F456271

General Info

Members Datasets Scaffolds Average Seq Length
504 245 504 323

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_16708_c1|nmdc:mga05p37_16708_c1_3687_4733
Length 348
Sequence MPSQSGPESAFVADKPFGGGPLGAPGTVEGRALARKVLETEAAAILALVDRLDARFDCAVQLLLQCKGRVILTGMGKSGIICQKIAATLSSTGTASFFLHPAEAMHGDLGVIRGDDVVIALSYSGETDELLRLLESIRRLGAKLIAITGGPASTLAQAADVALDCSVAEEACPMNLVPTASTTAALAIGDALAMTLLVEKGFRQEDFANLHPGGKIGKRLMRVSALMHSGKQCPIVRTETRMRDVIYEMSSKGLGMTCVVDGDDVLLGIITDGDLRRRMERGTEILDLTAADVMTRNPIAVSPDTLAAEALNIMEQRKITAIVVADADQAPRVAGVVHLHDLWRLEMF

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
140 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 2.58
Rhizosphere 95.44
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10116129 3300005290 Bacteria 1740
2 Ga0065712_10136681 3300005290 Bacteria 1491
3 Ga0065715_10041229 3300005293 Bacteria 1092
4 Ga0070658_10125321 3300005327 Bacteria 2137
5 Ga0070676_10127162 3300005328 Bacteria 1607
6 Ga0070683_100201845 3300005329 Bacteria 1888
7 Ga0068869_100070458 3300005334 Bacteria 2587
8 Ga0068869_100348737 3300005334 Bacteria 1206
9 Ga0070666_10016739 3300005335 Bacteria 4694
10 Ga0070680_100068639 3300005336 Bacteria 2910
11 Ga0068868_100119246 3300005338 Bacteria 2151
12 Ga0068868_100134555 3300005338 Bacteria 2025
13 Ga0068868_100191021 3300005338 Bacteria 1703
14 Ga0070660_100032966 3300005339 Bacteria 3901
15 Ga0070691_10001081 3300005341 Bacteria 11289
16 Ga0070668_100259686 3300005347 Bacteria 1444
17 Ga0070669_100073654 3300005353 Bacteria 2530
18 Ga0070675_100001125 3300005354 Bacteria 19310
19 Ga0070675_100030018 3300005354 Bacteria 4387
20 Ga0070671_100012471 3300005355 Bacteria 6843
21 Ga0070671_100049537 3300005355 Bacteria 3494
22 Ga0070674_100002729 3300005356 Bacteria 9764
23 Ga0070673_100102408 3300005364 Bacteria 2361
24 Ga0070673_100122252 3300005364 Bacteria 2174
25 Ga0070673_100346856 3300005364 Bacteria 1317
26 Ga0070673_100455276 3300005364 Bacteria 1152
27 Ga0070688_100041542 3300005365 Bacteria 2824
28 Ga0070688_100138921 3300005365 Bacteria 1648
29 Ga0070659_100127559 3300005366 Bacteria 2065
30 Ga0070667_100004898 3300005367 Bacteria 11215
31 Ga0070667_100194485 3300005367 Bacteria 1798
32 Ga0070709_10017425 3300005434 Bacteria 4120
33 Ga0070713_100028496 3300005436 Bacteria 4410
34 Ga0070701_10001830 3300005438 Bacteria 8046
35 Ga0070711_100074170 3300005439 Bacteria 2406
36 Ga0070705_100001314 3300005440 Bacteria 13321
37 Ga0070705_100029176 3300005440 Bacteria 3031
38 Ga0070700_100001496 3300005441 Bacteria 11632
39 Ga0070694_100003841 3300005444 Bacteria 8975
40 Ga0070708_100025380 3300005445 Bacteria 5066
41 Ga0070708_100142447 3300005445 Bacteria 2224
42 Ga0070678_100150675 3300005456 Bacteria 1873
43 Ga0070662_100083365 3300005457 Bacteria 2386
44 Ga0070662_100149275 3300005457 Bacteria 1818
45 Ga0068867_100024164 3300005459 Bacteria 4355
46 Ga0068867_100092604 3300005459 Bacteria 2296
47 Ga0068867_100324171 3300005459 Bacteria 1277
48 Ga0070706_100188670 3300005467 Bacteria 1926
49 Ga0070707_100046718 3300005468 Bacteria 4144
50 Ga0070707_100575084 3300005468 Bacteria 1089
51 Ga0070698_100058391 3300005471 Bacteria 3901
52 Ga0070698_100229144 3300005471 Bacteria 1791
53 Ga0070679_100025481 3300005530 Bacteria 5805
54 Ga0070679_100043229 3300005530 Bacteria 4488
55 Ga0070684_100105093 3300005535 Bacteria 2527
56 Ga0070684_100290842 3300005535 Bacteria 1498
57 Ga0070697_100210647 3300005536 Bacteria 1654
58 Ga0070672_100056015 3300005543 Bacteria 3090
59 Ga0070672_100211092 3300005543 Bacteria 1626
60 Ga0070686_100001857 3300005544 Bacteria 11778
61 Ga0070695_100007402 3300005545 Bacteria 6512
62 Ga0070696_100009529 3300005546 Bacteria 6500
63 Ga0070696_100197976 3300005546 Bacteria 1498
64 Ga0070665_100000114 3300005548 Bacteria 151271
65 Ga0070665_100014083 3300005548 Bacteria 8038
66 Ga0070665_100138593 3300005548 Bacteria 2436
67 Ga0070704_100046941 3300005549 Bacteria 3016
68 Ga0070704_100220743 3300005549 Bacteria 1541
69 Ga0070704_100234113 3300005549 Bacteria 1500
70 Ga0068855_100007855 3300005563 Bacteria 12890
71 Ga0068855_100527750 3300005563 Bacteria 1280
72 Ga0068854_100010165 3300005578 Bacteria 6097
73 Ga0068854_100024065 3300005578 Bacteria 4166
74 Ga0068854_100266721 3300005578 Bacteria 1373
75 Ga0070702_100040715 3300005615 Bacteria 2601
76 Ga0070702_100091819 3300005615 Bacteria 1843
77 Ga0068852_100162054 3300005616 Bacteria 2089
78 Ga0068859_100014186 3300005617 Bacteria 7991
79 Ga0068859_100313296 3300005617 Bacteria 1663
80 Ga0068859_100345753 3300005617 Bacteria 1582
81 Ga0068864_100030833 3300005618 Bacteria 4546
82 Ga0068866_10010088 3300005718 Bacteria 4039
83 Ga0068866_10153419 3300005718 Bacteria 1336
84 Ga0068861_100001397 3300005719 Bacteria 15173
85 Ga0068861_100036631 3300005719 Bacteria 3643
86 Ga0068861_100097598 3300005719 Bacteria 2331
87 Ga0068861_100106119 3300005719 Bacteria 2243
88 Ga0068861_100347536 3300005719 Bacteria 1300
89 Ga0068861_100457237 3300005719 Bacteria 1145
90 Ga0068863_100003994 3300005841 Bacteria 14562
91 Ga0068863_100120582 3300005841 Bacteria 2500
92 Ga0068863_100350835 3300005841 Bacteria 1437
93 Ga0068858_100000761 3300005842 Bacteria 33790
94 Ga0068858_100007567 3300005842 Bacteria 10492
95 Ga0068858_100048637 3300005842 Bacteria 3928
96 Ga0068858_100589638 3300005842 Bacteria 1078
97 Ga0068860_100120173 3300005843 Bacteria 2515
98 Ga0068860_100176456 3300005843 Bacteria 2065
99 Ga0068862_100000343 3300005844 Bacteria 50391
100 Ga0068862_100025130 3300005844 Bacteria 5000
101 Ga0068862_100054545 3300005844 Bacteria 3422
102 Ga0068862_100108009 3300005844 Bacteria 2440
103 Ga0081539_10011075 3300005985 Bacteria 7207
104 Ga0070717_10059812 3300006028 Bacteria 3154
105 Ga0070717_10470118 3300006028 Bacteria 1135
106 Ga0075368_10103880 3300006042 Bacteria 1168
107 Ga0070716_100017576 3300006173 Bacteria 3710
108 Ga0070716_100042379 3300006173 Bacteria 2541
109 Ga0075367_10011253 3300006178 Bacteria 4726
110 Ga0075367_10215139 3300006178 Bacteria 1202
111 Ga0075366_10010282 3300006195 Bacteria 5250
112 Ga0097621_100000066 3300006237 Bacteria 54619
113 Ga0097621_100003865 3300006237 Bacteria 10377
114 Ga0097621_100011699 3300006237 Bacteria 6477
115 Ga0097621_100135923 3300006237 Bacteria 2097
116 Ga0068871_100000170 3300006358 Bacteria 43522
117 Ga0068871_100016674 3300006358 Bacteria 5541
118 Ga0075428_100000108 3300006844 Bacteria 70319
119 Ga0075428_100032880 3300006844 Bacteria 5727
120 Ga0075428_100062654 3300006844 Bacteria 4071
121 Ga0075428_100103786 3300006844 Bacteria 3100
122 Ga0075430_100043470 3300006846 Bacteria 3797
123 Ga0075430_100094261 3300006846 Bacteria 2503
124 Ga0075431_100052275 3300006847 Bacteria 4212
125 Ga0075431_100055778 3300006847 Bacteria 4076
126 Ga0075431_100200466 3300006847 Bacteria 2042
127 Ga0075433_10033716 3300006852 Bacteria 4391
128 Ga0075433_10039685 3300006852 Bacteria 4072
129 Ga0075433_10094658 3300006852 Bacteria 2643
130 Ga0075434_100013487 3300006871 Bacteria 7781
131 Ga0075434_100056443 3300006871 Bacteria 3902
132 Ga0075434_100061081 3300006871 Bacteria 3748
133 Ga0075434_100106969 3300006871 Bacteria 2807
134 Ga0075434_100193581 3300006871 Bacteria 2054
135 Ga0075436_100001888 3300006914 Bacteria 14395
136 Ga0075436_100005597 3300006914 Bacteria 8621
137 Ga0075436_100039290 3300006914 Bacteria 3266
138 Ga0075436_100143058 3300006914 Bacteria 1681
139 Ga0075436_100166813 3300006914 Bacteria 1554
140 Ga0097620_100014186 3300006931 Bacteria 7991
141 Ga0097620_100313295 3300006931 Bacteria 1663
142 Ga0097620_100345752 3300006931 Bacteria 1582
143 Ga0075435_100001969 3300007076 Bacteria 13393
144 Ga0075435_100002082 3300007076 Bacteria 13131
145 Ga0075435_100068091 3300007076 Bacteria 2899
146 Ga0075435_100309533 3300007076 Bacteria 1351
147 Ga0105240_10360214 3300009093 Bacteria 1648
148 Ga0111539_10000001 3300009094 Bacteria 1035431
149 Ga0111539_10001440 3300009094 Bacteria 31737
150 Ga0111539_10004657 3300009094 Bacteria 17928
151 Ga0111539_10008383 3300009094 Bacteria 13151
152 Ga0111539_10022916 3300009094 Bacteria 7668
153 Ga0111539_10043543 3300009094 Bacteria 5380
154 Ga0111539_10230546 3300009094 Bacteria 2156
155 Ga0111539_10387939 3300009094 Bacteria 1626
156 Ga0111539_10712853 3300009094 Bacteria 1168
157 Ga0105247_10007600 3300009101 Bacteria 6638
158 Ga0105247_10037110 3300009101 Bacteria 2973
