611 | 3300025941 | Bacteria | 3827 |
| 255 | Ga0207711_10102304 | 3300025941 | Bacteria | 2536 |
| 256 | Ga0207711_10215339 | 3300025941 | Bacteria | 1755 |
| 257 | Ga0207711_10321412 | 3300025941 | Bacteria | 1430 |
| 258 | Ga0207689_10042602 | 3300025942 | Bacteria | 3754 |
| 259 | Ga0207689_10079854 | 3300025942 | Bacteria | 2688 |
| 260 | Ga0207689_10131665 | 3300025942 | Bacteria | 2058 |
| 261 | Ga0207661_10129304 | 3300025944 | Bacteria | 2161 |
| 262 | Ga0207661_10237900 | 3300025944 | Bacteria | 1615 |
| 263 | Ga0207661_10352003 | 3300025944 | Bacteria | 1329 |
| 264 | Ga0207667_10310570 | 3300025949 | Bacteria | 1610 |
| 265 | Ga0207651_10003153 | 3300025960 | Bacteria | 8044 |
| 266 | Ga0207651_10474271 | 3300025960 | Bacteria | 1077 |
| 267 | Ga0207712_10040818 | 3300025961 | Bacteria | 3187 |
| 268 | Ga0207712_10148438 | 3300025961 | Bacteria | 1808 |
| 269 | Ga0207712_10256730 | 3300025961 | Bacteria | 1415 |
| 270 | Ga0207668_10192863 | 3300025972 | Bacteria | 1616 |
| 271 | Ga0207640_10001184 | 3300025981 | Bacteria | 14256 |
| 272 | Ga0207640_10028496 | 3300025981 | Bacteria | 3416 |
| 273 | Ga0207640_10029023 | 3300025981 | Bacteria | 3390 |
| 274 | Ga0207658_10149494 | 3300025986 | Bacteria | 1901 |
| 275 | Ga0207677_10036402 | 3300026023 | Bacteria | 3207 |
| 276 | Ga0207677_10172520 | 3300026023 | Bacteria | 1693 |
| 277 | Ga0207677_10183692 | 3300026023 | Bacteria | 1647 |
| 278 | Ga0207703_10067812 | 3300026035 | Bacteria | 2937 |
| 279 | Ga0207703_10088906 | 3300026035 | Bacteria | 2593 |
| 280 | Ga0207703_10156586 | 3300026035 | Bacteria | 1991 |
| 281 | Ga0207678_10027292 | 3300026067 | Bacteria | 4979 |
| 282 | Ga0207708_10003693 | 3300026075 | Bacteria | 11298 |
| 283 | Ga0207708_10032219 | 3300026075 | Bacteria | 3981 |
| 284 | Ga0207641_10063297 | 3300026088 | Bacteria | 3159 |
| 285 | Ga0207641_10107861 | 3300026088 | Bacteria | 2464 |
| 286 | Ga0207648_10017009 | 3300026089 | Bacteria | 6627 |
| 287 | Ga0207648_10041242 | 3300026089 | Bacteria | 4053 |
| 288 | Ga0207648_10078692 | 3300026089 | Bacteria | 2876 |
| 289 | Ga0207648_10083764 | 3300026089 | Bacteria | 2781 |
| 290 | Ga0207648_10114164 | 3300026089 | Bacteria | 2373 |
| 291 | Ga0207676_10021942 | 3300026095 | Bacteria | 4690 |
| 292 | Ga0207675_100004573 | 3300026118 | Bacteria | 13347 |
| 293 | Ga0207675_100036702 | 3300026118 | Bacteria | 4571 |
| 294 | Ga0207675_100040892 | 3300026118 | Bacteria | 4331 |
| 295 | Ga0207675_100086851 | 3300026118 | Bacteria | 2937 |
| 296 | Ga0207675_100267713 | 3300026118 | Bacteria | 1658 |
| 297 | Ga0207683_10077910 | 3300026121 | Bacteria | 2936 |
| 298 | Ga0207683_10141006 | 3300026121 | Bacteria | 2172 |
| 299 | Ga0209983_1007563 | 3300027665 | Bacteria | 2226 |
| 300 | Ga0209971_1007393 | 3300027682 | Bacteria | 2606 |
| 301 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 302 | Ga0207428_10016482 | 3300027907 | Bacteria | 6355 |
| 303 | Ga0207428_10028884 | 3300027907 | Bacteria | 4603 |
| 304 | Ga0268266_10005118 | 3300028379 | Bacteria | 12357 |
| 305 | Ga0268266_10350447 | 3300028379 | Bacteria | 1387 |
| 306 | Ga0268266_10798809 | 3300028379 | Bacteria | 911 |
| 307 | Ga0268265_10000315 | 3300028380 | Bacteria | 53210 |
| 308 | Ga0268265_10014972 | 3300028380 | Bacteria | 5296 |
| 309 | Ga0268265_10025473 | 3300028380 | Bacteria | 4199 |
| 310 | Ga0268265_10097610 | 3300028380 | Bacteria | 2364 |
| 311 | Ga0268265_10116673 | 3300028380 | Bacteria | 2191 |
| 312 | Ga0268265_10261491 | 3300028380 | Bacteria | 1539 |
| 313 | Ga0268264_10050010 | 3300028381 | Bacteria | 3479 |
| 314 | Ga0268264_10051074 | 3300028381 | Bacteria | 3445 |
| 315 | Ga0268264_10281486 | 3300028381 | Bacteria | 1558 |
| 316 | Ga0307408_100027719 | 3300031548 | Bacteria | 3907 |
| 317 | Ga0265314_10058390 | 3300031711 | Bacteria | 2644 |
| 318 | Ga0307416_100070551 | 3300032002 | Bacteria | 2898 |
| 319 | Ga0307416_100369766 | 3300032002 | Bacteria | 1459 |
| 320 | Ga0307415_100024908 | 3300032126 | Bacteria | 3746 |
| 321 | Ga0373948_0001206 | 3300034817 | Bacteria | 3520 |
| 322 | Ga0373958_0004597 | 3300034819 | Bacteria | 2051 |
| 323 | Ga0373938_0001662 | 3300034957 | Bacteria | 3567 |
| 324 | Ga0373926_0088402 | 3300035083 | Bacteria | 1150 |
| 325 | Ga0373929_0000663 | 3300035085 | Bacteria | 6619 |
| 326 | Ga0373940_0001959 | 3300035088 | Bacteria | 3887 |
| 327 | Ga0373944_0074878 | 3300035089 | Bacteria | 1109 |
| 328 | Ga0373949_0002150 | 3300035090 | Bacteria | 5173 |
| 329 | Ga0373951_0000754 | 3300035091 | Bacteria | 8843 |
| 330 | Ga0373952_0000302 | 3300035092 | Bacteria | 8220 |
| 331 | Ga0373923_0038993 | 3300035111 | Bacteria | 1949 |
| 332 | Ga0373932_0012217 | 3300035112 | Bacteria | 2111 |
| 333 | Ga0373939_0002036 | 3300035114 | Bacteria | 4823 |
| 334 | Ga0373939_0017875 | 3300035114 | Bacteria | 1890 |
| 335 | Ga0373941_0001621 | 3300035115 | Bacteria | 4793 |
| 336 | Ga0373953_0128332 | 3300035117 | Bacteria | 1080 |
| 337 | Ga0373943_0005796 | 3300035170 | Bacteria | 5548 |
| 338 | Ga0373946_0008087 | 3300035171 | Bacteria | 3861 |
| 339 | Ga0373955_0030745 | 3300035172 | Bacteria | 2807 |
| 340 | Ga0373955_0231679 | 3300035172 | Bacteria | 1105 |
| 341 | Ga0373942_0000284 | 3300035207 | Bacteria | 13775 |
| 342 | Ga0373961_0000364 | 3300035241 | Bacteria | 19453 |
| 343 | Ga0373962_0023541 | 3300035242 | Bacteria | 1641 |
| 344 | Ga0373931_0050267 | 3300035691 | Bacteria | 2218 |
| 345 | Ga0373931_0165584 | 3300035691 | Bacteria | 1299 |
| 346 | Ga0373935_0029568 | 3300035692 | Bacteria | 3391 |
| 347 | Ga0373935_0033928 | 3300035692 | Bacteria | 3179 |
| 348 | Ga0373927_0116204 | 3300035695 | Bacteria | 1744 |
| 349 | Ga0373947_0006634 | 3300035725 | Bacteria | 6717 |
| 350 | Ga0373937_0395541 | 3300036401 | Bacteria | 1311 |
| 351 | Ga0373925_0009186 | 3300037068 | Bacteria | 7199 |
| 352 | Ga0373925_0055419 | 3300037068 | Bacteria | 2968 |
| 353 | Ga0451849_0160923 | 3300041505 | Bacteria | 5903 |
| 354 | Ga0450921_001204 | 3300042123 | Bacteria | 1507 |
| 355 | Ga0451577_0062732 | 3300042876 | Bacteria | 3314 |
| 356 | Ga0466963_0039122 | 3300044694 | Bacteria | 3105 |
| 357 | Ga0453684_0144098 | 3300044712 | Bacteria | 2840 |
| 358 | Ga0451576_0005014 | 3300045051 | Bacteria | 16823 |
| 359 | Ga0466967_0271728 | 3300045976 | Bacteria | 1624 |
| 360 | Ga0495592_0072476 | 3300046454 | Bacteria | 2506 |
| 361 | Ga0495629_0025099 | 3300046459 | Bacteria | 4239 |
| 362 | Ga0495629_0103052 | 3300046459 | Bacteria | 1991 |
| 363 | Ga0495580_0045080 | 3300046472 | Bacteria | 3133 |
| 364 | Ga0495582_0017467 | 3300046473 | Bacteria | 3926 |
| 365 | Ga0495582_0125529 | 3300046473 | Bacteria | 1448 |
| 366 | Ga0495639_0001920 | 3300046475 | Bacteria | 9225 |