159 Ga0114129_10001367 3300009147 Bacteria 32804
160 Ga0114129_10008634 3300009147 Bacteria 14527
161 Ga0114129_10029691 3300009147 Bacteria 7742
162 Ga0114129_10035583 3300009147 Bacteria 7035
163 Ga0114129_10052953 3300009147 Bacteria 5694
164 Ga0114129_10091638 3300009147 Bacteria 4211
165 Ga0114129_10141969 3300009147 Bacteria 3291
166 Ga0114129_10185611 3300009147 Bacteria 2827
167 Ga0114129_10196086 3300009147 Bacteria 2738
168 Ga0114129_10200768 3300009147 Bacteria 2701
169 Ga0114129_10272558 3300009147 Bacteria 2264
170 Ga0114129_10513233 3300009147 Bacteria 1564
171 Ga0114129_10747665 3300009147 Bacteria 1252
172 Ga0105243_10011387 3300009148 Bacteria 6731
173 Ga0105243_10029935 3300009148 Bacteria 4189
174 Ga0105243_10454146 3300009148 Bacteria 1203
175 Ga0105242_10015839 3300009176 Bacteria 5857
176 Ga0105242_10045751 3300009176 Bacteria 3548
177 Ga0105242_10059278 3300009176 Bacteria 3140
178 Ga0105242_10356893 3300009176 Bacteria 1352
179 Ga0105242_10555040 3300009176 Bacteria 1102
180 Ga0105248_10021247 3300009177 Bacteria 7192
181 Ga0105248_10027819 3300009177 Bacteria 6295
182 Ga0105248_10125247 3300009177 Bacteria 2898
183 Ga0105248_10132324 3300009177 Bacteria 2814
184 Ga0105248_10150831 3300009177 Bacteria 2622
185 Ga0105248_10160333 3300009177 Bacteria 2537
186 Ga0105248_10226985 3300009177 Bacteria 2102
187 Ga0105248_10266627 3300009177 Bacteria 1928
188 Ga0105248_10269290 3300009177 Bacteria 1918
189 Ga0105248_10697422 3300009177 Bacteria 1145
190 Ga0105237_10132969 3300009545 Bacteria 2482
191 Ga0105249_10191582 3300009553 Bacteria 1996
192 Ga0105249_10313208 3300009553 Bacteria 1578
193 Ga0163162_10044785 3300013306 Bacteria 4432
194 Ga0163162_10241941 3300013306 Bacteria 1935
195 Ga0157372_10182681 3300013307 Bacteria 2428
196 Ga0163163_10005222 3300014325 Bacteria 11201
197 Ga0163163_10054390 3300014325 Bacteria 3955
198 Ga0163163_10199311 3300014325 Bacteria 2050
199 Ga0157380_10170408 3300014326 Bacteria 1902
200 Ga0157380_10197531 3300014326 Bacteria 1782
201 Ga0157380_10312766 3300014326 Bacteria 1452
202 Ga0157379_10083672 3300014968 Bacteria 2860
203 Ga0157376_10019477 3300014969 Bacteria 5232
204 Ga0157376_10038828 3300014969 Bacteria 3877
205 Ga0157376_10063002 3300014969 Bacteria 3122
206 Ga0157376_10076491 3300014969 Bacteria 2860
207 Ga0157376_10216419 3300014969 Bacteria 1771
208 Ga0207710_10041597 3300025900 Bacteria 2039
209 Ga0207699_10047251 3300025906 Bacteria 2523
210 Ga0207645_10000802 3300025907 Bacteria 26290
211 Ga0207645_10005752 3300025907 Bacteria 8947
212 Ga0207645_10053489 3300025907 Bacteria 2580
213 Ga0207705_10082523 3300025909 Bacteria 2344
214 Ga0207707_10146346 3300025912 Bacteria 2065
215 Ga0207695_10115098 3300025913 Bacteria 2664
216 Ga0207695_10123157 3300025913 Bacteria 2559
217 Ga0207695_10157746 3300025913 Bacteria 2203
218 Ga0207662_10051424 3300025918 Bacteria 2452
219 Ga0207662_10148810 3300025918 Bacteria 1488
220 Ga0207657_10015006 3300025919 Bacteria 7523
221 Ga0207652_10039804 3300025921 Bacteria 3990
222 Ga0207652_10147658 3300025921 Bacteria 2105
223 Ga0207646_10063295 3300025922 Bacteria 3303
224 Ga0207646_10178232 3300025922 Bacteria 1919
225 Ga0207646_10281606 3300025922 Bacteria 1502
226 Ga0207681_10014159 3300025923 Bacteria 4949
227 Ga0207681_10020674 3300025923 Bacteria 4175
228 Ga0207681_10119095 3300025923 Bacteria 1933
229 Ga0207681_10155509 3300025923 Bacteria 1718
230 Ga0207659_10000918 3300025926 Bacteria 17553
231 Ga0207687_10354120 3300025927 Bacteria 1197
232 Ga0207664_10253004 3300025929 Bacteria 1538
233 Ga0207644_10133194 3300025931 Bacteria 1905
234 Ga0207690_10028639 3300025932 Bacteria 3532
235 Ga0207706_10046548 3300025933 Bacteria 3840
236 Ga0207706_10051795 3300025933 Bacteria 3625
237 Ga0207706_10079599 3300025933 Bacteria 2881
238 Ga0207706_10343396 3300025933 Bacteria 1298
239 Ga0207706_10426166 3300025933 Unclassified 1149
240 Ga0207686_10003167 3300025934 Bacteria 8856
241 Ga0207686_10006109 3300025934 Bacteria 6470
242 Ga0207709_10077339 3300025935 Bacteria 2133
243 Ga0207670_10277892 3300025936 Bacteria 1304
244 Ga0207669_10031547 3300025937 Bacteria 2962
245 Ga0207669_10055761 3300025937 Bacteria 2395
246 Ga0207669_10163940 3300025937 Bacteria 1574
247 Ga0207704_10030247 3300025938 Bacteria 3033
248 Ga0207704_10308660 3300025938 Bacteria 1215
249 Ga0207665_10053476 3300025939 Bacteria 2722
250 Ga0207691_10236552 3300025940 Bacteria 1580
251 Ga0207711_10015131 3300025941 Bacteria 6407
252 Ga0207711_10023851 3300025941 Bacteria 5122
253 Ga0207711_10028851 3300025941 Bacteria 4674
254 Ga0207711_10043611 3300025941 Bacteria 3827
255 Ga0207711_10102304 3300025941 Bacteria 2536
256 Ga0207711_10215339 3300025941 Bacteria 1755
257 Ga0207711_10321412 3300025941 Bacteria 1430
258 Ga0207689_10042602 3300025942 Bacteria 3754
259 Ga0207689_10079854 3300025942 Bacteria 2688
260 Ga0207689_10131665 3300025942 Bacteria 2058
261 Ga0207661_10129304 3300025944 Bacteria 2161
262 Ga0207661_10237900 3300025944 Bacteria 1615
263 Ga0207661_10352003 3300025944 Bacteria 1329
264 Ga0207667_10310570 3300025949 Bacteria 1610
265 Ga0207651_10003153 3300025960 Bacteria 8044
266 Ga0207651_10474271 3300025960 Bacteria 1077
267 Ga0207712_10040818 3300025961 Bacteria 3187
268 Ga0207712_10148438 3300025961 Bacteria 1808
269 Ga0207712_10256730 3300025961 Bacteria 1415
270 Ga0207668_10192863 3300025972 Bacteria 1616
271 Ga0207640_10001184 3300025981 Bacteria 14256
272 Ga0207640_10028496 3300025981 Bacteria 3416
273 Ga0207640_10029023 3300025981 Bacteria 3390
274 Ga0207658_10149494 3300025986 Bacteria 1901
275 Ga0207677_10036402 3300026023 Bacteria 3207
276 Ga0207677_10172520 3300026023 Bacteria 1693
277 Ga0207677_10183692 3300026023 Bacteria 1647
278 Ga0207703_10067812 3300026035 Bacteria 2937
279 Ga0207703_10088906 3300026035 Bacteria 2593
280 Ga0207703_10156586 3300026035 Bacteria 1991
281 Ga0207678_10027292 3300026067 Bacteria 4979
282 Ga0207708_10003693 3300026075 Bacteria 11298
283 Ga0207708_10032219 3300026075 Bacteria 3981
284 Ga0207641_10063297 3300026088 Bacteria 3159
285 Ga0207641_10107861 3300026088 Bacteria 2464
286 Ga0207648_10017009 3300026089 Bacteria 6627
287 Ga0207648_10041242 3300026089 Bacteria 4053
288 Ga0207648_10078692 3300026089 Bacteria 2876
289 Ga0207648_10083764 3300026089 Bacteria 2781
290 Ga0207648_10114164 3300026089 Bacteria 2373
291 Ga0207676_10021942 3300026095 Bacteria 4690
292 Ga0207675_100004573 3300026118 Bacteria 13347
293 Ga0207675_100036702 3300026118 Bacteria 4571
294 Ga0207675_100040892 3300026118 Bacteria 4331
295 Ga0207675_100086851 3300026118 Bacteria 2937
296 Ga0207675_100267713 3300026118 Bacteria 1658
297 Ga0207683_10077910 3300026121 Bacteria 2936
298 Ga0207683_10141006 3300026121 Bacteria 2172
299 Ga0209983_1007563 3300027665 Bacteria 2226
300 Ga0209971_1007393 3300027682 Bacteria 2606
301 Ga0207428_10000002 3300027907 Bacteria 854851
302 Ga0207428_10016482 3300027907 Bacteria 6355
303 Ga0207428_10028884 3300027907 Bacteria 4603
304 Ga0268266_10005118 3300028379 Bacteria 12357
305 Ga0268266_10350447 3300028379 Bacteria 1387
306 Ga0268266_10798809 3300028379 Bacteria 911
307 Ga0268265_10000315 3300028380 Bacteria 53210
308 Ga0268265_10014972 3300028380 Bacteria 5296
309 Ga0268265_10025473 3300028380 Bacteria 4199
310 Ga0268265_10097610 3300028380 Bacteria 2364
311 Ga0268265_10116673 3300028380 Bacteria 2191
312 Ga0268265_10261491 3300028380 Bacteria 1539
313 Ga0268264_10050010 3300028381 Bacteria 3479
314 Ga0268264_10051074 3300028381 Bacteria 3445
315 Ga0268264_10281486 3300028381 Bacteria 1558
316 Ga0307408_100027719 3300031548 Bacteria 3907
317 Ga0265314_10058390 3300031711 Bacteria 2644
318 Ga0307416_100070551 3300032002 Bacteria 2898
319 Ga0307416_100369766 3300032002 Bacteria 1459
320 Ga0307415_100024908 3300032126 Bacteria 3746
321 Ga0373948_0001206 3300034817 Bacteria 3520
322 Ga0373958_0004597 3300034819 Bacteria 2051
323 Ga0373938_0001662 3300034957 Bacteria 3567
324 Ga0373926_0088402 3300035083 Bacteria 1150
325 Ga0373929_0000663 3300035085 Bacteria 6619
326 Ga0373940_0001959 3300035088 Bacteria 3887
327 Ga0373944_0074878 3300035089 Bacteria 1109
328 Ga0373949_0002150 3300035090 Bacteria 5173
329 Ga0373951_0000754 3300035091 Bacteria 8843
330 Ga0373952_0000302 3300035092 Bacteria 8220
331 Ga0373923_0038993 3300035111 Bacteria 1949
332 Ga0373932_0012217 3300035112 Bacteria 2111
333 Ga0373939_0002036 3300035114 Bacteria 4823
334 Ga0373939_0017875 3300035114 Bacteria 1890
335 Ga0373941_0001621 3300035115 Bacteria 4793
336 Ga0373953_0128332 3300035117 Bacteria 1080
337 Ga0373943_0005796 3300035170 Bacteria 5548
338 Ga0373946_0008087 3300035171 Bacteria 3861
339 Ga0373955_0030745 3300035172 Bacteria 2807
340 Ga0373955_0231679 3300035172 Bacteria 1105
341 Ga0373942_0000284 3300035207 Bacteria 13775
342 Ga0373961_0000364 3300035241 Bacteria 19453
343 Ga0373962_0023541 3300035242 Bacteria 1641
344 Ga0373931_0050267 3300035691 Bacteria 2218
345 Ga0373931_0165584 3300035691 Bacteria 1299
346 Ga0373935_0029568 3300035692 Bacteria 3391
347 Ga0373935_0033928 3300035692 Bacteria 3179
348 Ga0373927_0116204 3300035695 Bacteria 1744
349 Ga0373947_0006634 3300035725 Bacteria 6717
350 Ga0373937_0395541 3300036401 Bacteria 1311
351 Ga0373925_0009186 3300037068 Bacteria 7199
352 Ga0373925_0055419 3300037068 Bacteria 2968
353 Ga0451849_0160923 3300041505 Bacteria 5903
354 Ga0450921_001204 3300042123 Bacteria 1507
355 Ga0451577_0062732 3300042876 Bacteria 3314
356 Ga0466963_0039122 3300044694 Bacteria 3105
357 Ga0453684_0144098 3300044712 Bacteria 2840
358 Ga0451576_0005014 3300045051 Bacteria 16823
359 Ga0466967_0271728 3300045976 Bacteria 1624
360 Ga0495592_0072476 3300046454 Bacteria 2506
361 Ga0495629_0025099 3300046459 Bacteria 4239
362 Ga0495629_0103052 3300046459 Bacteria 1991
363 Ga0495580_0045080 3300046472 Bacteria 3133
364 Ga0495582_0017467 3300046473 Bacteria 3926
365 Ga0495582_0125529 3300046473 Bacteria 1448
366 Ga0495639_0001920 3300046475 Bacteria 9225
367 Ga0495585_0156760 3300046492 Bacteria 1184
368 Ga0495594_0071087 3300046499 Bacteria 1935
369 Ga0495608_0035263 3300046511 Bacteria 3375
370 Ga0495628_0077312 3300046516 Bacteria 2589
371 Ga0495630_0001943 3300046517 Bacteria 14387
372 Ga0495587_0128325 3300046536 Bacteria 1450
373 Ga0495645_0003879 3300046543 Bacteria 10185
374 Ga0495645_0116158 3300046543 Bacteria 1889
375 Ga0495622_0008970 3300046557 Bacteria 4635
376 Ga0495633_0064217 3300046558 Bacteria 1717
377 Ga0495667_0154896 3300046559 Bacteria 1475
378 Ga0495634_0243096 3300046642 Bacteria 1103
379 Ga0495635_0066993 3300046663 Bacteria 2463
380 Ga0495647_0025299 3300046681 Bacteria 2168
381 Ga0495658_0011622 3300046683 Bacteria 4435
382 Ga0495658_0030083 3300046683 Unclassified 2946
383 Ga0495658_0054719 3300046683 Bacteria 2271
384 Ga0495613_0005250 3300046689 Bacteria 9732
385 Ga0495613_0192651 3300046689 Bacteria 1440
386 Ga0495613_0229391 3300046689 Bacteria 1301
387 Ga0495581_0004997 3300047315 Bacteria 7681
388 Ga0495674_0034999 3300047319 Bacteria 4535
389 Ga0495676_0008166 3300047321 Bacteria 9602
390 Ga0495680_0079617 3300047322 Bacteria 2477
391 Ga0495675_0237963 3300047444 Bacteria 1097
392 Ga0495684_0000174 3300047471 Bacteria 48736
393 Ga0495684_0015904 3300047471 Bacteria 5794
394 Ga0496102_0462778 3300048905 Bacteria 1189
395 Ga0496106_0098370 3300048909 Bacteria 2267
396 Ga0496106_0166817 3300048909 Bacteria 1743
397 Ga0496108_0076993 3300048911 Bacteria 2820
398 Ga0496109_0116200 3300048912 Bacteria 2490
399 Ga0496109_0185569 3300048912 Bacteria 1954
400 Ga0496112_0033032 3300048915 Bacteria 5025
401 Ga0496112_0189183 3300048915 Bacteria 2021
402 Ga0496112_0217688 3300048915 Bacteria 1866
403 Ga0496114_0000105 3300048917 Bacteria 60923
404 Ga0496114_0096570 3300048917 Bacteria 2516
405 Ga0496114_0401097 3300048917 Bacteria 1214
406 Ga0496114_0469853 3300048917 Bacteria 1113
407 Ga0501036_0145280 3300049572 Bacteria 2001
408 Ga0501036_0384821 3300049572 Bacteria 1171
409 Ga0501038_0037889 3300049574 Bacteria 4225
410 Ga0501039_0006038 3300049575 Bacteria 9194
411 Ga0501039_0023078 3300049575 Bacteria 4773
412 Ga0501040_0030184 3300049576 Bacteria 3661
413 Ga0501040_0136281 3300049576 Bacteria 1728
414 Ga0501041_0026882 3300049577 Bacteria 3465
415 Ga0501042_0010107 3300049578 Bacteria 6312
416 Ga0501042_0016995 3300049578 Bacteria 5010
417 Ga0501042_0030305 3300049578 Bacteria 3820
418 Ga0501043_0168068 3300049579 Bacteria 1712
419 Ga0501048_0013092 3300049582 Bacteria 6158
420 Ga0501048_0040451 3300049582 Bacteria 3341
421 Ga0501048_0195421 3300049582 Bacteria 1434
422 Ga0501067_0013705 3300049583 Bacteria 4490
423 Ga0501068_0104107 3300049584 Bacteria 1761
424 Ga0501070_0384357 3300049586 Bacteria 1137
425 Ga0501072_0024017 3300049588 Bacteria 4739
426 Ga0501072_0111023 3300049588 Unclassified 2183
427 Ga0501073_0159089 3300049589 Bacteria 1565
428 Ga0501073_0289461 3300049589 Bacteria 1130
429 Ga0501074_0091234 3300049590 Bacteria 2182
430 Ga0501075_0009227 3300049591 Bacteria 6897
431 Ga0501075_0130384 3300049591 Bacteria 1915
432 Ga0501076_0013912 3300049592 Bacteria 6042
433 Ga0501077_0000162 3300049593 Bacteria 37776
434 Ga0501077_0028214 3300049593 Bacteria 3567
435 Ga0501077_0122023 3300049593 Bacteria 1652
436 Ga0501079_0005806 3300049741 Bacteria 9227
437 Ga0501079_0049794 3300049741 Bacteria 3234
438 Ga0501080_0027202 3300049742 Bacteria 5319
439 Ga0501080_0065597 3300049742 Bacteria 3377
440 Ga0501080_0168084 3300049742 Bacteria 2024
441 Ga0501081_0046305 3300049743 Bacteria 2989
442 Ga0501045_0061427 3300049824 Bacteria 2756
443 nmdc:mga0k408_36528_c1 3300050493 Bacteria 2820
444 nmdc:mga06z11_8914_c1 3300050494 Bacteria 4206
445 nmdc:mga05p37_1036_c1 3300050507 Bacteria 31681
446 nmdc:mga05p37_10839_c1 3300050507 Bacteria 10822
447 nmdc:mga05p37_124475_c1 3300050507 Bacteria 3166
448 nmdc:mga05p37_134595_c1 3300050507 Bacteria 3032
449 nmdc:mga05p37_154075_c1 3300050507 Bacteria 2809
450 nmdc:mga05p37_160277_c1 3300050507 Bacteria 2748
451 nmdc:mga05p37_166011_c1 3300050507 Bacteria 2694
452 nmdc:mga05p37_16708_c1 3300050507 Bacteria 8844
453 nmdc:mga05p37_404068_c1 3300050507 Bacteria 1594
454 nmdc:mga05p37_4703_c1 3300050507 Bacteria 15946
455 nmdc:mga05p37_59539_c1 3300050507 Bacteria 3640
456 nmdc:mga05p37_78972_c1 3300050507 Bacteria 4052
457 nmdc:mga09592_55360_c1 3300050508 Bacteria 3352
458 nmdc:mga0qj67_252244_c1 3300050509 Bacteria 1432
459 nmdc:mga06r32_26256_c1 3300050510 Bacteria 5428
460 nmdc:mga06r32_5663_c1 3300050510 Bacteria 11244
461 nmdc:mga06r32_64117_c1 3300050510 Bacteria 3542
462 nmdc:mga08y16_306479_c1 3300050511 Bacteria 1636
463 nmdc:mga08y16_31309_c1 3300050511 Bacteria 5596
464 nmdc:mga08y16_32739_c1 3300050511 Bacteria 5466
465 nmdc:mga08y16_3591_c1 3300050511 Bacteria 16109
466 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
467 nmdc:mga08y16_4269_c1 3300050511 Bacteria 14915
468 nmdc:mga08y16_45157_c1 3300050511 Bacteria 4616
469 nmdc:mga08y16_556585_c1 3300050511 Unclassified 1160
470 nmdc:mga0n895_16719_c1 3300050512 Bacteria 6740
471 nmdc:mga0n895_25323_c1 3300050512 Bacteria 5605
472 nmdc:mga0n895_3220_c2 3300050512 Bacteria 8352
473 nmdc:mga0n895_4659_c1 3300050512 Bacteria 11311
474 nmdc:mga0n895_51341_c1 3300050512 Bacteria 4045
475 nmdc:mga0rr50_114_c1 3300050513 Bacteria 44678
476 nmdc:mga0rr50_136962_c1 3300050513 Bacteria 1966
477 nmdc:mga0rr50_504_c1 3300050513 Bacteria 20788
478 nmdc:mga08x19_135828_c1 3300050514 Bacteria 1658
479 nmdc:mga08x19_233425_c1 3300050514 Bacteria 1267
480 nmdc:mga08x19_271_c1 3300050514 Bacteria 39236
481 nmdc:mga08x19_27869_c1 3300050514 Bacteria 3535
482 nmdc:mga08x19_35403_c1 3300050514 Bacteria 3159
483 nmdc:mga0a205_13438_c1 3300050515 Bacteria 7623
484 nmdc:mga0a205_274997_c1 3300050515 Bacteria 1560
485 nmdc:mga0a205_48666_c1 3300050515 Bacteria 4092
486 Ga0495601_0003027 3300053077 Bacteria 9582
487 Ga0495601_0014872 3300053077 Bacteria 4698
488 Ga0495601_0026903 3300053077 Bacteria 3555
489 Ga0495601_0038671 3300053077 Bacteria 2984
490 Ga0495595_0030475 3300053084 Bacteria 2420
491 Ga0495595_0073027 3300053084 Bacteria 1624
492 Ga0495595_0091494 3300053084 Bacteria 1460
493 Ga0495619_0009731 3300053085 Bacteria 6061
494 Ga0495619_0015238 3300053085 Bacteria 4861
495 Ga0495619_0073958 3300053085 Bacteria 2284
496 Ga0500555_000424 3300053103 Bacteria 17586
497 Ga0500616_0000167 3300053153 Bacteria 109823
498 Ga0500645_000331 3300053730 Bacteria 33681
499 Ga0501084_0042637 3300054114 Bacteria 3795
500 Ga0501082_0000116 3300060353 Bacteria 62872
501 Ga0501082_0206221 3300060353 Bacteria 1710
502 Ga0501082_0394372 3300060353 Bacteria 1208
503 Ga0530510_0010960 3300061734 Bacteria 6360
504 Ga0530510_0041213 3300061734 Bacteria 3333