| 367 | Ga0495585_0156760 | 3300046492 | Bacteria | 1184 |
| 368 | Ga0495594_0071087 | 3300046499 | Bacteria | 1935 |
| 369 | Ga0495608_0035263 | 3300046511 | Bacteria | 3375 |
| 370 | Ga0495628_0077312 | 3300046516 | Bacteria | 2589 |
| 371 | Ga0495630_0001943 | 3300046517 | Bacteria | 14387 |
| 372 | Ga0495587_0128325 | 3300046536 | Bacteria | 1450 |
| 373 | Ga0495645_0003879 | 3300046543 | Bacteria | 10185 |
| 374 | Ga0495645_0116158 | 3300046543 | Bacteria | 1889 |
| 375 | Ga0495622_0008970 | 3300046557 | Bacteria | 4635 |
| 376 | Ga0495633_0064217 | 3300046558 | Bacteria | 1717 |
| 377 | Ga0495667_0154896 | 3300046559 | Bacteria | 1475 |
| 378 | Ga0495634_0243096 | 3300046642 | Bacteria | 1103 |
| 379 | Ga0495635_0066993 | 3300046663 | Bacteria | 2463 |
| 380 | Ga0495647_0025299 | 3300046681 | Bacteria | 2168 |
| 381 | Ga0495658_0011622 | 3300046683 | Bacteria | 4435 |
| 382 | Ga0495658_0030083 | 3300046683 | Unclassified | 2946 |
| 383 | Ga0495658_0054719 | 3300046683 | Bacteria | 2271 |
| 384 | Ga0495613_0005250 | 3300046689 | Bacteria | 9732 |
| 385 | Ga0495613_0192651 | 3300046689 | Bacteria | 1440 |
| 386 | Ga0495613_0229391 | 3300046689 | Bacteria | 1301 |
| 387 | Ga0495581_0004997 | 3300047315 | Bacteria | 7681 |
| 388 | Ga0495674_0034999 | 3300047319 | Bacteria | 4535 |
| 389 | Ga0495676_0008166 | 3300047321 | Bacteria | 9602 |
| 390 | Ga0495680_0079617 | 3300047322 | Bacteria | 2477 |
| 391 | Ga0495675_0237963 | 3300047444 | Bacteria | 1097 |
| 392 | Ga0495684_0000174 | 3300047471 | Bacteria | 48736 |
| 393 | Ga0495684_0015904 | 3300047471 | Bacteria | 5794 |
| 394 | Ga0496102_0462778 | 3300048905 | Bacteria | 1189 |
| 395 | Ga0496106_0098370 | 3300048909 | Bacteria | 2267 |
| 396 | Ga0496106_0166817 | 3300048909 | Bacteria | 1743 |
| 397 | Ga0496108_0076993 | 3300048911 | Bacteria | 2820 |
| 398 | Ga0496109_0116200 | 3300048912 | Bacteria | 2490 |
| 399 | Ga0496109_0185569 | 3300048912 | Bacteria | 1954 |
| 400 | Ga0496112_0033032 | 3300048915 | Bacteria | 5025 |
| 401 | Ga0496112_0189183 | 3300048915 | Bacteria | 2021 |
| 402 | Ga0496112_0217688 | 3300048915 | Bacteria | 1866 |
| 403 | Ga0496114_0000105 | 3300048917 | Bacteria | 60923 |
| 404 | Ga0496114_0096570 | 3300048917 | Bacteria | 2516 |
| 405 | Ga0496114_0401097 | 3300048917 | Bacteria | 1214 |
| 406 | Ga0496114_0469853 | 3300048917 | Bacteria | 1113 |
| 407 | Ga0501036_0145280 | 3300049572 | Bacteria | 2001 |
| 408 | Ga0501036_0384821 | 3300049572 | Bacteria | 1171 |
| 409 | Ga0501038_0037889 | 3300049574 | Bacteria | 4225 |
| 410 | Ga0501039_0006038 | 3300049575 | Bacteria | 9194 |
| 411 | Ga0501039_0023078 | 3300049575 | Bacteria | 4773 |
| 412 | Ga0501040_0030184 | 3300049576 | Bacteria | 3661 |
| 413 | Ga0501040_0136281 | 3300049576 | Bacteria | 1728 |
| 414 | Ga0501041_0026882 | 3300049577 | Bacteria | 3465 |
| 415 | Ga0501042_0010107 | 3300049578 | Bacteria | 6312 |
| 416 | Ga0501042_0016995 | 3300049578 | Bacteria | 5010 |
| 417 | Ga0501042_0030305 | 3300049578 | Bacteria | 3820 |
| 418 | Ga0501043_0168068 | 3300049579 | Bacteria | 1712 |
| 419 | Ga0501048_0013092 | 3300049582 | Bacteria | 6158 |
| 420 | Ga0501048_0040451 | 3300049582 | Bacteria | 3341 |
| 421 | Ga0501048_0195421 | 3300049582 | Bacteria | 1434 |
| 422 | Ga0501067_0013705 | 3300049583 | Bacteria | 4490 |
| 423 | Ga0501068_0104107 | 3300049584 | Bacteria | 1761 |
| 424 | Ga0501070_0384357 | 3300049586 | Bacteria | 1137 |
| 425 | Ga0501072_0024017 | 3300049588 | Bacteria | 4739 |
| 426 | Ga0501072_0111023 | 3300049588 | Unclassified | 2183 |
| 427 | Ga0501073_0159089 | 3300049589 | Bacteria | 1565 |
| 428 | Ga0501073_0289461 | 3300049589 | Bacteria | 1130 |
| 429 | Ga0501074_0091234 | 3300049590 | Bacteria | 2182 |
| 430 | Ga0501075_0009227 | 3300049591 | Bacteria | 6897 |
| 431 | Ga0501075_0130384 | 3300049591 | Bacteria | 1915 |
| 432 | Ga0501076_0013912 | 3300049592 | Bacteria | 6042 |
| 433 | Ga0501077_0000162 | 3300049593 | Bacteria | 37776 |
| 434 | Ga0501077_0028214 | 3300049593 | Bacteria | 3567 |
| 435 | Ga0501077_0122023 | 3300049593 | Bacteria | 1652 |
| 436 | Ga0501079_0005806 | 3300049741 | Bacteria | 9227 |
| 437 | Ga0501079_0049794 | 3300049741 | Bacteria | 3234 |
| 438 | Ga0501080_0027202 | 3300049742 | Bacteria | 5319 |
| 439 | Ga0501080_0065597 | 3300049742 | Bacteria | 3377 |
| 440 | Ga0501080_0168084 | 3300049742 | Bacteria | 2024 |
| 441 | Ga0501081_0046305 | 3300049743 | Bacteria | 2989 |
| 442 | Ga0501045_0061427 | 3300049824 | Bacteria | 2756 |
| 443 | nmdc:mga0k408_36528_c1 | 3300050493 | Bacteria | 2820 |
| 444 | nmdc:mga06z11_8914_c1 | 3300050494 | Bacteria | 4206 |
| 445 | nmdc:mga05p37_1036_c1 | 3300050507 | Bacteria | 31681 |
| 446 | nmdc:mga05p37_10839_c1 | 3300050507 | Bacteria | 10822 |
| 447 | nmdc:mga05p37_124475_c1 | 3300050507 | Bacteria | 3166 |
| 448 | nmdc:mga05p37_134595_c1 | 3300050507 | Bacteria | 3032 |
| 449 | nmdc:mga05p37_154075_c1 | 3300050507 | Bacteria | 2809 |
| 450 | nmdc:mga05p37_160277_c1 | 3300050507 | Bacteria | 2748 |
| 451 | nmdc:mga05p37_166011_c1 | 3300050507 | Bacteria | 2694 |
| 452 | nmdc:mga05p37_16708_c1 | 3300050507 | Bacteria | 8844 |
| 453 | nmdc:mga05p37_404068_c1 | 3300050507 | Bacteria | 1594 |
| 454 | nmdc:mga05p37_4703_c1 | 3300050507 | Bacteria | 15946 |
| 455 | nmdc:mga05p37_59539_c1 | 3300050507 | Bacteria | 3640 |
| 456 | nmdc:mga05p37_78972_c1 | 3300050507 | Bacteria | 4052 |
| 457 | nmdc:mga09592_55360_c1 | 3300050508 | Bacteria | 3352 |
| 458 | nmdc:mga0qj67_252244_c1 | 3300050509 | Bacteria | 1432 |
| 459 | nmdc:mga06r32_26256_c1 | 3300050510 | Bacteria | 5428 |
| 460 | nmdc:mga06r32_5663_c1 | 3300050510 | Bacteria | 11244 |
| 461 | nmdc:mga06r32_64117_c1 | 3300050510 | Bacteria | 3542 |
| 462 | nmdc:mga08y16_306479_c1 | 3300050511 | Bacteria | 1636 |
| 463 | nmdc:mga08y16_31309_c1 | 3300050511 | Bacteria | 5596 |
| 464 | nmdc:mga08y16_32739_c1 | 3300050511 | Bacteria | 5466 |
| 465 | nmdc:mga08y16_3591_c1 | 3300050511 | Bacteria | 16109 |
| 466 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 467 | nmdc:mga08y16_4269_c1 | 3300050511 | Bacteria | 14915 |
| 468 | nmdc:mga08y16_45157_c1 | 3300050511 | Bacteria | 4616 |
| 469 | nmdc:mga08y16_556585_c1 | 3300050511 | Unclassified | 1160 |
| 470 | nmdc:mga0n895_16719_c1 | 3300050512 | Bacteria | 6740 |
| 471 | nmdc:mga0n895_25323_c1 | 3300050512 | Bacteria | 5605 |
| 472 | nmdc:mga0n895_3220_c2 | 3300050512 | Bacteria | 8352 |
| 473 | nmdc:mga0n895_4659_c1 | 3300050512 | Bacteria | 11311 |
| 474 | nmdc:mga0n895_51341_c1 | 3300050512 | Bacteria | 4045 |
| 475 | nmdc:mga0rr50_114_c1 | 3300050513 | Bacteria | 44678 |
| 476 | nmdc:mga0rr50_136962_c1 | 3300050513 | Bacteria | 1966 |
| 477 | nmdc:mga0rr50_504_c1 | 3300050513 | Bacteria | 20788 |