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0289461 Ga0501073_0289461_291_1109 272
2 3300049593 Ga0501077_0122023 Ga0501077_0122023_70_921 283
3 3300028379 Ga0268266_10798809 Ga0268266_107988091 285
4 3300046543 Ga0495645_0116158 Ga0495645_0116158_703_1599 290
5 3300044694 Ga0466963_0039122 Ga0466963_0039122_2115_3065 294
6 3300045976 Ga0466967_0271728 Ga0466967_0271728_220_1170 294
7 3300046473 Ga0495582_0017467 Ga0495582_0017467_2162_3109 296
8 3300042123 Ga0450921_001204 Ga0450921_001204_350_1342 300
9 3300014326 Ga0157380_10170408 Ga0157380_101704083 302
10 3300005543 Ga0070672_100211092 Ga0070672_1002110922 305
11 3300025940 Ga0207691_10236552 Ga0207691_102365522 305
12 3300046459 Ga0495629_0025099 Ga0495629_0025099_1067_2023 306
13 3300046475 Ga0495639_0001920 Ga0495639_0001920_6430_7386 306
14 3300046499 Ga0495594_0071087 Ga0495594_0071087_580_1536 306
15 3300046557 Ga0495622_0008970 Ga0495622_0008970_1037_1993 306
16 3300046681 Ga0495647_0025299 Ga0495647_0025299_314_1270 306
17 3300046683 Ga0495658_0030083 Ga0495658_0030083_71_1027 306
18 3300047315 Ga0495581_0004997 Ga0495581_0004997_1900_2856 306
19 3300047321 Ga0495676_0008166 Ga0495676_0008166_2588_3544 306
20 3300050507 nmdc:mga05p37_78972_c1 nmdc:mga05p37_78972_c1_1710_2642 310
21 3300046492 Ga0495585_0156760 Ga0495585_0156760_225_1166 313
22 3300006914 Ga0075436_100143058 Ga0075436_1001430582 314
23 3300026118 Ga0207675_100040892 Ga0207675_1000408924 314
24 3300050514 nmdc:mga08x19_135828_c1 nmdc:mga08x19_135828_c1_177_1145 314
25 3300005290 Ga0065712_10136681 Ga0065712_101366811 315
26 3300005293 Ga0065715_10041229 Ga0065715_100412291 315
27 3300006028 Ga0070717_10470118 Ga0070717_104701181 315
28 3300006846 Ga0075430_100094261 Ga0075430_1000942612 315
29 3300006847 Ga0075431_100052275 Ga0075431_1000522753 315
30 3300009177 Ga0105248_10125247 Ga0105248_101252473 315
31 3300026089 Ga0207648_10114164 Ga0207648_101141642 315
32 3300026121 Ga0207683_10077910 Ga0207683_100779102 315
33 3300005327 Ga0070658_10125321 Ga0070658_101253211 316
34 3300005339 Ga0070660_100032966 Ga0070660_1000329662 316
35 3300005365 Ga0070688_100041542 Ga0070688_1000415422 316
36 3300005530 Ga0070679_100043229 Ga0070679_1000432292 316
37 3300005548 Ga0070665_100000114 Ga0070665_10000011456 316
38 3300005563 Ga0068855_100007855 Ga0068855_10000785513 316
39 3300005616 Ga0068852_100162054 Ga0068852_1001620543 316
40 3300005844 Ga0068862_100000343 Ga0068862_1000003439 316
41 3300006844 Ga0075428_100103786 Ga0075428_1001037863 316
42 3300006914 Ga0075436_100001888 Ga0075436_1000018889 316
43 3300009094 Ga0111539_10387939 Ga0111539_103879392 316
44 3300009094 Ga0111539_10712853 Ga0111539_107128532 316
45 3300009147 Ga0114129_10141969 Ga0114129_101419692 316
46 3300009147 Ga0114129_10272558 Ga0114129_102725582 316
47 3300009553 Ga0105249_10191582 Ga0105249_101915822 316
48 3300025907 Ga0207645_10005752 Ga0207645_100057527 316
49 3300025909 Ga0207705_10082523 Ga0207705_100825232 316
50 3300025919 Ga0207657_10015006 Ga0207657_100150066 316
51 3300025921 Ga0207652_10147658 Ga0207652_101476582 316
52 3300025949 Ga0207667_10310570 Ga0207667_103105702 316
53 3300025961 Ga0207712_10148438 Ga0207712_101484382 316
54 3300028380 Ga0268265_10000315 Ga0268265_1000031529 316
55 3300041505 Ga0451849_0160923 Ga0451849_0160923_4693_5655 316
56 3300049572 Ga0501036_0145280 Ga0501036_0145280_515_1465 316
57 3300049575 Ga0501039_0023078 Ga0501039_0023078_1189_2139 316
58 3300049577 Ga0501041_0026882 Ga0501041_0026882_749_1699 316
59 3300049578 Ga0501042_0010107 Ga0501042_0010107_3209_4159 316
60 3300049582 Ga0501048_0040451 Ga0501048_0040451_514_1464 316
61 3300049583 Ga0501067_0013705 Ga0501067_0013705_3180_4142 316
62 3300049584 Ga0501068_0104107 Ga0501068_0104107_481_1431 316
63 3300049591 Ga0501075_0009227 Ga0501075_0009227_4496_5446 316
64 3300049591 Ga0501075_0130384 Ga0501075_0130384_132_1094 316
65 3300049593 Ga0501077_0000162 Ga0501077_0000162_31687_32649 316
66 3300049742 Ga0501080_0027202 Ga0501080_0027202_2772_3734 316
67 3300050507 nmdc:mga05p37_59539_c1 nmdc:mga05p37_59539_c1_2404_3360 316
68 3300050511 nmdc:mga08y16_306479_c1 nmdc:mga08y16_306479_c1_379_1329 316
69 3300050514 nmdc:mga08x19_271_c1 nmdc:mga08x19_271_c1_4782_5744 316
70 3300053153 Ga0500616_0000167 Ga0500616_0000167_74720_75751 316
71 3300060353 Ga0501082_0000116 Ga0501082_0000116_9085_10047 316
72 3300005329 Ga0070683_100201845 Ga0070683_1002018452 317
73 3300005347 Ga0070668_100259686 Ga0070668_1002596862 317
74 3300005456 Ga0070678_100150675 Ga0070678_1001506752 317
75 3300005467 Ga0070706_100188670 Ga0070706_1001886701 317
76 3300009094 Ga0111539_10004657 Ga0111539_1000465715 317
77 3300009553 Ga0105249_10313208 Ga0105249_103132082 317
78 3300013307 Ga0157372_10182681 Ga0157372_101826812 317
79 3300025907 Ga0207645_10053489 Ga0207645_100534892 317
80 3300025933 Ga0207706_10079599 Ga0207706_100795993 317
81 3300025937 Ga0207669_10055761 Ga0207669_100557612 317
82 3300025972 Ga0207668_10192863 Ga0207668_101928632 317
83 3300026089 Ga0207648_10078692 Ga0207648_100786923 317
84 3300026121 Ga0207683_10141006 Ga0207683_101410063 317
85 3300027665 Ga0209983_1007563 Ga0209983_10075632 317
86 3300027682 Ga0209971_1007393 Ga0209971_10073932 317
87 3300027907 Ga0207428_10016482 Ga0207428_100164825 317
88 3300031548 Ga0307408_100027719 Ga0307408_1000277193 317
89 3300032002 Ga0307416_100369766 Ga0307416_1003697662 317
90 3300032126 Ga0307415_100024908 Ga0307415_1000249083 317
91 3300046689 Ga0495613_0229391 Ga0495613_0229391_81_1040 317
92 3300048915 Ga0496112_0189183 Ga0496112_0189183_222_1193 317
93 3300050511 nmdc:mga08y16_3591_c1 nmdc:mga08y16_3591_c1_3700_4719 317
94 3300053077 Ga0495601_0014872 Ga0495601_0014872_189_1148 317
95 3300053084 Ga0495595_0030475 Ga0495595_0030475_1103_2062 317
96 3300053085 Ga0495619_0009731 Ga0495619_0009731_3247_4206 317
97 3300060353 Ga0501082_0394372 Ga0501082_0394372_113_1084 317
98 3300005530 Ga0070679_100025481 Ga0070679_1000254814 318
99 3300005617 Ga0068859_100014186 Ga0068859_1000141866 318
100 3300006844 Ga0075428_100062654 Ga0075428_1000626544 318
101 3300006871 Ga0075434_100106969 Ga0075434_1001069692 318
102 3300006931 Ga0097620_100014186 Ga0097620_1000141865 318
103 3300009176 Ga0105242_10356893 Ga0105242_103568932 318
104 3300009177 Ga0105248_10269290 Ga0105248_102692902 318
105 3300025921 Ga0207652_10039804 Ga0207652_100398043 318
106 3300025942 Ga0207689_10079854 Ga0207689_100798542 318
107 3300025961 Ga0207712_10256730 Ga0207712_102567302 318
108 3300042876 Ga0451577_0062732 Ga0451577_0062732_2211_3167 318
109 3300044712 Ga0453684_0144098 Ga0453684_0144098_621_1577 318
110 3300049572 Ga0501036_0384821 Ga0501036_0384821_175_1131 318
111 3300049574 Ga0501038_0037889 Ga0501038_0037889_214_1170 318
112 3300049576 Ga0501040_0030184 Ga0501040_0030184_1794_2750 318
113 3300049578 Ga0501042_0030305 Ga0501042_0030305_287_1243 318
114 3300049579 Ga0501043_0168068 Ga0501043_0168068_658_1614 318
115 3300049582 Ga0501048_0013092 Ga0501048_0013092_1617_2573 318
116 3300049588 Ga0501072_0111023 Ga0501072_0111023_104_1060 318
117 3300049592 Ga0501076_0013912 Ga0501076_0013912_5051_6007 318
118 3300049741 Ga0501079_0005806 Ga0501079_0005806_5799_6755 318
119 3300049824 Ga0501045_0061427 Ga0501045_0061427_935_1891 318
120 3300050510 nmdc:mga06r32_26256_c1 nmdc:mga06r32_26256_c1_356_1315 318
121 3300050512 nmdc:mga0n895_51341_c1 nmdc:mga0n895_51341_c1_1531_2487 318
122 3300053103 Ga0500555_000424 Ga0500555_000424_11651_12652 318
123 3300053730 Ga0500645_000331 Ga0500645_000331_11662_12663 318
124 3300054114 Ga0501084_0042637 Ga0501084_0042637_2493_3449 318
125 3300061734 Ga0530510_0010960 Ga0530510_0010960_245_1201 318
126 3300005338 Ga0068868_100191021 Ga0068868_1001910212 319
127 3300005353 Ga0070669_100073654 Ga0070669_1000736542 319
128 3300005354 Ga0070675_100001125 Ga0070675_10000112518 319
129 3300005354 Ga0070675_100030018 Ga0070675_1000300183 319
130 3300005355 Ga0070671_100012471 Ga0070671_1000124714 319
131 3300005356 Ga0070674_100002729 Ga0070674_1000027293 319
132 3300005364 Ga0070673_100102408 Ga0070673_1001024082 319
133 3300005364 Ga0070673_100122252 Ga0070673_1001222522 319
134 3300005366 Ga0070659_100127559 Ga0070659_1001275591 319
135 3300005367 Ga0070667_100194485 Ga0070667_1001944852 319
136 3300005457 Ga0070662_100083365 Ga0070662_1000833652 319
137 3300005468 Ga0070707_100046718 Ga0070707_1000467184 319
138 3300005471 Ga0070698_100229144 Ga0070698_1002291442 319
139 3300005548 Ga0070665_100138593 Ga0070665_1001385932 319
140 3300005549 Ga0070704_100234113 Ga0070704_1002341132 319
141 3300005563 Ga0068855_100527750 Ga0068855_1005277502 319
142 3300005718 Ga0068866_10010088 Ga0068866_100100883 319
143 3300005719 Ga0068861_100036631 Ga0068861_1000366312 319
144 3300005719 Ga0068861_100106119 Ga0068861_1001061192 319
145 3300005719 Ga0068861_100457237 Ga0068861_1004572371 319
146 3300005844 Ga0068862_100108009 Ga0068862_1001080092 319
147 3300006042 Ga0075368_10103880 Ga0075368_101038802 319
148 3300006178 Ga0075367_10011253 Ga0075367_100112533 319
149 3300006195 Ga0075366_10010282 Ga0075366_100102824 319
150 3300006844 Ga0075428_100000108 Ga0075428_10000010857 319
151 3300006844 Ga0075428_100032880 Ga0075428_1000328803 319
152 3300006846 Ga0075430_100043470 Ga0075430_1000434702 319
153 3300006847 Ga0075431_100055778 Ga0075431_1000557783 319
154 3300006847 Ga0075431_100200466 Ga0075431_1002004662 319
155 3300006852 Ga0075433_10039685 Ga0075433_100396853 319
156 3300006852 Ga0075433_10094658 Ga0075433_100946583 319
157 3300006914 Ga0075436_100166813 Ga0075436_1001668132 319
158 3300009094 Ga0111539_10000001 Ga0111539_10000001254 319
159 3300009094 Ga0111539_10043543 Ga0111539_100435434 319
160 3300009094 Ga0111539_10230546 Ga0111539_102305462 319
161 3300009147 Ga0114129_10029691 Ga0114129_100296912 319
162 3300009147 Ga0114129_10035583 Ga0114129_100355835 319
163 3300009147 Ga0114129_10052953 Ga0114129_100529534 319
164 3300009147 Ga0114129_10091638 Ga0114129_100916383 319
165 3300009147 Ga0114129_10196086 Ga0114129_101960862 319
166 3300009147 Ga0114129_10200768 Ga0114129_102007683 319
167 3300009148 Ga0105243_10029935 Ga0105243_100299352 319
168 3300009177 Ga0105248_10027819 Ga0105248_100278193 319
169 3300009545 Ga0105237_10132969 Ga0105237_101329692 319
170 3300014325 Ga0163163_10199311 Ga0163163_101993112 319
171 3300014326 Ga0157380_10197531 Ga0157380_101975312 319
172 3300014326 Ga0157380_10312766 Ga0157380_103127661 319
173 3300025913 Ga0207695_10115098 Ga0207695_101150983 319
174 3300025922 Ga0207646_10063295 Ga0207646_100632953 319
175 3300025923 Ga0207681_10020674 Ga0207681_100206742 319
176 3300025923 Ga0207681_10119095 Ga0207681_101190952 319
177 3300025926 Ga0207659_10000918 Ga0207659_100009183 319
178 3300025929 Ga0207664_10253004 Ga0207664_102530042 319
179 3300025932 Ga0207690_10028639 Ga0207690_100286392 319
180 3300025933 Ga0207706_10343396 Ga0207706_103433961 319
181 3300025935 Ga0207709_10077339 Ga0207709_100773392 319
182 3300025937 Ga0207669_10031547 Ga0207669_100315471 319
183 3300025938 Ga0207704_10030247 Ga0207704_100302473 319
184 3300025941 Ga0207711_10023851 Ga0207711_100238513 319
185 3300025960 Ga0207651_10474271 Ga0207651_104742711 319
186 3300025961 Ga0207712_10040818 Ga0207712_100408183 319
187 3300025986 Ga0207658_10149494 Ga0207658_101494942 319
188 3300026023 Ga0207677_10172520 Ga0207677_101725202 319
189 3300026067 Ga0207678_10027292 Ga0207678_100272922 319
190 3300026089 Ga0207648_10041242 Ga0207648_100412423 319
191 3300026118 Ga0207675_100036702 Ga0207675_1000367022 319
192 3300027907 Ga0207428_10000002 Ga0207428_10000002267 319
193 3300028380 Ga0268265_10025473 Ga0268265_100254732 319
194 3300035241 Ga0373961_0000364 Ga0373961_0000364_1860_2831 319
195 3300035692 Ga0373935_0029568 Ga0373935_0029568_841_1806 319
196 3300048917 Ga0496114_0000105 Ga0496114_0000105_55100_56131 319
197 3300049575 Ga0501039_0006038 Ga0501039_0006038_7695_8666 319
198 3300049576 Ga0501040_0136281 Ga0501040_0136281_687_1658 319
199 3300049578 Ga0501042_0016995 Ga0501042_0016995_3075_4046 319
200 3300049582 Ga0501048_0195421 Ga0501048_0195421_327_1322 319
201 3300049586 Ga0501070_0384357 Ga0501070_0384357_51_1025 319
202 3300049588 Ga0501072_0024017 Ga0501072_0024017_1959_2930 319
203 3300049589 Ga0501073_0159089 Ga0501073_0159089_448_1422 319
204 3300049590 Ga0501074_0091234 Ga0501074_0091234_14_985 319
205 3300049593 Ga0501077_0028214 Ga0501077_0028214_844_1815 319
206 3300049741 Ga0501079_0049794 Ga0501079_0049794_282_1253 319
207 3300049742 Ga0501080_0065597 Ga0501080_0065597_1859_2833 319
208 3300049742 Ga0501080_0168084 Ga0501080_0168084_88_1059 319
209 3300049743 Ga0501081_0046305 Ga0501081_0046305_1316_2287 319
210 3300050493 nmdc:mga0k408_36528_c1 nmdc:mga0k408_36528_c1_1035_2009 319
211 3300050494 nmdc:mga06z11_8914_c1 nmdc:mga06z11_8914_c1_428_1402 319
212 3300050507 nmdc:mga05p37_124475_c1 nmdc:mga05p37_124475_c1_443_1417 319
213 3300050507 nmdc:mga05p37_154075_c1 nmdc:mga05p37_154075_c1_391_1350 319
214 3300050507 nmdc:mga05p37_160277_c1 nmdc:mga05p37_160277_c1_971_1942 319
215 3300050508 nmdc:mga09592_55360_c1 nmdc:mga09592_55360_c1_1888_2859 319
216 3300050509 nmdc:mga0qj67_252244_c1 nmdc:mga0qj67_252244_c1_447_1418 319
217 3300050510 nmdc:mga06r32_5663_c1 nmdc:mga06r32_5663_c1_937_1908 319
218 3300050510 nmdc:mga06r32_64117_c1 nmdc:mga06r32_64117_c1_591_1550 319
219 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_288399_289376 319
220 3300050511 nmdc:mga08y16_4269_c1 nmdc:mga08y16_4269_c1_11568_12530 319
221 3300050511 nmdc:mga08y16_556585_c1 nmdc:mga08y16_556585_c1_155_1129 319
222 3300050514 nmdc:mga08x19_27869_c1 nmdc:mga08x19_27869_c1_1842_2801 319
223 3300050515 nmdc:mga0a205_274997_c1 nmdc:mga0a205_274997_c1_568_1533 319
224 3300050515 nmdc:mga0a205_48666_c1 nmdc:mga0a205_48666_c1_2399_3373 319
225 3300060353 Ga0501082_0206221 Ga0501082_0206221_172_1143 319
226 3300061734 Ga0530510_0041213 Ga0530510_0041213_271_1242 319
227 3300005328 Ga0070676_10127162 Ga0070676_101271622 320
228 3300005334 Ga0068869_100070458 Ga0068869_1000704583 320
229 3300005334 Ga0068869_100348737 Ga0068869_1003487372 320
230 3300005364 Ga0070673_100346856 Ga0070673_1003468562 320
231 3300005364 Ga0070673_100455276 Ga0070673_1004552762 320
232 3300005434 Ga0070709_10017425 Ga0070709_100174251 320
233 3300005436 Ga0070713_100028496 Ga0070713_1000284962 320
234 3300005439 Ga0070711_100074170 Ga0070711_1000741702 320
235 3300005445 Ga0070708_100025380 Ga0070708_1000253803 320
236 3300005445 Ga0070708_100142447 Ga0070708_1001424472 320
237 3300005459 Ga0068867_100324171 Ga0068867_1003241712 320
238 3300005468 Ga0070707_100575084 Ga0070707_1005750841 320
239 3300005471 Ga0070698_100058391 Ga0070698_1000583914 320
240 3300005535 Ga0070684_100290842 Ga0070684_1002908421 320
241 3300005549 Ga0070704_100220743 Ga0070704_1002207432 320
242 3300005578 Ga0068854_100024065 Ga0068854_1000240653 320
243 3300005615 Ga0070702_100091819 Ga0070702_1000918192 320
244 3300005617 Ga0068859_100313296 Ga0068859_1003132962 320
245 3300005617 Ga0068859_100345753 Ga0068859_1003457532 320
246 3300005842 Ga0068858_100000761 Ga0068858_10000076121 320
247 3300005842 Ga0068858_100589638 Ga0068858_1005896381 320
248 3300005843 Ga0068860_100176456 Ga0068860_1001764562 320
249 3300006028 Ga0070717_10059812 Ga0070717_100598122 320
250 3300006178 Ga0075367_10215139 Ga0075367_102151391 320
251 3300006237 Ga0097621_100000066 Ga0097621_10000006617 320
252 3300006237 Ga0097621_100003865 Ga0097621_1000038652 320