| 478 | nmdc:mga08x19_135828_c1 | 3300050514 | Bacteria | 1658 |
| 479 | nmdc:mga08x19_233425_c1 | 3300050514 | Bacteria | 1267 |
| 480 | nmdc:mga08x19_271_c1 | 3300050514 | Bacteria | 39236 |
| 481 | nmdc:mga08x19_27869_c1 | 3300050514 | Bacteria | 3535 |
| 482 | nmdc:mga08x19_35403_c1 | 3300050514 | Bacteria | 3159 |
| 483 | nmdc:mga0a205_13438_c1 | 3300050515 | Bacteria | 7623 |
| 484 | nmdc:mga0a205_274997_c1 | 3300050515 | Bacteria | 1560 |
| 485 | nmdc:mga0a205_48666_c1 | 3300050515 | Bacteria | 4092 |
| 486 | Ga0495601_0003027 | 3300053077 | Bacteria | 9582 |
| 487 | Ga0495601_0014872 | 3300053077 | Bacteria | 4698 |
| 488 | Ga0495601_0026903 | 3300053077 | Bacteria | 3555 |
| 489 | Ga0495601_0038671 | 3300053077 | Bacteria | 2984 |
| 490 | Ga0495595_0030475 | 3300053084 | Bacteria | 2420 |
| 491 | Ga0495595_0073027 | 3300053084 | Bacteria | 1624 |
| 492 | Ga0495595_0091494 | 3300053084 | Bacteria | 1460 |
| 493 | Ga0495619_0009731 | 3300053085 | Bacteria | 6061 |
| 494 | Ga0495619_0015238 | 3300053085 | Bacteria | 4861 |
| 495 | Ga0495619_0073958 | 3300053085 | Bacteria | 2284 |
| 496 | Ga0500555_000424 | 3300053103 | Bacteria | 17586 |
| 497 | Ga0500616_0000167 | 3300053153 | Bacteria | 109823 |
| 498 | Ga0500645_000331 | 3300053730 | Bacteria | 33681 |
| 499 | Ga0501084_0042637 | 3300054114 | Bacteria | 3795 |
| 500 | Ga0501082_0000116 | 3300060353 | Bacteria | 62872 |
| 501 | Ga0501082_0206221 | 3300060353 | Bacteria | 1710 |
| 502 | Ga0501082_0394372 | 3300060353 | Bacteria | 1208 |
| 503 | Ga0530510_0010960 | 3300061734 | Bacteria | 6360 |
| 504 | Ga0530510_0041213 | 3300061734 | Bacteria | 3333 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049589 | Ga0501073_0289461 | Ga0501073_0289461_291_1109 | 272 |
| 2 | 3300049593 | Ga0501077_0122023 | Ga0501077_0122023_70_921 | 283 |
| 3 | 3300028379 | Ga0268266_10798809 | Ga0268266_107988091 | 285 |
| 4 | 3300046543 | Ga0495645_0116158 | Ga0495645_0116158_703_1599 | 290 |
| 5 | 3300044694 | Ga0466963_0039122 | Ga0466963_0039122_2115_3065 | 294 |
| 6 | 3300045976 | Ga0466967_0271728 | Ga0466967_0271728_220_1170 | 294 |
| 7 | 3300046473 | Ga0495582_0017467 | Ga0495582_0017467_2162_3109 | 296 |
| 8 | 3300042123 | Ga0450921_001204 | Ga0450921_001204_350_1342 | 300 |
| 9 | 3300014326 | Ga0157380_10170408 | Ga0157380_101704083 | 302 |
| 10 | 3300005543 | Ga0070672_100211092 | Ga0070672_1002110922 | 305 |
| 11 | 3300025940 | Ga0207691_10236552 | Ga0207691_102365522 | 305 |
| 12 | 3300046459 | Ga0495629_0025099 | Ga0495629_0025099_1067_2023 | 306 |
| 13 | 3300046475 | Ga0495639_0001920 | Ga0495639_0001920_6430_7386 | 306 |
| 14 | 3300046499 | Ga0495594_0071087 | Ga0495594_0071087_580_1536 | 306 |
| 15 | 3300046557 | Ga0495622_0008970 | Ga0495622_0008970_1037_1993 | 306 |
| 16 | 3300046681 | Ga0495647_0025299 | Ga0495647_0025299_314_1270 | 306 |
| 17 | 3300046683 | Ga0495658_0030083 | Ga0495658_0030083_71_1027 | 306 |
| 18 | 3300047315 | Ga0495581_0004997 | Ga0495581_0004997_1900_2856 | 306 |
| 19 | 3300047321 | Ga0495676_0008166 | Ga0495676_0008166_2588_3544 | 306 |
| 20 | 3300050507 | nmdc:mga05p37_78972_c1 | nmdc:mga05p37_78972_c1_1710_2642 | 310 |
| 21 | 3300046492 | Ga0495585_0156760 | Ga0495585_0156760_225_1166 | 313 |
| 22 | 3300006914 | Ga0075436_100143058 | Ga0075436_1001430582 | 314 |
| 23 | 3300026118 | Ga0207675_100040892 | Ga0207675_1000408924 | 314 |
| 24 | 3300050514 | nmdc:mga08x19_135828_c1 | nmdc:mga08x19_135828_c1_177_1145 | 314 |
| 25 | 3300005290 | Ga0065712_10136681 | Ga0065712_101366811 | 315 |
| 26 | 3300005293 | Ga0065715_10041229 | Ga0065715_100412291 | 315 |
| 27 | 3300006028 | Ga0070717_10470118 | Ga0070717_104701181 | 315 |
| 28 | 3300006846 | Ga0075430_100094261 | Ga0075430_1000942612 | 315 |
| 29 | 3300006847 | Ga0075431_100052275 | Ga0075431_1000522753 | 315 |
| 30 | 3300009177 | Ga0105248_10125247 | Ga0105248_101252473 | 315 |
| 31 | 3300026089 | Ga0207648_10114164 | Ga0207648_101141642 | 315 |
| 32 | 3300026121 | Ga0207683_10077910 | Ga0207683_100779102 | 315 |
| 33 | 3300005327 | Ga0070658_10125321 | Ga0070658_101253211 | 316 |
| 34 | 3300005339 | Ga0070660_100032966 | Ga0070660_1000329662 | 316 |
| 35 | 3300005365 | Ga0070688_100041542 | Ga0070688_1000415422 | 316 |
| 36 | 3300005530 | Ga0070679_100043229 | Ga0070679_1000432292 | 316 |
| 37 | 3300005548 | Ga0070665_100000114 | Ga0070665_10000011456 | 316 |
| 38 | 3300005563 | Ga0068855_100007855 | Ga0068855_10000785513 | 316 |
| 39 | 3300005616 | Ga0068852_100162054 | Ga0068852_1001620543 | 316 |
| 40 | 3300005844 | Ga0068862_100000343 | Ga0068862_1000003439 | 316 |
| 41 | 3300006844 | Ga0075428_100103786 | Ga0075428_1001037863 | 316 |
| 42 | 3300006914 | Ga0075436_100001888 | Ga0075436_1000018889 | 316 |
| 43 | 3300009094 | Ga0111539_10387939 | Ga0111539_103879392 | 316 |
| 44 | 3300009094 | Ga0111539_10712853 | Ga0111539_107128532 | 316 |
| 45 | 3300009147 | Ga0114129_10141969 | Ga0114129_101419692 | 316 |
| 46 | 3300009147 | Ga0114129_10272558 | Ga0114129_102725582 | 316 |
| 47 | 3300009553 | Ga0105249_10191582 | Ga0105249_101915822 | 316 |
| 48 | 3300025907 | Ga0207645_10005752 | Ga0207645_100057527 | 316 |
| 49 | 3300025909 | Ga0207705_10082523 | Ga0207705_100825232 | 316 |
| 50 | 3300025919 | Ga0207657_10015006 | Ga0207657_100150066 | 316 |
| 51 | 3300025921 | Ga0207652_10147658 | Ga0207652_101476582 | 316 |
| 52 | 3300025949 | Ga0207667_10310570 | Ga0207667_103105702 | 316 |
| 53 | 3300025961 | Ga0207712_10148438 | Ga0207712_101484382 | 316 |
| 54 | 3300028380 | Ga0268265_10000315 | Ga0268265_1000031529 | 316 |
| 55 | 3300041505 | Ga0451849_0160923 | Ga0451849_0160923_4693_5655 | 316 |
| 56 | 3300049572 | Ga0501036_0145280 | Ga0501036_0145280_515_1465 | 316 |
| 57 | 3300049575 | Ga0501039_0023078 | Ga0501039_0023078_1189_2139 | 316 |
| 58 | 3300049577 | Ga0501041_0026882 | Ga0501041_0026882_749_1699 | 316 |
| 59 | 3300049578 | Ga0501042_0010107 | Ga0501042_0010107_3209_4159 | 316 |
| 60 | 3300049582 | Ga0501048_0040451 | Ga0501048_0040451_514_1464 | 316 |
| 61 | 3300049583 | Ga0501067_0013705 | Ga0501067_0013705_3180_4142 | 316 |
| 62 | 3300049584 | Ga0501068_0104107 | Ga0501068_0104107_481_1431 | 316 |
| 63 | 3300049591 | Ga0501075_0009227 | Ga0501075_0009227_4496_5446 | 316 |
| 64 | 3300049591 | Ga0501075_0130384 | Ga0501075_0130384_132_1094 | 316 |
| 65 | 3300049593 | Ga0501077_0000162 | Ga0501077_0000162_31687_32649 | 316 |
| 66 | 3300049742 | Ga0501080_0027202 | Ga0501080_0027202_2772_3734 | 316 |
| 67 | 3300050507 | nmdc:mga05p37_59539_c1 | nmdc:mga05p37_59539_c1_2404_3360 | 316 |
| 68 | 3300050511 | nmdc:mga08y16_306479_c1 | nmdc:mga08y16_306479_c1_379_1329 | 316 |
| 69 | 3300050514 | nmdc:mga08x19_271_c1 | nmdc:mga08x19_271_c1_4782_5744 | 316 |