253 3300006358 Ga0068871_100000170 Ga0068871_10000017048 320
254 3300006358 Ga0068871_100016674 Ga0068871_1000166744 320
255 3300006931 Ga0097620_100313295 Ga0097620_1003132952 320
256 3300006931 Ga0097620_100345752 Ga0097620_1003457522 320
257 3300009094 Ga0111539_10001440 Ga0111539_1000144016 320
258 3300009094 Ga0111539_10022916 Ga0111539_100229167 320
259 3300009101 Ga0105247_10007600 Ga0105247_100076002 320
260 3300009176 Ga0105242_10059278 Ga0105242_100592783 320
261 3300009176 Ga0105242_10555040 Ga0105242_105550401 320
262 3300009177 Ga0105248_10150831 Ga0105248_101508312 320
263 3300009177 Ga0105248_10697422 Ga0105248_106974222 320
264 3300013306 Ga0163162_10241941 Ga0163162_102419412 320
265 3300014968 Ga0157379_10083672 Ga0157379_100836722 320
266 3300014969 Ga0157376_10019477 Ga0157376_100194773 320
267 3300014969 Ga0157376_10038828 Ga0157376_100388284 320
268 3300025900 Ga0207710_10041597 Ga0207710_100415972 320
269 3300025906 Ga0207699_10047251 Ga0207699_100472512 320
270 3300025912 Ga0207707_10146346 Ga0207707_101463462 320
271 3300025913 Ga0207695_10123157 Ga0207695_101231573 320
272 3300025927 Ga0207687_10354120 Ga0207687_103541201 320
273 3300025933 Ga0207706_10426166 Ga0207706_104261661 320
274 3300025934 Ga0207686_10003167 Ga0207686_100031677 320
275 3300025938 Ga0207704_10308660 Ga0207704_103086602 320
276 3300025941 Ga0207711_10043611 Ga0207711_100436113 320
277 3300025941 Ga0207711_10102304 Ga0207711_101023042 320
278 3300025941 Ga0207711_10321412 Ga0207711_103214122 320
279 3300025942 Ga0207689_10042602 Ga0207689_100426023 320
280 3300025944 Ga0207661_10129304 Ga0207661_101293043 320
281 3300025944 Ga0207661_10352003 Ga0207661_103520032 320
282 3300025960 Ga0207651_10003153 Ga0207651_100031532 320
283 3300025981 Ga0207640_10028496 Ga0207640_100284963 320
284 3300026035 Ga0207703_10088906 Ga0207703_100889063 320
285 3300026035 Ga0207703_10156586 Ga0207703_101565861 320
286 3300027907 Ga0207428_10028884 Ga0207428_100288843 320
287 3300028379 Ga0268266_10350447 Ga0268266_103504472 320
288 3300028380 Ga0268265_10261491 Ga0268265_102614912 320
289 3300028381 Ga0268264_10051074 Ga0268264_100510743 320
290 3300031711 Ga0265314_10058390 Ga0265314_100583903 320
291 3300032002 Ga0307416_100070551 Ga0307416_1000705513 320
292 3300035083 Ga0373926_0088402 Ga0373926_0088402_120_1082 320
293 3300035089 Ga0373944_0074878 Ga0373944_0074878_84_1046 320
294 3300035111 Ga0373923_0038993 Ga0373923_0038993_639_1601 320
295 3300035117 Ga0373953_0128332 Ga0373953_0128332_14_976 320
296 3300035170 Ga0373943_0005796 Ga0373943_0005796_2489_3451 320
297 3300035171 Ga0373946_0008087 Ga0373946_0008087_741_1703 320
298 3300035172 Ga0373955_0030745 Ga0373955_0030745_631_1593 320
299 3300035242 Ga0373962_0023541 Ga0373962_0023541_618_1607 320
300 3300035691 Ga0373931_0165584 Ga0373931_0165584_297_1259 320
301 3300035692 Ga0373935_0033928 Ga0373935_0033928_1748_2710 320
302 3300035695 Ga0373927_0116204 Ga0373927_0116204_271_1233 320
303 3300035725 Ga0373947_0006634 Ga0373947_0006634_1476_2438 320
304 3300036401 Ga0373937_0395541 Ga0373937_0395541_301_1263 320
305 3300037068 Ga0373925_0009186 Ga0373925_0009186_3775_4737 320
306 3300037068 Ga0373925_0055419 Ga0373925_0055419_1976_2938 320
307 3300046454 Ga0495592_0072476 Ga0495592_0072476_1126_2088 320
308 3300046472 Ga0495580_0045080 Ga0495580_0045080_118_1080 320
309 3300046511 Ga0495608_0035263 Ga0495608_0035263_2032_2994 320
310 3300046516 Ga0495628_0077312 Ga0495628_0077312_134_1096 320
311 3300046517 Ga0495630_0001943 Ga0495630_0001943_3295_4257 320
312 3300046536 Ga0495587_0128325 Ga0495587_0128325_150_1112 320
313 3300046642 Ga0495634_0243096 Ga0495634_0243096_124_1086 320
314 3300046689 Ga0495613_0005250 Ga0495613_0005250_6782_7744 320
315 3300046689 Ga0495613_0192651 Ga0495613_0192651_250_1212 320
316 3300047319 Ga0495674_0034999 Ga0495674_0034999_922_1884 320
317 3300047322 Ga0495680_0079617 Ga0495680_0079617_19_981 320
318 3300047444 Ga0495675_0237963 Ga0495675_0237963_107_1069 320
319 3300047471 Ga0495684_0000174 Ga0495684_0000174_2843_3805 320
320 3300048912 Ga0496109_0185569 Ga0496109_0185569_960_1922 320
321 3300048917 Ga0496114_0469853 Ga0496114_0469853_41_1003 320
322 3300050511 nmdc:mga08y16_31309_c1 nmdc:mga08y16_31309_c1_843_1805 320
323 3300050511 nmdc:mga08y16_45157_c1 nmdc:mga08y16_45157_c1_2451_3413 320
324 3300053077 Ga0495601_0003027 Ga0495601_0003027_3064_4026 320
325 3300053084 Ga0495595_0091494 Ga0495595_0091494_107_1069 320
326 3300053085 Ga0495619_0015238 Ga0495619_0015238_969_1931 320
327 3300005355 Ga0070671_100049537 Ga0070671_1000495371 321
328 3300005365 Ga0070688_100138921 Ga0070688_1001389211 321
329 3300005367 Ga0070667_100004898 Ga0070667_1000048983 321
330 3300005438 Ga0070701_10001830 Ga0070701_100018305 321
331 3300005536 Ga0070697_100210647 Ga0070697_1002106472 321
332 3300005543 Ga0070672_100056015 Ga0070672_1000560153 321
333 3300005841 Ga0068863_100003994 Ga0068863_1000039948 321
334 3300005843 Ga0068860_100120173 Ga0068860_1001201731 321
335 3300005844 Ga0068862_100054545 Ga0068862_1000545452 321
336 3300005985 Ga0081539_10011075 Ga0081539_100110756 321
337 3300006173 Ga0070716_100017576 Ga0070716_1000175763 321
338 3300006852 Ga0075433_10033716 Ga0075433_100337163 321
339 3300006871 Ga0075434_100013487 Ga0075434_1000134873 321
340 3300006871 Ga0075434_100061081 Ga0075434_1000610813 321
341 3300007076 Ga0075435_100309533 Ga0075435_1003095332 321
342 3300009094 Ga0111539_10008383 Ga0111539_100083839 321
343 3300009147 Ga0114129_10001367 Ga0114129_1000136726 321
344 3300009147 Ga0114129_10008634 Ga0114129_1000863412 321
345 3300009147 Ga0114129_10513233 Ga0114129_105132332 321
346 3300009147 Ga0114129_10747665 Ga0114129_107476651 321
347 3300009148 Ga0105243_10454146 Ga0105243_104541462 321
348 3300009177 Ga0105248_10160333 Ga0105248_101603333 321
349 3300014969 Ga0157376_10076491 Ga0157376_100764913 321
350 3300025931 Ga0207644_10133194 Ga0207644_101331942 321
351 3300025936 Ga0207670_10277892 Ga0207670_102778922 321
352 3300025941 Ga0207711_10028851 Ga0207711_100288514 321
353 3300025944 Ga0207661_10237900 Ga0207661_102379002 321
354 3300026088 Ga0207641_10063297 Ga0207641_100632972 321
355 3300028380 Ga0268265_10014972 Ga0268265_100149723 321
356 3300028381 Ga0268264_10050010 Ga0268264_100500104 321
357 3300035114 Ga0373939_0017875 Ga0373939_0017875_262_1269 321
358 3300035691 Ga0373931_0050267 Ga0373931_0050267_331_1338 321
359 3300048909 Ga0496106_0166817 Ga0496106_0166817_249_1256 321
360 3300048912 Ga0496109_0116200 Ga0496109_0116200_953_1960 321
361 3300050507 nmdc:mga05p37_1036_c1 nmdc:mga05p37_1036_c1_7734_8699 321
362 3300050507 nmdc:mga05p37_10839_c1 nmdc:mga05p37_10839_c1_6512_7519 321
363 3300050507 nmdc:mga05p37_16708_c1 nmdc:mga05p37_16708_c1_3687_4733 321
364 3300050507 nmdc:mga05p37_404068_c1 nmdc:mga05p37_404068_c1_312_1277 321
365 3300050507 nmdc:mga05p37_4703_c1 nmdc:mga05p37_4703_c1_8327_9334 321
366 3300050511 nmdc:mga08y16_32739_c1 nmdc:mga08y16_32739_c1_2926_3933 321
367 3300050512 nmdc:mga0n895_25323_c1 nmdc:mga0n895_25323_c1_1878_2885 321
368 3300050515 nmdc:mga0a205_13438_c1 nmdc:mga0a205_13438_c1_4138_5103 321
369 3300005290 Ga0065712_10116129 Ga0065712_101161292 322
370 3300005335 Ga0070666_10016739 Ga0070666_100167394 322
371 3300005336 Ga0070680_100068639 Ga0070680_1000686391 322
372 3300005338 Ga0068868_100119246 Ga0068868_1001192463 322
373 3300005338 Ga0068868_100134555 Ga0068868_1001345552 322
374 3300005341 Ga0070691_10001081 Ga0070691_100010817 322
375 3300005440 Ga0070705_100001314 Ga0070705_1000013144 322
376 3300005440 Ga0070705_100029176 Ga0070705_1000291762 322
377 3300005441 Ga0070700_100001496 Ga0070700_1000014963 322
378 3300005444 Ga0070694_100003841 Ga0070694_1000038415 322
379 3300005457 Ga0070662_100149275 Ga0070662_1001492752 322