| 70 | 3300053153 | Ga0500616_0000167 | Ga0500616_0000167_74720_75751 | 316 |
| 71 | 3300060353 | Ga0501082_0000116 | Ga0501082_0000116_9085_10047 | 316 |
| 72 | 3300005329 | Ga0070683_100201845 | Ga0070683_1002018452 | 317 |
| 73 | 3300005347 | Ga0070668_100259686 | Ga0070668_1002596862 | 317 |
| 74 | 3300005456 | Ga0070678_100150675 | Ga0070678_1001506752 | 317 |
| 75 | 3300005467 | Ga0070706_100188670 | Ga0070706_1001886701 | 317 |
| 76 | 3300009094 | Ga0111539_10004657 | Ga0111539_1000465715 | 317 |
| 77 | 3300009553 | Ga0105249_10313208 | Ga0105249_103132082 | 317 |
| 78 | 3300013307 | Ga0157372_10182681 | Ga0157372_101826812 | 317 |
| 79 | 3300025907 | Ga0207645_10053489 | Ga0207645_100534892 | 317 |
| 80 | 3300025933 | Ga0207706_10079599 | Ga0207706_100795993 | 317 |
| 81 | 3300025937 | Ga0207669_10055761 | Ga0207669_100557612 | 317 |
| 82 | 3300025972 | Ga0207668_10192863 | Ga0207668_101928632 | 317 |
| 83 | 3300026089 | Ga0207648_10078692 | Ga0207648_100786923 | 317 |
| 84 | 3300026121 | Ga0207683_10141006 | Ga0207683_101410063 | 317 |
| 85 | 3300027665 | Ga0209983_1007563 | Ga0209983_10075632 | 317 |
| 86 | 3300027682 | Ga0209971_1007393 | Ga0209971_10073932 | 317 |
| 87 | 3300027907 | Ga0207428_10016482 | Ga0207428_100164825 | 317 |
| 88 | 3300031548 | Ga0307408_100027719 | Ga0307408_1000277193 | 317 |
| 89 | 3300032002 | Ga0307416_100369766 | Ga0307416_1003697662 | 317 |
| 90 | 3300032126 | Ga0307415_100024908 | Ga0307415_1000249083 | 317 |
| 91 | 3300046689 | Ga0495613_0229391 | Ga0495613_0229391_81_1040 | 317 |
| 92 | 3300048915 | Ga0496112_0189183 | Ga0496112_0189183_222_1193 | 317 |
| 93 | 3300050511 | nmdc:mga08y16_3591_c1 | nmdc:mga08y16_3591_c1_3700_4719 | 317 |
| 94 | 3300053077 | Ga0495601_0014872 | Ga0495601_0014872_189_1148 | 317 |
| 95 | 3300053084 | Ga0495595_0030475 | Ga0495595_0030475_1103_2062 | 317 |
| 96 | 3300053085 | Ga0495619_0009731 | Ga0495619_0009731_3247_4206 | 317 |
| 97 | 3300060353 | Ga0501082_0394372 | Ga0501082_0394372_113_1084 | 317 |
| 98 | 3300005530 | Ga0070679_100025481 | Ga0070679_1000254814 | 318 |
| 99 | 3300005617 | Ga0068859_100014186 | Ga0068859_1000141866 | 318 |
| 100 | 3300006844 | Ga0075428_100062654 | Ga0075428_1000626544 | 318 |
| 101 | 3300006871 | Ga0075434_100106969 | Ga0075434_1001069692 | 318 |
| 102 | 3300006931 | Ga0097620_100014186 | Ga0097620_1000141865 | 318 |
| 103 | 3300009176 | Ga0105242_10356893 | Ga0105242_103568932 | 318 |
| 104 | 3300009177 | Ga0105248_10269290 | Ga0105248_102692902 | 318 |
| 105 | 3300025921 | Ga0207652_10039804 | Ga0207652_100398043 | 318 |
| 106 | 3300025942 | Ga0207689_10079854 | Ga0207689_100798542 | 318 |
| 107 | 3300025961 | Ga0207712_10256730 | Ga0207712_102567302 | 318 |
| 108 | 3300042876 | Ga0451577_0062732 | Ga0451577_0062732_2211_3167 | 318 |
| 109 | 3300044712 | Ga0453684_0144098 | Ga0453684_0144098_621_1577 | 318 |
| 110 | 3300049572 | Ga0501036_0384821 | Ga0501036_0384821_175_1131 | 318 |
| 111 | 3300049574 | Ga0501038_0037889 | Ga0501038_0037889_214_1170 | 318 |
| 112 | 3300049576 | Ga0501040_0030184 | Ga0501040_0030184_1794_2750 | 318 |
| 113 | 3300049578 | Ga0501042_0030305 | Ga0501042_0030305_287_1243 | 318 |
| 114 | 3300049579 | Ga0501043_0168068 | Ga0501043_0168068_658_1614 | 318 |
| 115 | 3300049582 | Ga0501048_0013092 | Ga0501048_0013092_1617_2573 | 318 |
| 116 | 3300049588 | Ga0501072_0111023 | Ga0501072_0111023_104_1060 | 318 |
| 117 | 3300049592 | Ga0501076_0013912 | Ga0501076_0013912_5051_6007 | 318 |
| 118 | 3300049741 | Ga0501079_0005806 | Ga0501079_0005806_5799_6755 | 318 |
| 119 | 3300049824 | Ga0501045_0061427 | Ga0501045_0061427_935_1891 | 318 |
| 120 | 3300050510 | nmdc:mga06r32_26256_c1 | nmdc:mga06r32_26256_c1_356_1315 | 318 |
| 121 | 3300050512 | nmdc:mga0n895_51341_c1 | nmdc:mga0n895_51341_c1_1531_2487 | 318 |
| 122 | 3300053103 | Ga0500555_000424 | Ga0500555_000424_11651_12652 | 318 |
| 123 | 3300053730 | Ga0500645_000331 | Ga0500645_000331_11662_12663 | 318 |
| 124 | 3300054114 | Ga0501084_0042637 | Ga0501084_0042637_2493_3449 | 318 |
| 125 | 3300061734 | Ga0530510_0010960 | Ga0530510_0010960_245_1201 | 318 |
| 126 | 3300005338 | Ga0068868_100191021 | Ga0068868_1001910212 | 319 |
| 127 | 3300005353 | Ga0070669_100073654 | Ga0070669_1000736542 | 319 |
| 128 | 3300005354 | Ga0070675_100001125 | Ga0070675_10000112518 | 319 |
| 129 | 3300005354 | Ga0070675_100030018 | Ga0070675_1000300183 | 319 |
| 130 | 3300005355 | Ga0070671_100012471 | Ga0070671_1000124714 | 319 |
| 131 | 3300005356 | Ga0070674_100002729 | Ga0070674_1000027293 | 319 |
| 132 | 3300005364 | Ga0070673_100102408 | Ga0070673_1001024082 | 319 |
| 133 | 3300005364 | Ga0070673_100122252 | Ga0070673_1001222522 | 319 |
| 134 | 3300005366 | Ga0070659_100127559 | Ga0070659_1001275591 | 319 |
| 135 | 3300005367 | Ga0070667_100194485 | Ga0070667_1001944852 | 319 |
| 136 | 3300005457 | Ga0070662_100083365 | Ga0070662_1000833652 | 319 |
| 137 | 3300005468 | Ga0070707_100046718 | Ga0070707_1000467184 | 319 |
| 138 | 3300005471 | Ga0070698_100229144 | Ga0070698_1002291442 | 319 |
| 139 | 3300005548 | Ga0070665_100138593 | Ga0070665_1001385932 | 319 |
| 140 | 3300005549 | Ga0070704_100234113 | Ga0070704_1002341132 | 319 |
| 141 | 3300005563 | Ga0068855_100527750 | Ga0068855_1005277502 | 319 |
| 142 | 3300005718 | Ga0068866_10010088 | Ga0068866_100100883 | 319 |
| 143 | 3300005719 | Ga0068861_100036631 | Ga0068861_1000366312 | 319 |
| 144 | 3300005719 | Ga0068861_100106119 | Ga0068861_1001061192 | 319 |
| 145 | 3300005719 | Ga0068861_100457237 | Ga0068861_1004572371 | 319 |
| 146 | 3300005844 | Ga0068862_100108009 | Ga0068862_1001080092 | 319 |
| 147 | 3300006042 | Ga0075368_10103880 | Ga0075368_101038802 | 319 |
| 148 | 3300006178 | Ga0075367_10011253 | Ga0075367_100112533 | 319 |
| 149 | 3300006195 | Ga0075366_10010282 | Ga0075366_100102824 | 319 |
| 150 | 3300006844 | Ga0075428_100000108 | Ga0075428_10000010857 | 319 |
| 151 | 3300006844 | Ga0075428_100032880 | Ga0075428_1000328803 | 319 |
| 152 | 3300006846 | Ga0075430_100043470 | Ga0075430_1000434702 | 319 |
| 153 | 3300006847 | Ga0075431_100055778 | Ga0075431_1000557783 | 319 |
| 154 | 3300006847 | Ga0075431_100200466 | Ga0075431_1002004662 | 319 |
| 155 | 3300006852 | Ga0075433_10039685 | Ga0075433_100396853 | 319 |
| 156 | 3300006852 | Ga0075433_10094658 | Ga0075433_100946583 | 319 |
| 157 | 3300006914 | Ga0075436_100166813 | Ga0075436_1001668132 | 319 |
| 158 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001254 | 319 |
| 159 | 3300009094 | Ga0111539_10043543 | Ga0111539_100435434 | 319 |
| 160 | 3300009094 | Ga0111539_10230546 | Ga0111539_102305462 | 319 |
| 161 | 3300009147 | Ga0114129_10029691 | Ga0114129_100296912 | 319 |