380 3300005459 Ga0068867_100024164 Ga0068867_1000241642 322
381 3300005459 Ga0068867_100092604 Ga0068867_1000926043 322
382 3300005535 Ga0070684_100105093 Ga0070684_1001050932 322
383 3300005544 Ga0070686_100001857 Ga0070686_10000185710 322
384 3300005545 Ga0070695_100007402 Ga0070695_1000074025 322
385 3300005546 Ga0070696_100009529 Ga0070696_1000095294 322
386 3300005546 Ga0070696_100197976 Ga0070696_1001979762 322
387 3300005548 Ga0070665_100014083 Ga0070665_1000140834 322
388 3300005549 Ga0070704_100046941 Ga0070704_1000469413 322
389 3300005578 Ga0068854_100010165 Ga0068854_1000101653 322
390 3300005578 Ga0068854_100266721 Ga0068854_1002667212 322
391 3300005615 Ga0070702_100040715 Ga0070702_1000407151 322
392 3300005618 Ga0068864_100030833 Ga0068864_1000308332 322
393 3300005718 Ga0068866_10153419 Ga0068866_101534192 322
394 3300005719 Ga0068861_100001397 Ga0068861_10000139710 322
395 3300005719 Ga0068861_100097598 Ga0068861_1000975982 322
396 3300005719 Ga0068861_100347536 Ga0068861_1003475362 322
397 3300005841 Ga0068863_100120582 Ga0068863_1001205822 322
398 3300005841 Ga0068863_100350835 Ga0068863_1003508351 322
399 3300005842 Ga0068858_100007567 Ga0068858_1000075676 322
400 3300005842 Ga0068858_100048637 Ga0068858_1000486373 322
401 3300005844 Ga0068862_100025130 Ga0068862_1000251304 322
402 3300006173 Ga0070716_100042379 Ga0070716_1000423793 322
403 3300006237 Ga0097621_100011699 Ga0097621_1000116993 322
404 3300006237 Ga0097621_100135923 Ga0097621_1001359232 322
405 3300006871 Ga0075434_100056443 Ga0075434_1000564432 322
406 3300006871 Ga0075434_100193581 Ga0075434_1001935812 322
407 3300006914 Ga0075436_100005597 Ga0075436_1000055977 322
408 3300006914 Ga0075436_100039290 Ga0075436_1000392903 322
409 3300007076 Ga0075435_100001969 Ga0075435_10000196910 322
410 3300007076 Ga0075435_100002082 Ga0075435_1000020829 322
411 3300007076 Ga0075435_100068091 Ga0075435_1000680912 322
412 3300009093 Ga0105240_10360214 Ga0105240_103602142 322
413 3300009101 Ga0105247_10037110 Ga0105247_100371103 322
414 3300009147 Ga0114129_10185611 Ga0114129_101856112 322
415 3300009148 Ga0105243_10011387 Ga0105243_100113875 322
416 3300009176 Ga0105242_10015839 Ga0105242_100158393 322
417 3300009176 Ga0105242_10045751 Ga0105242_100457513 322
418 3300009177 Ga0105248_10021247 Ga0105248_100212474 322
419 3300009177 Ga0105248_10132324 Ga0105248_101323243 322
420 3300009177 Ga0105248_10226985 Ga0105248_102269854 322
421 3300009177 Ga0105248_10266627 Ga0105248_102666272 322
422 3300013306 Ga0163162_10044785 Ga0163162_100447854 322
423 3300014325 Ga0163163_10005222 Ga0163163_1000522210 322
424 3300014325 Ga0163163_10054390 Ga0163163_100543903 322
425 3300014969 Ga0157376_10063002 Ga0157376_100630022 322
426 3300014969 Ga0157376_10216419 Ga0157376_102164192 322
427 3300025907 Ga0207645_10000802 Ga0207645_100008028 322
428 3300025913 Ga0207695_10157746 Ga0207695_101577462 322
429 3300025918 Ga0207662_10051424 Ga0207662_100514242 322
430 3300025918 Ga0207662_10148810 Ga0207662_101488102 322
431 3300025922 Ga0207646_10178232 Ga0207646_101782322 322
432 3300025922 Ga0207646_10281606 Ga0207646_102816062 322
433 3300025923 Ga0207681_10014159 Ga0207681_100141593 322
434 3300025923 Ga0207681_10155509 Ga0207681_101555091 322
435 3300025933 Ga0207706_10046548 Ga0207706_100465482 322
436 3300025933 Ga0207706_10051795 Ga0207706_100517953 322
437 3300025934 Ga0207686_10006109 Ga0207686_100061095 322
438 3300025937 Ga0207669_10163940 Ga0207669_101639402 322
439 3300025939 Ga0207665_10053476 Ga0207665_100534762 322
440 3300025941 Ga0207711_10015131 Ga0207711_100151312 322
441 3300025941 Ga0207711_10215339 Ga0207711_102153392 322
442 3300025942 Ga0207689_10131665 Ga0207689_101316652 322
443 3300025981 Ga0207640_10001184 Ga0207640_100011846 322
444 3300025981 Ga0207640_10029023 Ga0207640_100290233 322
445 3300026023 Ga0207677_10036402 Ga0207677_100364022 322
446 3300026023 Ga0207677_10183692 Ga0207677_101836923 322
447 3300026035 Ga0207703_10067812 Ga0207703_100678123 322
448 3300026075 Ga0207708_10003693 Ga0207708_1000369310 322
449 3300026075 Ga0207708_10032219 Ga0207708_100322193 322
450 3300026088 Ga0207641_10107861 Ga0207641_101078612 322
451 3300026089 Ga0207648_10017009 Ga0207648_100170093 322
452 3300026089 Ga0207648_10083764 Ga0207648_100837642 322
453 3300026095 Ga0207676_10021942 Ga0207676_100219424 322
454 3300026118 Ga0207675_100004573 Ga0207675_1000045739 322
455 3300026118 Ga0207675_100086851 Ga0207675_1000868512 322
456 3300026118 Ga0207675_100267713 Ga0207675_1002677132 322
457 3300028379 Ga0268266_10005118 Ga0268266_100051183 322
458 3300028380 Ga0268265_10097610 Ga0268265_100976103 322
459 3300028380 Ga0268265_10116673 Ga0268265_101166733 322
460 3300028381 Ga0268264_10281486 Ga0268264_102814862 322
461 3300034817 Ga0373948_0001206 Ga0373948_0001206_655_1650 322
462 3300034819 Ga0373958_0004597 Ga0373958_0004597_1039_2034 322
463 3300034957 Ga0373938_0001662 Ga0373938_0001662_2166_3161 322
464 3300035085 Ga0373929_0000663 Ga0373929_0000663_3023_4018 322
465 3300035088 Ga0373940_0001959 Ga0373940_0001959_1758_2753 322
466 3300035090 Ga0373949_0002150 Ga0373949_0002150_2396_3391 322
467 3300035091 Ga0373951_0000754 Ga0373951_0000754_816_1811 322
468 3300035092 Ga0373952_0000302 Ga0373952_0000302_6628_7623 322
469 3300035112 Ga0373932_0012217 Ga0373932_0012217_1090_2085 322
470 3300035114 Ga0373939_0002036 Ga0373939_0002036_1774_2769 322
471 3300035115 Ga0373941_0001621 Ga0373941_0001621_2745_3740 322
472 3300035172 Ga0373955_0231679 Ga0373955_0231679_28_996 322
473 3300035207 Ga0373942_0000284 Ga0373942_0000284_2412_3407 322
474 3300045051 Ga0451576_0005014 Ga0451576_0005014_1635_2630 322
475 3300046459 Ga0495629_0103052 Ga0495629_0103052_345_1313 322
476 3300046473 Ga0495582_0125529 Ga0495582_0125529_40_1008 322
477 3300046543 Ga0495645_0003879 Ga0495645_0003879_6690_7658 322
478 3300046558 Ga0495633_0064217 Ga0495633_0064217_112_1089 322
479 3300046559 Ga0495667_0154896 Ga0495667_0154896_398_1366 322
480 3300046663 Ga0495635_0066993 Ga0495635_0066993_1198_2166 322
481 3300046683 Ga0495658_0011622 Ga0495658_0011622_3141_4109 322
482 3300046683 Ga0495658_0054719 Ga0495658_0054719_76_1044 322
483 3300047471 Ga0495684_0015904 Ga0495684_0015904_1267_2235 322
484 3300048905 Ga0496102_0462778 Ga0496102_0462778_56_1051 322
485 3300048909 Ga0496106_0098370 Ga0496106_0098370_1195_2190 322
486 3300048911 Ga0496108_0076993 Ga0496108_0076993_1031_1999 322
487 3300048915 Ga0496112_0033032 Ga0496112_0033032_708_1676 322
488 3300048915 Ga0496112_0217688 Ga0496112_0217688_101_1117 322
489 3300048917 Ga0496114_0096570 Ga0496114_0096570_201_1169 322
490 3300048917 Ga0496114_0401097 Ga0496114_0401097_235_1203 322
491 3300050507 nmdc:mga05p37_134595_c1 nmdc:mga05p37_134595_c1_411_1385 322
492 3300050507 nmdc:mga05p37_166011_c1 nmdc:mga05p37_166011_c1_295_1278 322
493 3300050512 nmdc:mga0n895_16719_c1 nmdc:mga0n895_16719_c1_986_1954 322
494 3300050512 nmdc:mga0n895_3220_c2 nmdc:mga0n895_3220_c2_5566_6534 322
495 3300050512 nmdc:mga0n895_4659_c1 nmdc:mga0n895_4659_c1_7443_8426 322
496 3300050513 nmdc:mga0rr50_114_c1 nmdc:mga0rr50_114_c1_38950_39918 322
497 3300050513 nmdc:mga0rr50_136962_c1 nmdc:mga0rr50_136962_c1_314_1294 322
498 3300050513 nmdc:mga0rr50_504_c1 nmdc:mga0rr50_504_c1_19321_20316 322
499 3300050514 nmdc:mga08x19_233425_c1 nmdc:mga08x19_233425_c1_80_1060 322
500 3300050514 nmdc:mga08x19_35403_c1 nmdc:mga08x19_35403_c1_1886_2854 322
501 3300053077 Ga0495601_0026903 Ga0495601_0026903_1499_2467 322
502 3300053077 Ga0495601_0038671 Ga0495601_0038671_599_1567 322
503 3300053084 Ga0495595_0073027 Ga0495595_0073027_141_1109 322
504 3300053085 Ga0495619_0073958 Ga0495619_0073958_553_1521 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