| 162 | 3300009147 | Ga0114129_10035583 | Ga0114129_100355835 | 319 |
| 163 | 3300009147 | Ga0114129_10052953 | Ga0114129_100529534 | 319 |
| 164 | 3300009147 | Ga0114129_10091638 | Ga0114129_100916383 | 319 |
| 165 | 3300009147 | Ga0114129_10196086 | Ga0114129_101960862 | 319 |
| 166 | 3300009147 | Ga0114129_10200768 | Ga0114129_102007683 | 319 |
| 167 | 3300009148 | Ga0105243_10029935 | Ga0105243_100299352 | 319 |
| 168 | 3300009177 | Ga0105248_10027819 | Ga0105248_100278193 | 319 |
| 169 | 3300009545 | Ga0105237_10132969 | Ga0105237_101329692 | 319 |
| 170 | 3300014325 | Ga0163163_10199311 | Ga0163163_101993112 | 319 |
| 171 | 3300014326 | Ga0157380_10197531 | Ga0157380_101975312 | 319 |
| 172 | 3300014326 | Ga0157380_10312766 | Ga0157380_103127661 | 319 |
| 173 | 3300025913 | Ga0207695_10115098 | Ga0207695_101150983 | 319 |
| 174 | 3300025922 | Ga0207646_10063295 | Ga0207646_100632953 | 319 |
| 175 | 3300025923 | Ga0207681_10020674 | Ga0207681_100206742 | 319 |
| 176 | 3300025923 | Ga0207681_10119095 | Ga0207681_101190952 | 319 |
| 177 | 3300025926 | Ga0207659_10000918 | Ga0207659_100009183 | 319 |
| 178 | 3300025929 | Ga0207664_10253004 | Ga0207664_102530042 | 319 |
| 179 | 3300025932 | Ga0207690_10028639 | Ga0207690_100286392 | 319 |
| 180 | 3300025933 | Ga0207706_10343396 | Ga0207706_103433961 | 319 |
| 181 | 3300025935 | Ga0207709_10077339 | Ga0207709_100773392 | 319 |
| 182 | 3300025937 | Ga0207669_10031547 | Ga0207669_100315471 | 319 |
| 183 | 3300025938 | Ga0207704_10030247 | Ga0207704_100302473 | 319 |
| 184 | 3300025941 | Ga0207711_10023851 | Ga0207711_100238513 | 319 |
| 185 | 3300025960 | Ga0207651_10474271 | Ga0207651_104742711 | 319 |
| 186 | 3300025961 | Ga0207712_10040818 | Ga0207712_100408183 | 319 |
| 187 | 3300025986 | Ga0207658_10149494 | Ga0207658_101494942 | 319 |
| 188 | 3300026023 | Ga0207677_10172520 | Ga0207677_101725202 | 319 |
| 189 | 3300026067 | Ga0207678_10027292 | Ga0207678_100272922 | 319 |
| 190 | 3300026089 | Ga0207648_10041242 | Ga0207648_100412423 | 319 |
| 191 | 3300026118 | Ga0207675_100036702 | Ga0207675_1000367022 | 319 |
| 192 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002267 | 319 |
| 193 | 3300028380 | Ga0268265_10025473 | Ga0268265_100254732 | 319 |
| 194 | 3300035241 | Ga0373961_0000364 | Ga0373961_0000364_1860_2831 | 319 |
| 195 | 3300035692 | Ga0373935_0029568 | Ga0373935_0029568_841_1806 | 319 |
| 196 | 3300048917 | Ga0496114_0000105 | Ga0496114_0000105_55100_56131 | 319 |
| 197 | 3300049575 | Ga0501039_0006038 | Ga0501039_0006038_7695_8666 | 319 |
| 198 | 3300049576 | Ga0501040_0136281 | Ga0501040_0136281_687_1658 | 319 |
| 199 | 3300049578 | Ga0501042_0016995 | Ga0501042_0016995_3075_4046 | 319 |
| 200 | 3300049582 | Ga0501048_0195421 | Ga0501048_0195421_327_1322 | 319 |
| 201 | 3300049586 | Ga0501070_0384357 | Ga0501070_0384357_51_1025 | 319 |
| 202 | 3300049588 | Ga0501072_0024017 | Ga0501072_0024017_1959_2930 | 319 |
| 203 | 3300049589 | Ga0501073_0159089 | Ga0501073_0159089_448_1422 | 319 |
| 204 | 3300049590 | Ga0501074_0091234 | Ga0501074_0091234_14_985 | 319 |
| 205 | 3300049593 | Ga0501077_0028214 | Ga0501077_0028214_844_1815 | 319 |
| 206 | 3300049741 | Ga0501079_0049794 | Ga0501079_0049794_282_1253 | 319 |
| 207 | 3300049742 | Ga0501080_0065597 | Ga0501080_0065597_1859_2833 | 319 |
| 208 | 3300049742 | Ga0501080_0168084 | Ga0501080_0168084_88_1059 | 319 |
| 209 | 3300049743 | Ga0501081_0046305 | Ga0501081_0046305_1316_2287 | 319 |
| 210 | 3300050493 | nmdc:mga0k408_36528_c1 | nmdc:mga0k408_36528_c1_1035_2009 | 319 |
| 211 | 3300050494 | nmdc:mga06z11_8914_c1 | nmdc:mga06z11_8914_c1_428_1402 | 319 |
| 212 | 3300050507 | nmdc:mga05p37_124475_c1 | nmdc:mga05p37_124475_c1_443_1417 | 319 |
| 213 | 3300050507 | nmdc:mga05p37_154075_c1 | nmdc:mga05p37_154075_c1_391_1350 | 319 |
| 214 | 3300050507 | nmdc:mga05p37_160277_c1 | nmdc:mga05p37_160277_c1_971_1942 | 319 |
| 215 | 3300050508 | nmdc:mga09592_55360_c1 | nmdc:mga09592_55360_c1_1888_2859 | 319 |
| 216 | 3300050509 | nmdc:mga0qj67_252244_c1 | nmdc:mga0qj67_252244_c1_447_1418 | 319 |
| 217 | 3300050510 | nmdc:mga06r32_5663_c1 | nmdc:mga06r32_5663_c1_937_1908 | 319 |
| 218 | 3300050510 | nmdc:mga06r32_64117_c1 | nmdc:mga06r32_64117_c1_591_1550 | 319 |
| 219 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_288399_289376 | 319 |
| 220 | 3300050511 | nmdc:mga08y16_4269_c1 | nmdc:mga08y16_4269_c1_11568_12530 | 319 |
| 221 | 3300050511 | nmdc:mga08y16_556585_c1 | nmdc:mga08y16_556585_c1_155_1129 | 319 |
| 222 | 3300050514 | nmdc:mga08x19_27869_c1 | nmdc:mga08x19_27869_c1_1842_2801 | 319 |
| 223 | 3300050515 | nmdc:mga0a205_274997_c1 | nmdc:mga0a205_274997_c1_568_1533 | 319 |
| 224 | 3300050515 | nmdc:mga0a205_48666_c1 | nmdc:mga0a205_48666_c1_2399_3373 | 319 |
| 225 | 3300060353 | Ga0501082_0206221 | Ga0501082_0206221_172_1143 | 319 |
| 226 | 3300061734 | Ga0530510_0041213 | Ga0530510_0041213_271_1242 | 319 |
| 227 | 3300005328 | Ga0070676_10127162 | Ga0070676_101271622 | 320 |
| 228 | 3300005334 | Ga0068869_100070458 | Ga0068869_1000704583 | 320 |
| 229 | 3300005334 | Ga0068869_100348737 | Ga0068869_1003487372 | 320 |
| 230 | 3300005364 | Ga0070673_100346856 | Ga0070673_1003468562 | 320 |
| 231 | 3300005364 | Ga0070673_100455276 | Ga0070673_1004552762 | 320 |
| 232 | 3300005434 | Ga0070709_10017425 | Ga0070709_100174251 | 320 |
| 233 | 3300005436 | Ga0070713_100028496 | Ga0070713_1000284962 | 320 |
| 234 | 3300005439 | Ga0070711_100074170 | Ga0070711_1000741702 | 320 |
| 235 | 3300005445 | Ga0070708_100025380 | Ga0070708_1000253803 | 320 |
| 236 | 3300005445 | Ga0070708_100142447 | Ga0070708_1001424472 | 320 |
| 237 | 3300005459 | Ga0068867_100324171 | Ga0068867_1003241712 | 320 |
| 238 | 3300005468 | Ga0070707_100575084 | Ga0070707_1005750841 | 320 |
| 239 | 3300005471 | Ga0070698_100058391 | Ga0070698_1000583914 | 320 |
| 240 | 3300005535 | Ga0070684_100290842 | Ga0070684_1002908421 | 320 |
| 241 | 3300005549 | Ga0070704_100220743 | Ga0070704_1002207432 | 320 |
| 242 | 3300005578 | Ga0068854_100024065 | Ga0068854_1000240653 | 320 |
| 243 | 3300005615 | Ga0070702_100091819 | Ga0070702_1000918192 | 320 |
| 244 | 3300005617 | Ga0068859_100313296 | Ga0068859_1003132962 | 320 |
| 245 | 3300005617 | Ga0068859_100345753 | Ga0068859_1003457532 | 320 |
| 246 | 3300005842 | Ga0068858_100000761 | Ga0068858_10000076121 | 320 |
| 247 | 3300005842 | Ga0068858_100589638 | Ga0068858_1005896381 | 320 |
| 248 | 3300005843 | Ga0068860_100176456 | Ga0068860_1001764562 | 320 |
| 249 | 3300006028 | Ga0070717_10059812 | Ga0070717_100598122 | 320 |
| 250 | 3300006178 | Ga0075367_10215139 | Ga0075367_102151391 | 320 |
| 251 | 3300006237 | Ga0097621_100000066 | Ga0097621_10000006617 | 320 |
| 252 | 3300006237 | Ga0097621_100003865 | Ga0097621_1000038652 | 320 |
| 253 | 3300006358 | Ga0068871_100000170 | Ga0068871_10000017048 | 320 |
| 254 | 3300006358 | Ga0068871_100016674 | Ga0068871_1000166744 | 320 |
| 255 | 3300006931 | Ga0097620_100313295 | Ga0097620_1003132952 | 320 |
| 256 | 3300006931 | Ga0097620_100345752 | Ga0097620_1003457522 | 320 |
| 257 | 3300009094 | Ga0111539_10001440 | Ga0111539_1000144016 | 320 |
| 258 | 3300009094 | Ga0111539_10022916 | Ga0111539_100229167 | 320 |
| 259 | 3300009101 | Ga0105247_10007600 | Ga0105247_100076002 | 320 |
| 260 | 3300009176 | Ga0105242_10059278 | Ga0105242_100592783 | 320 |
| 261 | 3300009176 | Ga0105242_10555040 | Ga0105242_105550401 | 320 |
| 262 | 3300009177 | Ga0105248_10150831 | Ga0105248_101508312 | 320 |
| 263 | 3300009177 | Ga0105248_10697422 | Ga0105248_106974222 | 320 |
| 264 | 3300013306 | Ga0163162_10241941 | Ga0163162_102419412 | 320 |
| 265 | 3300014968 | Ga0157379_10083672 | Ga0157379_100836722 | 320 |
| 266 | 3300014969 | Ga0157376_10019477 | Ga0157376_100194773 | 320 |
| 267 | 3300014969 | Ga0157376_10038828 | Ga0157376_100388284 | 320 |
| 268 | 3300025900 | Ga0207710_10041597 | Ga0207710_100415972 | 320 |
| 269 | 3300025906 | Ga0207699_10047251 | Ga0207699_100472512 | 320 |
| 270 | 3300025912 | Ga0207707_10146346 | Ga0207707_101463462 | 320 |
| 271 | 3300025913 | Ga0207695_10123157 | Ga0207695_101231573 | 320 |
| 272 | 3300025927 | Ga0207687_10354120 | Ga0207687_103541201 | 320 |
| 273 | 3300025933 | Ga0207706_10426166 | Ga0207706_104261661 | 320 |
| 274 | 3300025934 | Ga0207686_10003167 | Ga0207686_100031677 | 320 |
| 275 | 3300025938 | Ga0207704_10308660 | Ga0207704_103086602 | 320 |
| 276 | 3300025941 | Ga0207711_10043611 | Ga0207711_100436113 | 320 |
| 277 | 3300025941 | Ga0207711_10102304 | Ga0207711_101023042 | 320 |
| 278 | 3300025941 | Ga0207711_10321412 | Ga0207711_103214122 | 320 |
| 279 | 3300025942 | Ga0207689_10042602 | Ga0207689_100426023 | 320 |
| 280 | 3300025944 | Ga0207661_10129304 | Ga0207661_101293043 | 320 |
| 281 | 3300025944 | Ga0207661_10352003 | Ga0207661_103520032 | 320 |
| 282 | 3300025960 | Ga0207651_10003153 | Ga0207651_100031532 | 320 |
| 283 | 3300025981 | Ga0207640_10028496 | Ga0207640_100284963 | 320 |
| 284 | 3300026035 | Ga0207703_10088906 | Ga0207703_100889063 | 320 |
| 285 | 3300026035 | Ga0207703_10156586 | Ga0207703_101565861 | 320 |
| 286 | 3300027907 | Ga0207428_10028884 | Ga0207428_100288843 | 320 |
| 287 | 3300028379 | Ga0268266_10350447 | Ga0268266_103504472 | 320 |
| 288 | 3300028380 | Ga0268265_10261491 | Ga0268265_102614912 | 320 |
| 289 | 3300028381 | Ga0268264_10051074 | Ga0268264_100510743 | 320 |
| 290 | 3300031711 | Ga0265314_10058390 | Ga0265314_100583903 | 320 |
| 291 | 3300032002 | Ga0307416_100070551 | Ga0307416_1000705513 | 320 |
| 292 | 3300035083 | Ga0373926_0088402 | Ga0373926_0088402_120_1082 | 320 |
| 293 | 3300035089 | Ga0373944_0074878 | Ga0373944_0074878_84_1046 | 320 |
| 294 | 3300035111 | Ga0373923_0038993 | Ga0373923_0038993_639_1601 | 320 |
| 295 | 3300035117 | Ga0373953_0128332 | Ga0373953_0128332_14_976 | 320 |
| 296 | 3300035170 | Ga0373943_0005796 | Ga0373943_0005796_2489_3451 | 320 |
| 297 | 3300035171 | Ga0373946_0008087 | Ga0373946_0008087_741_1703 | 320 |
| 298 | 3300035172 | Ga0373955_0030745 | Ga0373955_0030745_631_1593 | 320 |
| 299 | 3300035242 | Ga0373962_0023541 | Ga0373962_0023541_618_1607 | 320 |
| 300 | 3300035691 | Ga0373931_0165584 | Ga0373931_0165584_297_1259 | 320 |
| 301 | 3300035692 | Ga0373935_0033928 | Ga0373935_0033928_1748_2710 | 320 |
| 302 | 3300035695 | Ga0373927_0116204 | Ga0373927_0116204_271_1233 | 320 |
| 303 | 3300035725 | Ga0373947_0006634 | Ga0373947_0006634_1476_2438 | 320 |
| 304 | 3300036401 | Ga0373937_0395541 | Ga0373937_0395541_301_1263 | 320 |
| 305 | 3300037068 | Ga0373925_0009186 | Ga0373925_0009186_3775_4737 | 320 |
| 306 | 3300037068 | Ga0373925_0055419 | Ga0373925_0055419_1976_2938 | 320 |
| 307 | 3300046454 | Ga0495592_0072476 | Ga0495592_0072476_1126_2088 | 320 |
| 308 | 3300046472 | Ga0495580_0045080 | Ga0495580_0045080_118_1080 | 320 |
| 309 | 3300046511 | Ga0495608_0035263 | Ga0495608_0035263_2032_2994 | 320 |
| 310 | 3300046516 | Ga0495628_0077312 | Ga0495628_0077312_134_1096 | 320 |
| 311 | 3300046517 | Ga0495630_0001943 | Ga0495630_0001943_3295_4257 | 320 |
| 312 | 3300046536 | Ga0495587_0128325 | Ga0495587_0128325_150_1112 | 320 |
| 313 | 3300046642 | Ga0495634_0243096 | Ga0495634_0243096_124_1086 | 320 |
| 314 | 3300046689 | Ga0495613_0005250 | Ga0495613_0005250_6782_7744 | 320 |
| 315 | 3300046689 | Ga0495613_0192651 | Ga0495613_0192651_250_1212 | 320 |
| 316 | 3300047319 | Ga0495674_0034999 | Ga0495674_0034999_922_1884 | 320 |
| 317 | 3300047322 | Ga0495680_0079617 | Ga0495680_0079617_19_981 | 320 |
| 318 | 3300047444 | Ga0495675_0237963 | Ga0495675_0237963_107_1069 | 320 |
| 319 | 3300047471 | Ga0495684_0000174 | Ga0495684_0000174_2843_3805 | 320 |
| 320 | 3300048912 | Ga0496109_0185569 | Ga0496109_0185569_960_1922 | 320 |
| 321 | 3300048917 | Ga0496114_0469853 | Ga0496114_0469853_41_1003 | 320 |
| 322 | 3300050511 | nmdc:mga08y16_31309_c1 | nmdc:mga08y16_31309_c1_843_1805 | 320 |
| 323 | 3300050511 | nmdc:mga08y16_45157_c1 | nmdc:mga08y16_45157_c1_2451_3413 | 320 |
| 324 | 3300053077 | Ga0495601_0003027 | Ga0495601_0003027_3064_4026 | 320 |
| 325 | 3300053084 | Ga0495595_0091494 | Ga0495595_0091494_107_1069 | 320 |
| 326 | 3300053085 | Ga0495619_0015238 | Ga0495619_0015238_969_1931 | 320 |
| 327 | 3300005355 | Ga0070671_100049537 | Ga0070671_1000495371 | 321 |
| 328 | 3300005365 | Ga0070688_100138921 | Ga0070688_1001389211 | 321 |
| 329 | 3300005367 | Ga0070667_100004898 | Ga0070667_1000048983 | 321 |
| 330 | 3300005438 | Ga0070701_10001830 | Ga0070701_100018305 | 321 |
| 331 | 3300005536 | Ga0070697_100210647 | Ga0070697_1002106472 | 321 |
| 332 | 3300005543 | Ga0070672_100056015 | Ga0070672_1000560153 | 321 |
| 333 | 3300005841 | Ga0068863_100003994 | Ga0068863_1000039948 | 321 |
| 334 | 3300005843 | Ga0068860_100120173 | Ga0068860_1001201731 | 321 |
| 335 | 3300005844 | Ga0068862_100054545 | Ga0068862_1000545452 | 321 |
| 336 | 3300005985 | Ga0081539_10011075 | Ga0081539_100110756 | 321 |
| 337 | 3300006173 | Ga0070716_100017576 | Ga0070716_1000175763 | 321 |
| 338 | 3300006852 | Ga0075433_10033716 | Ga0075433_100337163 | 321 |
| 339 | 3300006871 | Ga0075434_100013487 | Ga0075434_1000134873 | 321 |
| 340 | 3300006871 | Ga0075434_100061081 | Ga0075434_1000610813 | 321 |
| 341 | 3300007076 | Ga0075435_100309533 | Ga0075435_1003095332 | 321 |
| 342 | 3300009094 | Ga0111539_10008383 | Ga0111539_100083839 | 321 |
| 343 | 3300009147 | Ga0114129_10001367 | Ga0114129_1000136726 | 321 |