63

195

0.97

PF00571

CBS

CBS domain

290

342

0.93

PF00571

CBS

CBS domain

223

281

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9852 4 174
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9629 4 174
3k2v-assembly1.cif.gz_B structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. 0.9521 188 316
4o9k-assembly1.cif.gz_B crystal structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from methylococcus capsulatus in complex with cmp-kdo 0.95 193 322
3fna-assembly3.cif.gz_B-2 crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.948 190 316
ID Description Score Start End Superfamily
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9701 193 318 3.10.580.10
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9627 4 191 3.40.50.10490
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9591 193 318 3.10.580.10
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9473 193 318 3.10.580.10
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.943 4 191 3.40.50.10490
ID Description Score Start End GO Terms
AF-K1Z903-F1-model_v4 SIS domain-containing protein 0.9972 5 140 GO:0097367
GO:1901135
AF-A0A656SJ60-F1-model_v4 deleted 0.9859 36 117
AF-A0A259R762-F1-model_v4 deleted 0.9835 5 134
AF-A0A4V2AMI0-F1-model_v4 SIS domain-containing protein 0.9828 14 159 GO:0097367
GO:1901135
AF-A0A7C1G239-F1-model_v4 SIS domain-containing protein 0.9667 1 106 GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
87.38 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map