| 344 | 3300009147 | Ga0114129_10008634 | Ga0114129_1000863412 | 321 |
| 345 | 3300009147 | Ga0114129_10513233 | Ga0114129_105132332 | 321 |
| 346 | 3300009147 | Ga0114129_10747665 | Ga0114129_107476651 | 321 |
| 347 | 3300009148 | Ga0105243_10454146 | Ga0105243_104541462 | 321 |
| 348 | 3300009177 | Ga0105248_10160333 | Ga0105248_101603333 | 321 |
| 349 | 3300014969 | Ga0157376_10076491 | Ga0157376_100764913 | 321 |
| 350 | 3300025931 | Ga0207644_10133194 | Ga0207644_101331942 | 321 |
| 351 | 3300025936 | Ga0207670_10277892 | Ga0207670_102778922 | 321 |
| 352 | 3300025941 | Ga0207711_10028851 | Ga0207711_100288514 | 321 |
| 353 | 3300025944 | Ga0207661_10237900 | Ga0207661_102379002 | 321 |
| 354 | 3300026088 | Ga0207641_10063297 | Ga0207641_100632972 | 321 |
| 355 | 3300028380 | Ga0268265_10014972 | Ga0268265_100149723 | 321 |
| 356 | 3300028381 | Ga0268264_10050010 | Ga0268264_100500104 | 321 |
| 357 | 3300035114 | Ga0373939_0017875 | Ga0373939_0017875_262_1269 | 321 |
| 358 | 3300035691 | Ga0373931_0050267 | Ga0373931_0050267_331_1338 | 321 |
| 359 | 3300048909 | Ga0496106_0166817 | Ga0496106_0166817_249_1256 | 321 |
| 360 | 3300048912 | Ga0496109_0116200 | Ga0496109_0116200_953_1960 | 321 |
| 361 | 3300050507 | nmdc:mga05p37_1036_c1 | nmdc:mga05p37_1036_c1_7734_8699 | 321 |
| 362 | 3300050507 | nmdc:mga05p37_10839_c1 | nmdc:mga05p37_10839_c1_6512_7519 | 321 |
| 363 | 3300050507 | nmdc:mga05p37_16708_c1 | nmdc:mga05p37_16708_c1_3687_4733 | 321 |
| 364 | 3300050507 | nmdc:mga05p37_404068_c1 | nmdc:mga05p37_404068_c1_312_1277 | 321 |
| 365 | 3300050507 | nmdc:mga05p37_4703_c1 | nmdc:mga05p37_4703_c1_8327_9334 | 321 |
| 366 | 3300050511 | nmdc:mga08y16_32739_c1 | nmdc:mga08y16_32739_c1_2926_3933 | 321 |
| 367 | 3300050512 | nmdc:mga0n895_25323_c1 | nmdc:mga0n895_25323_c1_1878_2885 | 321 |
| 368 | 3300050515 | nmdc:mga0a205_13438_c1 | nmdc:mga0a205_13438_c1_4138_5103 | 321 |
| 369 | 3300005290 | Ga0065712_10116129 | Ga0065712_101161292 | 322 |
| 370 | 3300005335 | Ga0070666_10016739 | Ga0070666_100167394 | 322 |
| 371 | 3300005336 | Ga0070680_100068639 | Ga0070680_1000686391 | 322 |
| 372 | 3300005338 | Ga0068868_100119246 | Ga0068868_1001192463 | 322 |
| 373 | 3300005338 | Ga0068868_100134555 | Ga0068868_1001345552 | 322 |
| 374 | 3300005341 | Ga0070691_10001081 | Ga0070691_100010817 | 322 |
| 375 | 3300005440 | Ga0070705_100001314 | Ga0070705_1000013144 | 322 |
| 376 | 3300005440 | Ga0070705_100029176 | Ga0070705_1000291762 | 322 |
| 377 | 3300005441 | Ga0070700_100001496 | Ga0070700_1000014963 | 322 |
| 378 | 3300005444 | Ga0070694_100003841 | Ga0070694_1000038415 | 322 |
| 379 | 3300005457 | Ga0070662_100149275 | Ga0070662_1001492752 | 322 |
| 380 | 3300005459 | Ga0068867_100024164 | Ga0068867_1000241642 | 322 |
| 381 | 3300005459 | Ga0068867_100092604 | Ga0068867_1000926043 | 322 |
| 382 | 3300005535 | Ga0070684_100105093 | Ga0070684_1001050932 | 322 |
| 383 | 3300005544 | Ga0070686_100001857 | Ga0070686_10000185710 | 322 |
| 384 | 3300005545 | Ga0070695_100007402 | Ga0070695_1000074025 | 322 |
| 385 | 3300005546 | Ga0070696_100009529 | Ga0070696_1000095294 | 322 |
| 386 | 3300005546 | Ga0070696_100197976 | Ga0070696_1001979762 | 322 |
| 387 | 3300005548 | Ga0070665_100014083 | Ga0070665_1000140834 | 322 |
| 388 | 3300005549 | Ga0070704_100046941 | Ga0070704_1000469413 | 322 |
| 389 | 3300005578 | Ga0068854_100010165 | Ga0068854_1000101653 | 322 |
| 390 | 3300005578 | Ga0068854_100266721 | Ga0068854_1002667212 | 322 |
| 391 | 3300005615 | Ga0070702_100040715 | Ga0070702_1000407151 | 322 |
| 392 | 3300005618 | Ga0068864_100030833 | Ga0068864_1000308332 | 322 |
| 393 | 3300005718 | Ga0068866_10153419 | Ga0068866_101534192 | 322 |
| 394 | 3300005719 | Ga0068861_100001397 | Ga0068861_10000139710 | 322 |
| 395 | 3300005719 | Ga0068861_100097598 | Ga0068861_1000975982 | 322 |
| 396 | 3300005719 | Ga0068861_100347536 | Ga0068861_1003475362 | 322 |
| 397 | 3300005841 | Ga0068863_100120582 | Ga0068863_1001205822 | 322 |
| 398 | 3300005841 | Ga0068863_100350835 | Ga0068863_1003508351 | 322 |
| 399 | 3300005842 | Ga0068858_100007567 | Ga0068858_1000075676 | 322 |
| 400 | 3300005842 | Ga0068858_100048637 | Ga0068858_1000486373 | 322 |
| 401 | 3300005844 | Ga0068862_100025130 | Ga0068862_1000251304 | 322 |
| 402 | 3300006173 | Ga0070716_100042379 | Ga0070716_1000423793 | 322 |
| 403 | 3300006237 | Ga0097621_100011699 | Ga0097621_1000116993 | 322 |
| 404 | 3300006237 | Ga0097621_100135923 | Ga0097621_1001359232 | 322 |
| 405 | 3300006871 | Ga0075434_100056443 | Ga0075434_1000564432 | 322 |
| 406 | 3300006871 | Ga0075434_100193581 | Ga0075434_1001935812 | 322 |
| 407 | 3300006914 | Ga0075436_100005597 | Ga0075436_1000055977 | 322 |
| 408 | 3300006914 | Ga0075436_100039290 | Ga0075436_1000392903 | 322 |
| 409 | 3300007076 | Ga0075435_100001969 | Ga0075435_10000196910 | 322 |
| 410 | 3300007076 | Ga0075435_100002082 | Ga0075435_1000020829 | 322 |
| 411 | 3300007076 | Ga0075435_100068091 | Ga0075435_1000680912 | 322 |
| 412 | 3300009093 | Ga0105240_10360214 | Ga0105240_103602142 | 322 |
| 413 | 3300009101 | Ga0105247_10037110 | Ga0105247_100371103 | 322 |
| 414 | 3300009147 | Ga0114129_10185611 | Ga0114129_101856112 | 322 |
| 415 | 3300009148 | Ga0105243_10011387 | Ga0105243_100113875 | 322 |
| 416 | 3300009176 | Ga0105242_10015839 | Ga0105242_100158393 | 322 |
| 417 | 3300009176 | Ga0105242_10045751 | Ga0105242_100457513 | 322 |
| 418 | 3300009177 | Ga0105248_10021247 | Ga0105248_100212474 | 322 |
| 419 | 3300009177 | Ga0105248_10132324 | Ga0105248_101323243 | 322 |
| 420 | 3300009177 | Ga0105248_10226985 | Ga0105248_102269854 | 322 |
| 421 | 3300009177 | Ga0105248_10266627 | Ga0105248_102666272 | 322 |
| 422 | 3300013306 | Ga0163162_10044785 | Ga0163162_100447854 | 322 |
| 423 | 3300014325 | Ga0163163_10005222 | Ga0163163_1000522210 | 322 |
| 424 | 3300014325 | Ga0163163_10054390 | Ga0163163_100543903 | 322 |
| 425 | 3300014969 | Ga0157376_10063002 | Ga0157376_100630022 | 322 |
| 426 | 3300014969 | Ga0157376_10216419 | Ga0157376_102164192 | 322 |
| 427 | 3300025907 | Ga0207645_10000802 | Ga0207645_100008028 | 322 |
| 428 | 3300025913 | Ga0207695_10157746 | Ga0207695_101577462 | 322 |
| 429 | 3300025918 | Ga0207662_10051424 | Ga0207662_100514242 | 322 |
| 430 | 3300025918 | Ga0207662_10148810 | Ga0207662_101488102 | 322 |
| 431 | 3300025922 | Ga0207646_10178232 | Ga0207646_101782322 | 322 |
| 432 | 3300025922 | Ga0207646_10281606 | Ga0207646_102816062 | 322 |
| 433 | 3300025923 | Ga0207681_10014159 | Ga0207681_100141593 | 322 |
| 434 | 3300025923 | Ga0207681_10155509 | Ga0207681_101555091 | 322 |
| 435 | 3300025933 | Ga0207706_10046548 | Ga0207706_100465482 | 322 |
| 436 | 3300025933 | Ga0207706_10051795 | Ga0207706_100517953 | 322 |
| 437 | 3300025934 | Ga0207686_10006109 | Ga0207686_100061095 | 322 |
| 438 | 3300025937 | Ga0207669_10163940 | Ga0207669_101639402 | 322 |
| 439 | 3300025939 | Ga0207665_10053476 | Ga0207665_100534762 | 322 |
| 440 | 3300025941 | Ga0207711_10015131 | Ga0207711_100151312 | 322 |
| 441 | 3300025941 | Ga0207711_10215339 | Ga0207711_102153392 | 322 |
| 442 | 3300025942 | Ga0207689_10131665 | Ga0207689_101316652 | 322 |
| 443 | 3300025981 | Ga0207640_10001184 | Ga0207640_100011846 | 322 |
| 444 | 3300025981 | Ga0207640_10029023 | Ga0207640_100290233 | 322 |
| 445 | 3300026023 | Ga0207677_10036402 | Ga0207677_100364022 | 322 |
| 446 | 3300026023 | Ga0207677_10183692 | Ga0207677_101836923 | 322 |
| 447 | 3300026035 | Ga0207703_10067812 | Ga0207703_100678123 | 322 |
| 448 | 3300026075 | Ga0207708_10003693 | Ga0207708_1000369310 | 322 |
| 449 | 3300026075 | Ga0207708_10032219 | Ga0207708_100322193 | 322 |
| 450 | 3300026088 | Ga0207641_10107861 | Ga0207641_101078612 | 322 |
| 451 | 3300026089 | Ga0207648_10017009 | Ga0207648_100170093 | 322 |
| 452 | 3300026089 | Ga0207648_10083764 | Ga0207648_100837642 | 322 |
| 453 | 3300026095 | Ga0207676_10021942 | Ga0207676_100219424 | 322 |
| 454 | 3300026118 | Ga0207675_100004573 | Ga0207675_1000045739 | 322 |
| 455 | 3300026118 | Ga0207675_100086851 | Ga0207675_1000868512 | 322 |
| 456 | 3300026118 | Ga0207675_100267713 | Ga0207675_1002677132 | 322 |
| 457 | 3300028379 | Ga0268266_10005118 | Ga0268266_100051183 | 322 |
| 458 | 3300028380 | Ga0268265_10097610 | Ga0268265_100976103 | 322 |
| 459 | 3300028380 | Ga0268265_10116673 | Ga0268265_101166733 | 322 |
| 460 | 3300028381 | Ga0268264_10281486 | Ga0268264_102814862 | 322 |
| 461 | 3300034817 | Ga0373948_0001206 | Ga0373948_0001206_655_1650 | 322 |
| 462 | 3300034819 | Ga0373958_0004597 | Ga0373958_0004597_1039_2034 | 322 |
| 463 | 3300034957 | Ga0373938_0001662 | Ga0373938_0001662_2166_3161 | 322 |
| 464 | 3300035085 | Ga0373929_0000663 | Ga0373929_0000663_3023_4018 | 322 |
| 465 | 3300035088 | Ga0373940_0001959 | Ga0373940_0001959_1758_2753 | 322 |
| 466 | 3300035090 | Ga0373949_0002150 | Ga0373949_0002150_2396_3391 | 322 |
| 467 | 3300035091 | Ga0373951_0000754 | Ga0373951_0000754_816_1811 | 322 |
| 468 | 3300035092 | Ga0373952_0000302 | Ga0373952_0000302_6628_7623 | 322 |
| 469 | 3300035112 | Ga0373932_0012217 | Ga0373932_0012217_1090_2085 | 322 |
| 470 | 3300035114 | Ga0373939_0002036 | Ga0373939_0002036_1774_2769 | 322 |
| 471 | 3300035115 | Ga0373941_0001621 | Ga0373941_0001621_2745_3740 | 322 |
| 472 | 3300035172 | Ga0373955_0231679 | Ga0373955_0231679_28_996 | 322 |
| 473 | 3300035207 | Ga0373942_0000284 | Ga0373942_0000284_2412_3407 | 322 |
| 474 | 3300045051 | Ga0451576_0005014 | Ga0451576_0005014_1635_2630 | 322 |
| 475 | 3300046459 | Ga0495629_0103052 | Ga0495629_0103052_345_1313 | 322 |
| 476 | 3300046473 | Ga0495582_0125529 | Ga0495582_0125529_40_1008 | 322 |
| 477 | 3300046543 | Ga0495645_0003879 | Ga0495645_0003879_6690_7658 | 322 |
| 478 | 3300046558 | Ga0495633_0064217 | Ga0495633_0064217_112_1089 | 322 |
| 479 | 3300046559 | Ga0495667_0154896 | Ga0495667_0154896_398_1366 | 322 |
| 480 | 3300046663 | Ga0495635_0066993 | Ga0495635_0066993_1198_2166 | 322 |
| 481 | 3300046683 | Ga0495658_0011622 | Ga0495658_0011622_3141_4109 | 322 |
| 482 | 3300046683 | Ga0495658_0054719 | Ga0495658_0054719_76_1044 | 322 |
| 483 | 3300047471 | Ga0495684_0015904 | Ga0495684_0015904_1267_2235 | 322 |
| 484 | 3300048905 | Ga0496102_0462778 | Ga0496102_0462778_56_1051 | 322 |
| 485 | 3300048909 | Ga0496106_0098370 | Ga0496106_0098370_1195_2190 | 322 |
| 486 | 3300048911 | Ga0496108_0076993 | Ga0496108_0076993_1031_1999 | 322 |
| 487 | 3300048915 | Ga0496112_0033032 | Ga0496112_0033032_708_1676 | 322 |
| 488 | 3300048915 | Ga0496112_0217688 | Ga0496112_0217688_101_1117 | 322 |
| 489 | 3300048917 | Ga0496114_0096570 | Ga0496114_0096570_201_1169 | 322 |
| 490 | 3300048917 | Ga0496114_0401097 | Ga0496114_0401097_235_1203 | 322 |
| 491 | 3300050507 | nmdc:mga05p37_134595_c1 | nmdc:mga05p37_134595_c1_411_1385 | 322 |
| 492 | 3300050507 | nmdc:mga05p37_166011_c1 | nmdc:mga05p37_166011_c1_295_1278 | 322 |
| 493 | 3300050512 | nmdc:mga0n895_16719_c1 | nmdc:mga0n895_16719_c1_986_1954 | 322 |
| 494 | 3300050512 | nmdc:mga0n895_3220_c2 | nmdc:mga0n895_3220_c2_5566_6534 | 322 |
| 495 | 3300050512 | nmdc:mga0n895_4659_c1 | nmdc:mga0n895_4659_c1_7443_8426 | 322 |
| 496 | 3300050513 | nmdc:mga0rr50_114_c1 | nmdc:mga0rr50_114_c1_38950_39918 | 322 |
| 497 | 3300050513 | nmdc:mga0rr50_136962_c1 | nmdc:mga0rr50_136962_c1_314_1294 | 322 |
| 498 | 3300050513 | nmdc:mga0rr50_504_c1 | nmdc:mga0rr50_504_c1_19321_20316 | 322 |
| 499 | 3300050514 | nmdc:mga08x19_233425_c1 | nmdc:mga08x19_233425_c1_80_1060 | 322 |
| 500 | 3300050514 | nmdc:mga08x19_35403_c1 | nmdc:mga08x19_35403_c1_1886_2854 | 322 |
| 501 | 3300053077 | Ga0495601_0026903 | Ga0495601_0026903_1499_2467 | 322 |
| 502 | 3300053077 | Ga0495601_0038671 | Ga0495601_0038671_599_1567 | 322 |
| 503 | 3300053084 | Ga0495595_0073027 | Ga0495595_0073027_141_1109 | 322 |
| 504 | 3300053085 | Ga0495619_0073958 | Ga0495619_0073958_553_1521 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9852 | 4 | 174 |
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9629 | 4 | 174 |
| 3k2v-assembly1.cif.gz_B | structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. | 0.9521 | 188 | 316 |
| 4o9k-assembly1.cif.gz_B | crystal structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from methylococcus capsulatus in complex with cmp-kdo | 0.95 | 193 | 322 |
| 3fna-assembly3.cif.gz_B-2 | crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 | 0.948 | 190 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45395_202_325_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9701 | 193 | 318 | 3.10.580.10 |
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9627 | 4 | 191 | 3.40.50.10490 |
| af_P17115_194_318_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9591 | 193 | 318 | 3.10.580.10 |
| af_P45395_202_325_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9473 | 193 | 318 | 3.10.580.10 |
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.943 | 4 | 191 | 3.40.50.10490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K1Z903-F1-model_v4 | SIS domain-containing protein | 0.9972 | 5 | 140 |
GO:0097367
GO:1901135 |
| AF-A0A656SJ60-F1-model_v4 | deleted | 0.9859 | 36 | 117 |
|
| AF-A0A259R762-F1-model_v4 | deleted | 0.9835 | 5 | 134 |
|
| AF-A0A4V2AMI0-F1-model_v4 | SIS domain-containing protein | 0.9828 | 14 | 159 |
GO:0097367
GO:1901135 |
| AF-A0A7C1G239-F1-model_v4 | SIS domain-containing protein | 0.9667 | 1 | 106 |
GO:0097367
GO:1901135 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar