F456306

General Info

Members Datasets Scaffolds Average Seq Length
505 230 1010 338

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100007128|Ga0070683_1000071282
Length 378
Sequence MRILRILPVQPVNCGFVGTWCIRHSVRWCGLLLTAFCFTGRSKMLNRRRFVPEAICAGALAVFCASGAGQNAVNDLAPVIDVHVHAMDESFPGGGPMCPNAAKFLASDPKTKEAPFGWDQEACTPKLYPAEKGQYLKDVVDEMKRLNVTAVVFGDPKSVQKWKDAAGDRVIRGTSFSEGMTPDARVSLDELRKDFTTGGFKVMGEIGLQYEGLSPSDPSVDRYFALAEQLDVPVAIHMGTGGSGRANLTTPKFRGSMGNPLLLEDLLARHPKLRVQVMHAGYPMIDNMLTLLQANSHVYVDVAGLIWSYPLKEVNRYIQRLVEAGFEDRVMFGTDQMEWPKLMAYSISIIQNADYLTPEEKRDILYNNAVRFLRLDKK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
190 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.79
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 1.58
Rhizosphere 92.28
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100007128 3300005329 Bacteria 9421
2 rootH2_10060713 3300003320 Bacteria 6291
3 rootH1_10058642 3300003323 Bacteria 4109
4 Ga0065707_10126637 3300005295 Bacteria 1998
5 Ga0070658_10081958 3300005327 Bacteria 2651
6 Ga0070676_10032227 3300005328 Bacteria 3001
7 Ga0070683_100005935 3300005329 Bacteria 10222
8 Ga0070683_100021515 3300005329 Bacteria 5756
9 Ga0070683_100026677 3300005329 Bacteria 5205
10 Ga0070683_100071875 3300005329 Bacteria 3229
11 Ga0070683_100388234 3300005329 Bacteria 1331
12 Ga0070670_100005335 3300005331 Bacteria 10837
13 Ga0068869_100010471 3300005334 Bacteria 6048
14 Ga0068869_100013580 3300005334 Bacteria 5420
15 Ga0068869_100161460 3300005334 Bacteria 1745
16 Ga0070666_10074402 3300005335 Unclassified 2315
17 Ga0068868_100047773 3300005338 Bacteria 3356
18 Ga0068868_100048878 3300005338 Bacteria 3319
19 Ga0068868_100088225 3300005338 Bacteria 2496
20 Ga0068868_100146699 3300005338 Bacteria 1941
21 Ga0070687_100100747 3300005343 Bacteria 1617
22 Ga0070661_100010035 3300005344 Bacteria 6574
23 Ga0070661_100028256 3300005344 Bacteria 4045
24 Ga0070661_100083687 3300005344 Bacteria 2357
25 Ga0070661_100298029 3300005344 Unclassified 1254
26 Ga0070668_100240566 3300005347 Bacteria 1499
27 Ga0070675_100116872 3300005354 Bacteria 2263
28 Ga0070671_100014395 3300005355 Bacteria 6391
29 Ga0070671_100109518 3300005355 Bacteria 2320
30 Ga0070674_100013518 3300005356 Bacteria 5049
31 Ga0070674_100047622 3300005356 Bacteria 2939
32 Ga0070673_100096229 3300005364 Unclassified 2429
33 Ga0070688_100157942 3300005365 Bacteria 1556
34 Ga0070688_100298777 3300005365 Bacteria 1163
35 Ga0070659_100027802 3300005366 Bacteria 4360
36 Ga0070659_100317977 3300005366 Bacteria 1301
37 Ga0070667_100004529 3300005367 Bacteria 11706
38 Ga0070667_100077135 3300005367 Unclassified 2845
39 Ga0070667_100078547 3300005367 Bacteria 2820
40 Ga0070667_100113817 3300005367 Bacteria 2348
41 Ga0070709_10000663 3300005434 Bacteria 19594
42 Ga0070709_10132489 3300005434 Unclassified 1703
43 Ga0070709_10141856 3300005434 Unclassified 1652
44 Ga0070714_100019354 3300005435 Bacteria 5544
45 Ga0070713_100000288 3300005436 Bacteria 33342
46 Ga0070713_100000708 3300005436 Bacteria 21394
47 Ga0070713_100458269 3300005436 Bacteria 1198
48 Ga0070701_10039701 3300005438 Bacteria 2389
49 Ga0070711_100000634 3300005439 Bacteria 18335
50 Ga0070711_100002849 3300005439 Bacteria 9946
51 Ga0070711_100127000 3300005439 Bacteria 1894
52 Ga0070678_100080826 3300005456 Bacteria 2462
53 Ga0070678_100100880 3300005456 Bacteria 2237
54 Ga0070662_100139991 3300005457 Bacteria 1874
55 Ga0070681_10000506 3300005458 Bacteria 31860
56 Ga0070681_10152762 3300005458 Bacteria 2234
57 Ga0070698_100009619 3300005471 Bacteria 10341
58 Ga0070684_100007653 3300005535 Bacteria 8422
59 Ga0070684_100009714 3300005535 Bacteria 7592
60 Ga0070684_100015732 3300005535 Bacteria 6172
61 Ga0070684_100080460 3300005535 Unclassified 2882
62 Ga0068853_100000074 3300005539 Bacteria 69174
63 Ga0068853_100041082 3300005539 Bacteria 3949
64 Ga0068853_100090912 3300005539 Bacteria 2683
65 Ga0068853_100103999 3300005539 Bacteria 2514
66 Ga0068853_100447834 3300005539 Bacteria 1214
67 Ga0070672_100091881 3300005543 Bacteria 2449
68 Ga0070672_100324107 3300005543 Unclassified 1310
69 Ga0070686_100031341 3300005544 Bacteria 3250
70 Ga0070693_100199754 3300005547 Bacteria 1298
71 Ga0070665_100208523 3300005548 Bacteria 1955
72 Ga0070665_100222952 3300005548 Bacteria 1886
73 Ga0068855_100001215 3300005563 Bacteria 31959
74 Ga0068855_100005244 3300005563 Bacteria 15811
75 Ga0068855_100023784 3300005563 Bacteria 7339
76 Ga0068855_100043779 3300005563 Bacteria 5300
77 Ga0068855_100073624 3300005563 Bacteria 3968
78 Ga0068855_100128952 3300005563 Bacteria 2890
79 Ga0068855_100252939 3300005563 Bacteria 1965
80 Ga0070664_100130798 3300005564 Bacteria 2204
81 Ga0068857_100001254 3300005577 Bacteria 19874
82 Ga0068857_100009287 3300005577 Bacteria 8533
83 Ga0068857_100036294 3300005577 Bacteria 4368
84 Ga0068857_100130938 3300005577 Unclassified 2262
85 Ga0068854_100023451 3300005578 Bacteria 4216
86 Ga0068854_100063707 3300005578 Bacteria 2677
87 Ga0068854_100178534 3300005578 Bacteria 1657
88 Ga0068854_100307618 3300005578 Bacteria 1284
89 Ga0068856_100001608 3300005614 Bacteria 23621
90 Ga0068856_100003189 3300005614 Bacteria 16692
91 Ga0068856_100003456 3300005614 Bacteria 15972
92 Ga0068856_100004477 3300005614 Bacteria 13900
93 Ga0068856_100016278 3300005614 Bacteria 7195
94 Ga0068856_100162284 3300005614 Bacteria 2245
95 Ga0068856_100346671 3300005614 Bacteria 1504
96 Ga0068852_100000073 3300005616 Bacteria 69820
97 Ga0068852_100011999 3300005616 Bacteria 6555
98 Ga0068852_100053654 3300005616 Bacteria 3471
99 Ga0068852_100164632 3300005616 Bacteria 2074
100 Ga0068859_100005531 3300005617 Bacteria 12867
101 Ga0068859_100069325 3300005617 Bacteria 3561
102 Ga0068864_100005109 3300005618 Bacteria 10753
103 Ga0068864_100158840 3300005618 Bacteria 2054
104 Ga0068851_10011616 3300005834 Bacteria 4133
105 Ga0068851_10030374 3300005834 Bacteria 2680
106 Ga0068851_10048543 3300005834 Bacteria 2151
107 Ga0068863_100020476 3300005841 Bacteria 6321
108 Ga0068863_100089408 3300005841 Bacteria 2920
109 Ga0068863_100191277 3300005841 Bacteria 1966
110 Ga0068858_100035706 3300005842 Bacteria 4609
111 Ga0068860_100014746 3300005843 Bacteria 7642
112 Ga0068860_100022828 3300005843 Bacteria 6051
113 Ga0068860_100024285 3300005843 Bacteria 5861
114 Ga0068860_100220016 3300005843 Bacteria 1844
115 Ga0068860_100515335 3300005843 Bacteria 1195
116 Ga0068862_100088349 3300005844 Bacteria 2697
117 Ga0068862_100125026 3300005844 Bacteria 2270
118 Ga0070717_10046582 3300006028 Bacteria 3549
119 Ga0075368_10023671 3300006042 Bacteria 2348
120 Ga0075364_10060635 3300006051 Bacteria 2480
121 Ga0075364_10127078 3300006051 Bacteria 1710
122 Ga0070715_10006180 3300006163 Bacteria 4055
123 Ga0070716_100006469 3300006173 Bacteria 5724
124 Ga0070716_100016010 3300006173 Bacteria 3865
125 Ga0070716_100069460 3300006173 Bacteria 2065
126 Ga0070712_100000525 3300006175 Bacteria 22111
127 Ga0070712_100010745 3300006175 Bacteria 5785
128 Ga0070712_100061455 3300006175 Bacteria 2654
129 Ga0075362_10013905 3300006177 Bacteria 3234
130 Ga0075362_10053698 3300006177 Bacteria 1809
131 Ga0075367_10015552 3300006178 Bacteria 4141
132 Ga0075366_10026565 3300006195 Bacteria 3392
133 Ga0097621_100000314 3300006237 Bacteria 32871
134 Ga0097621_100002954 3300006237 Bacteria 11675
135 Ga0097621_100004777 3300006237 Bacteria 9480
136 Ga0097621_100180199 3300006237 Bacteria 1825
137 Ga0097621_100230802 3300006237 Bacteria 1616
138 Ga0068871_100003196 3300006358 Bacteria 11243
139 Ga0068871_100007511 3300006358 Bacteria 7794
140 Ga0068871_100007846 3300006358 Bacteria 7649
141 Ga0068871_100113923 3300006358 Bacteria 2278
142 Ga0068871_100190608 3300006358 Bacteria 1766
143 Ga0075428_100088533 3300006844 Bacteria 3377
144 Ga0075428_100298805 3300006844 Bacteria 1731
145 Ga0075429_100144542 3300006880 Bacteria 2082
146 Ga0068865_100019216 3300006881 Unclassified 4421
147 Ga0068865_100132383 3300006881 Bacteria 1870
148 Ga0068865_100287895 3300006881 Unclassified 1310
149 Ga0097620_100005531 3300006931 Bacteria 12867
150 Ga0097620_100069326 3300006931 Bacteria 3561
151 Ga0105240_10003498 3300009093 Bacteria 24350
152 Ga0105240_10003973 3300009093 Bacteria 22823
153 Ga0105240_10011865 3300009093 Bacteria 12096
154 Ga0105240_10022727 3300009093 Bacteria 8308
155 Ga0105240_10028521 3300009093 Bacteria 7290
156 Ga0105240_10036164 3300009093 Bacteria 6355
157 Ga0105240_10057023 3300009093 Bacteria 4884
158 Ga0105240_10235120 3300009093 Bacteria 2127
159 Ga0105240_10299507 3300009093 Bacteria 1840
160 Ga0111539_10002910 3300009094 Bacteria 22714
161 Ga0105245_10003381 3300009098 Bacteria 14291
162 Ga0105245_10109361 3300009098 Bacteria 2568
163 Ga0105245_10277613 3300009098 Bacteria 1636
164 Ga0105243_10166570 3300009148 Bacteria 1905
165 Ga0105241_10000094 3300009174 Bacteria 66981
166 Ga0105241_10000111 3300009174 Bacteria 58391
167 Ga0105241_10002420 3300009174 Bacteria 14007
168 Ga0105241_10006612 3300009174 Bacteria 8543
169 Ga0105241_10013510 3300009174 Bacteria 5982
170 Ga0105241_10343027 3300009174 Bacteria 1295
171 Ga0105242_10012049 3300009176 Bacteria 6654
172 Ga0105242_10136598 3300009176 Bacteria 2123
173 Ga0105248_10000931 3300009177 Bacteria 32596
174 Ga0105248_10018480 3300009177 Bacteria 7705
175 Ga0105248_10035868 3300009177 Bacteria 5548
176 Ga0105248_10053790 3300009177 Bacteria 4516
177 Ga0105248_10411247 3300009177 Unclassified 1523
178 Ga0105248_10518753 3300009177 Bacteria 1344
179 Ga0105237_10003225 3300009545 Bacteria 19544
180 Ga0105237_10027057 3300009545 Bacteria 5858
181 Ga0105237_10030595 3300009545 Bacteria 5467
182 Ga0105237_10043554 3300009545 Bacteria 4521
183 Ga0105237_10163441 3300009545 Bacteria 2225
184 Ga0105237_10181385 3300009545 Bacteria 2105
185 Ga0105237_10199330 3300009545 Bacteria 2001
186 Ga0105237_10250307 3300009545 Bacteria 1774
187 Ga0105238_10000022 3300009551 Bacteria 204310
188 Ga0105238_10000064 3300009551 Bacteria 122380
189 Ga0105238_10009284 3300009551 Bacteria 9845
190 Ga0105238_10027625 3300009551 Bacteria 5783
191 Ga0105238_10040919 3300009551 Bacteria 4695
192 Ga0105238_10126508 3300009551 Bacteria 2534
193 Ga0105238_10193933 3300009551 Bacteria 2007
194 Ga0105238_10378042 3300009551 Bacteria 1407
195 Ga0105249_10145809 3300009553 Bacteria 2274
196 Ga0105249_10458391 3300009553 Bacteria 1314
197 Ga0105239_10004574 3300010375 Bacteria 16490
198 Ga0105239_10004929 3300010375 Bacteria 15757
199 Ga0105239_10015510 3300010375 Bacteria 8438
200 Ga0105239_10099293 3300010375 Bacteria 3218
201 Ga0105239_10364837 3300010375 Bacteria 1632
202 Ga0105246_10007035 3300011119 Bacteria 6885
203 Ga0105246_10091017 3300011119 Bacteria 2198
204 Ga0105246_10101320 3300011119 Bacteria 2097
205 Ga0157373_10054003 3300013100 Bacteria 2856
206 Ga0157373_10114011 3300013100 Bacteria 1900
207 Ga0157371_10014783 3300013102 Bacteria 5876
208 Ga0157369_10000522 3300013105 Bacteria 50647
209 Ga0157369_10001500 3300013105 Bacteria 28635
210 Ga0157369_10003062 3300013105 Bacteria 19966
211 Ga0157369_10003096 3300013105 Bacteria 19865
212 Ga0157369_10006657 3300013105 Bacteria 13354
213 Ga0157369_10014619 3300013105 Bacteria 8855
214 Ga0157369_10042140 3300013105 Bacteria 4981
215 Ga0157369_10052576 3300013105 Bacteria 4407
216 Ga0157369_10112118 3300013105 Bacteria 2898
217 Ga0157369_10337231 3300013105 Unclassified 1566
218 Ga0157369_10513930 3300013105 Bacteria 1239
219 Ga0157374_10000164 3300013296 Bacteria 61685
220 Ga0157374_10000577 3300013296 Bacteria 32518
221 Ga0157374_10019404 3300013296 Bacteria 6017
222 Ga0157374_10168009 3300013296 Bacteria 2139
223 Ga0157374_10368833 3300013296 Bacteria 1429
224 Ga0157378_10000204 3300013297 Bacteria 57882
225 Ga0157378_10011342 3300013297 Bacteria 7799
226 Ga0157378_10024633 3300013297 Bacteria 5298
227 Ga0157378_10040521 3300013297 Bacteria 4130
228 Ga0157378_10048951 3300013297 Bacteria 3760
229 Ga0157378_10054501 3300013297 Bacteria 3560
230 Ga0163162_10017773 3300013306 Bacteria 6957
231 Ga0163162_10026792 3300013306 Bacteria 5700
232 Ga0157372_10001046 3300013307 Bacteria 30268
233 Ga0157372_10005367 3300013307 Bacteria 13621
234 Ga0157372_10011480 3300013307 Bacteria 9420
235 Ga0157372_10011598 3300013307 Bacteria 9380
236 Ga0157372_10012290 3300013307 Bacteria 9121
237 Ga0157372_10015923 3300013307 Bacteria 8063
238 Ga0157372_10051100 3300013307 Bacteria 4599
239 Ga0157372_10111541 3300013307 Bacteria 3133
240 Ga0157372_10150689 3300013307 Bacteria 2684
241 Ga0157372_10196648 3300013307 Bacteria 2335
242 Ga0157372_10214842 3300013307 Bacteria 2229
243 Ga0157375_10013495 3300013308 Bacteria 7275
244 Ga0157375_10180989 3300013308 Bacteria 2259
245 Ga0163163_10029197 3300014325 Bacteria 5303
246 Ga0163163_10067674 3300014325 Bacteria 3552
247 Ga0163163_10129660 3300014325 Bacteria 2562
248 Ga0157380_10172170 3300014326 Bacteria 1893
249 Ga0157377_10054882 3300014745 Bacteria 2257
250 Ga0157379_10013336 3300014968 Bacteria 7195
251 Ga0157379_10020941 3300014968 Bacteria 5787
252 Ga0157379_10056928 3300014968 Bacteria 3493
253 Ga0157379_10101125 3300014968 Bacteria 2587
254 Ga0157379_10241870 3300014968 Bacteria 1637
255 Ga0157376_10003558 3300014969 Bacteria 10744
256 Ga0157376_10004502 3300014969 Bacteria 9710
257 Ga0157376_10007498 3300014969 Bacteria 7794
258 Ga0157376_10009345 3300014969 Bacteria 7122
259 Ga0157376_10073721 3300014969 Bacteria 2908
260 Ga0157376_10078851 3300014969 Bacteria 2822
261 Ga0163161_10092188 3300017792 Bacteria 2243
262 Ga0213876_10006383 3300021384 Bacteria 6428
263 Ga0213876_10021594 3300021384 Bacteria 3405
264 Ga0207656_10078368 3300025321 Unclassified 1481
265 Ga0207710_10005232 3300025900 Bacteria 5607
266 Ga0207680_10059138 3300025903 Unclassified 2326
267 Ga0207699_10017732 3300025906 Bacteria 3756
268 Ga0207699_10064024 3300025906 Bacteria 2223
269 Ga0207699_10133868 3300025906 Unclassified 1621
270 Ga0207645_10008105 3300025907 Bacteria 7363
271 Ga0207645_10117415 3300025907 Bacteria 1726
272 Ga0207705_10066477 3300025909 Bacteria 2608
273 Ga0207705_10150534 3300025909 Bacteria 1744
274 Ga0207654_10000055 3300025911 Bacteria 77517
275 Ga0207654_10001748 3300025911 Bacteria 11283
276 Ga0207654_10023681 3300025911 Bacteria 3292
277 Ga0207707_10001125 3300025912 Bacteria 25351
278 Ga0207695_10000096 3300025913 Bacteria 265048
279 Ga0207695_10000168 3300025913 Bacteria 193087
280 Ga0207695_10007098 3300025913 Bacteria 14346
281 Ga0207695_10013431 3300025913 Bacteria 9768
282 Ga0207695_10013487 3300025913 Bacteria 9744
283 Ga0207695_10016331 3300025913 Bacteria 8689
284 Ga0207695_10030629 3300025913 Bacteria 5920
285 Ga0207695_10144759 3300025913 Bacteria 2322
286 Ga0207695_10149098 3300025913 Unclassified 2279
287 Ga0207671_10000022 3300025914 Bacteria 277803
288 Ga0207671_10005196 3300025914 Bacteria 12100
289 Ga0207671_10125381 3300025914 Bacteria 1966
290 Ga0207671_10155086 3300025914 Bacteria 1771
291 Ga0207671_10208982 3300025914 Bacteria 1526
292 Ga0207693_10000010 3300025915 Bacteria 162031
293 Ga0207693_10000203 3300025915 Bacteria 54373
294 Ga0207693_10002101 3300025915 Bacteria 17385
295 Ga0207693_10053625 3300025915 Unclassified 3164
296 Ga0207663_10016513 3300025916 Bacteria 4096
297 Ga0207663_10029594 3300025916 Bacteria 3219
298 Ga0207660_10023311 3300025917 Bacteria 4179
299 Ga0207649_10010373 3300025920 Bacteria 5116
300 Ga0207652_10028705 3300025921 Bacteria 4645
301 Ga0207646_10401956 3300025922 Bacteria 1237
302 Ga0207694_10000009 3300025924 Bacteria 460687
303 Ga0207694_10009788 3300025924 Bacteria 7235
304 Ga0207694_10009895 3300025924 Bacteria 7194
305 Ga0207694_10039017 3300025924 Bacteria 3653
306 Ga0207694_10042176 3300025924 Bacteria 3519
307 Ga0207694_10051786 3300025924 Bacteria 3181
308 Ga0207694_10090948 3300025924 Bacteria 2408
309 Ga0207650_10111768 3300025925 Bacteria 2116
310 Ga0207659_10220404 3300025926 Bacteria 1525
311 Ga0207687_10008287 3300025927 Bacteria 6798
312 Ga0207687_10122196 3300025927 Bacteria 1949
313 Ga0207700_10001773 3300025928 Bacteria 12237
314 Ga0207700_10003811 3300025928 Bacteria 8810
315 Ga0207644_10142941 3300025931 Bacteria 1844
316 Ga0207706_10001497 3300025933 Bacteria 23206
317 Ga0207706_10257529 3300025933 Bacteria 1523
318 Ga0207669_10003763 3300025937 Bacteria 6590
319 Ga0207704_10015941 3300025938 Bacteria 3846
320 Ga0207704_10023357 3300025938 Bacteria 3331
321 Ga0207704_10369191 3300025938 Unclassified 1123
322 Ga0207665_10010521 3300025939 Bacteria 6078
323 Ga0207665_10020140 3300025939 Bacteria 4381
324 Ga0207665_10081571 3300025939 Unclassified 2227
325 Ga0207665_10157558 3300025939 Unclassified 1631
326 Ga0207691_10002031 3300025940 Bacteria 19804
327 Ga0207691_10010251 3300025940 Bacteria 8990
328 Ga0207711_10020458 3300025941 Bacteria 5518
329 Ga0207711_10028225 3300025941 Unclassified 4721
330 Ga0207689_10000353 3300025942 Bacteria 43010
331 Ga0207689_10001414 3300025942 Bacteria 22916
332 Ga0207689_10079258 3300025942 Bacteria 2699
333 Ga0207661_10017028 3300025944 Bacteria 5369
334 Ga0207661_10049491 3300025944 Bacteria 3345
335 Ga0207661_10088183 3300025944 Bacteria 2578
336 Ga0207661_10110880 3300025944 Bacteria 2320
337 Ga0207661_10168639 3300025944 Unclassified 1904
338 Ga0207679_10081087 3300025945 Bacteria 2480
339 Ga0207679_10249410 3300025945 Bacteria 1508
340 Ga0207667_10000370 3300025949 Bacteria 60796
341 Ga0207667_10012010 3300025949 Bacteria 10023
342 Ga0207667_10124328 3300025949 Bacteria 2658
343 Ga0207651_10097998 3300025960 Bacteria 2167
344 Ga0207651_10180473 3300025960 Bacteria 1674
345 Ga0207668_10293449 3300025972 Bacteria 1339
346 Ga0207640_10291852 3300025981 Bacteria 1286
347 Ga0207658_10074941 3300025986 Bacteria 2572
348 Ga0207677_10004837 3300026023 Bacteria 7270
349 Ga0207677_10427134 3300026023 Unclassified 1130
350 Ga0207703_10018683 3300026035 Bacteria 5415
351 Ga0207703_10029508 3300026035 Bacteria 4329
352 Ga0207703_10075075 3300026035 Bacteria 2801
353 Ga0207703_10097110 3300026035 Bacteria 2489
354 Ga0207639_10000065 3300026041 Bacteria 98610
355 Ga0207639_10024514 3300026041 Bacteria 4366
356 Ga0207639_10171914 3300026041 Bacteria 1836
357 Ga0207678_10043705 3300026067 Bacteria 3876
358 Ga0207708_10003824 3300026075 Bacteria 11093
359 Ga0207702_10001288 3300026078 Bacteria 25108
360 Ga0207702_10001772 3300026078 Bacteria 21238
361 Ga0207702_10008208 3300026078 Bacteria 8826
362 Ga0207702_10008647 3300026078 Bacteria 8588
363 Ga0207702_10015752 3300026078 Bacteria 6259
364 Ga0207702_10086025 3300026078 Bacteria 2741
365 Ga0207641_10012696 3300026088 Bacteria 6906
366 Ga0207641_10015820 3300026088 Bacteria 6178
367 Ga0207641_10316616 3300026088 Bacteria 1478
368 Ga0207648_10368797 3300026089 Bacteria 1296
369 Ga0207676_10027930 3300026095 Bacteria 4209
370 Ga0207676_10299078 3300026095 Bacteria 1469
371 Ga0207674_10002547 3300026116 Bacteria 22963
372 Ga0207674_10004444 3300026116 Bacteria 16855
373 Ga0207674_10006526 3300026116 Bacteria 13713
374 Ga0207674_10027214 3300026116 Bacteria 6053
375 Ga0207675_100110593 3300026118 Bacteria 2592
376 Ga0207683_10000883 3300026121 Bacteria 27539
377 Ga0207683_10006491 3300026121 Bacteria 10011
378 Ga0207698_10000028 3300026142 Bacteria 117250
379 Ga0207698_10075615 3300026142 Bacteria 2693
380 Ga0207428_10003247 3300027907 Bacteria 15845
381 Ga0265354_1000676 3300028016 Bacteria 5655
382 Ga0265354_1001392 3300028016 Unclassified 3486
383 Ga0268266_10041475 3300028379 Bacteria 3928
384 Ga0268266_10182961 3300028379 Bacteria 1909
385 Ga0268265_10064122 3300028380 Bacteria 2829
386 Ga0268265_10121818 3300028380 Bacteria 2150
387 Ga0268264_10014593 3300028381 Bacteria 6454
388 Ga0268264_10062250 3300028381 Bacteria 3133
389 Ga0268264_10096288 3300028381 Bacteria 2563
390 Ga0265338_10005268 3300028800 Bacteria 16944
391 Ga0265324_10002928 3300029957 Bacteria 8369
392 Ga0265770_1004679 3300030878 Bacteria 1871
393 Ga0265765_1000985 3300030879 Bacteria 2509
394 Ga0265760_10002706 3300031090 Bacteria 5180
395 Ga0265760_10003756 3300031090 Unclassified 4401
396 Ga0265332_10015284 3300031238 Bacteria 3387
397 Ga0265332_10074349 3300031238 Unclassified 1445
398 Ga0265320_10001745 3300031240 Bacteria 15415
399 Ga0265325_10003006 3300031241 Bacteria 11192
400 Ga0265329_10016115 3300031242 Bacteria 2597
401 Ga0265340_10011080 3300031247 Bacteria 4805
402 Ga0265339_10101875 3300031249 Bacteria 1493
403 Ga0265331_10004138 3300031250 Bacteria 9094
404 Ga0265331_10016601 3300031250 Bacteria 3862
405 Ga0265316_10003460 3300031344 Bacteria 15960
406 Ga0265316_10074430 3300031344 Bacteria 2614
407 Ga0307408_100038375 3300031548 Bacteria 3379
408 Ga0307408_100072470 3300031548 Bacteria 2550
409 Ga0307408_100170011 3300031548 Bacteria 1740
410 Ga0316579_10033319 3300031691 Bacteria 2365
411 Ga0265314_10004267 3300031711 Bacteria 13378
412 Ga0265314_10067059 3300031711 Bacteria 2419
413 Ga0265342_10019679 3300031712 Bacteria 4346
414 Ga0316578_10002573 3300031728 Bacteria 8023
415 Ga0307405_10008093 3300031731 Bacteria 5308
416 Ga0307405_10052448 3300031731 Bacteria 2536
417 Ga0316577_10003003 3300031733 Bacteria 8449
418 Ga0307413_10015851 3300031824 Bacteria 3874
419 Ga0307410_10039339 3300031852 Bacteria 3104
420 Ga0307406_10069205 3300031901 Bacteria 2307
421 Ga0307407_10021867 3300031903 Bacteria 3307
422 Ga0307407_10137788 3300031903 Bacteria 1570
423 Ga0307412_10047317 3300031911 Bacteria 2825
424 Ga0307409_100104577 3300031995 Bacteria 2358
425 Ga0307416_100280135 3300032002 Bacteria 1643
426 Ga0307416_100371668 3300032002 Bacteria 1456
427 Ga0307414_10029001 3300032004 Bacteria 3597
428 Ga0307411_10018346 3300032005 Bacteria 4011
429 Ga0307415_100030756 3300032126 Bacteria 3450
430 Ga0307415_100036810 3300032126 Bacteria 3210
431 Ga0316212_1001441 3300033547 Unclassified 3235
432 Ga0373947_0009182 3300035725 Bacteria 5684
433 Ga0373947_0163429 3300035725 Bacteria 1441
434 Ga0316582_0002658 3300036647 Bacteria 8463
435 Ga0316584_0001274 3300036712 Bacteria 14901
436 Ga0373925_0005308 3300037068 Bacteria 9621
437 Ga0395905_0008635 3300037471 Bacteria 10036
438 Ga0436364_0145533 3300037853 Bacteria 3629
439 Ga0436364_0330172 3300037853 Bacteria 2075
440 Ga0436364_0598181 3300037853 Unclassified 4193
441 Ga0436364_0612043 3300037853 Bacteria 326330
442 Ga0436364_0653530 3300037853 Unclassified 4394
443 Ga0395901_0015456 3300038443 Bacteria 7772
444 Ga0436365_0145100 3300039437 Bacteria 5434
445 Ga0436365_0283911 3300039437 Bacteria 4941
446 Ga0436365_0433973 3300039437 Bacteria 24440
447 Ga0436365_0802840 3300039437 Bacteria 2492
448 Ga0436365_1082953 3300039437 Bacteria 5696
449 Ga0436360_0786466 3300039438 Bacteria 6067
450 Ga0436360_0840616 3300039438 Unclassified 3568
451 Ga0436361_0046421 3300039447 Bacteria 10962
452 Ga0436361_0575470 3300039447 Bacteria 5197
453 Ga0436361_0747193 3300039447 Bacteria 11556
454 Ga0436361_0913485 3300039447 Bacteria 2132
455 Ga0436363_1132264 3300039450 Bacteria 1940
456 Ga0436363_1528194 3300039450 Unclassified 1310
457 Ga0436362_0005664 3300039453 Bacteria 3300
458 Ga0450920_002031 3300042122 Bacteria 3420
459 Ga0450894_002226 3300042131 Bacteria 2634
460 Ga0450895_000747 3300042132 Bacteria 2030
461 Ga0439464_0051743 3300042439 Bacteria 1189
462 Ga0450918_004526 3300042531 Bacteria 2529
463 Ga0466963_0104346 3300044694 Bacteria 1942
464 Ga0466967_0018091 3300045976 Bacteria 5622
465 Ga0495580_0002828 3300046472 Bacteria 14920
466 Ga0495580_0006378 3300046472 Bacteria 9622
467 Ga0495580_0091648 3300046472 Unclassified 2115
468 Ga0495582_0001020 3300046473 Bacteria 15683
469 Ga0495582_0050471 3300046473 Bacteria 2292
470 Ga0495628_0117643 3300046516 Bacteria 2041
471 Ga0495666_0055732 3300046526 Bacteria 1894
472 Ga0495640_0049105 3300046533 Bacteria 2912
473 Ga0495586_0126403 3300046535 Unclassified 1430
474 Ga0495645_0010184 3300046543 Bacteria 6587
475 Ga0495647_0029259 3300046681 Bacteria 2036
476 Ga0495658_0093270 3300046683 Unclassified 1786
477 Ga0495613_0123185 3300046689 Unclassified 1860
478 Ga0495624_0148424 3300046690 Unclassified 1435
479 Ga0495660_0009089 3300046810 Bacteria 5803
480 Ga0495581_0010538 3300047315 Bacteria 5344
481 Ga0495674_0154296 3300047319 Unclassified 1924
482 Ga0495676_0074497 3300047321 Bacteria 2599
483 Ga0495602_0083690 3300048088 Bacteria 2672
484 Ga0496102_0006774 3300048905 Bacteria 9777
485 Ga0496104_0352807 3300048907 Bacteria 1384
486 Ga0496106_0024042 3300048909 Bacteria 4529
487 Ga0496108_0359907 3300048911 Unclassified 1270
488 Ga0496112_0001123 3300048915 Bacteria 19904
489 Ga0496112_0028700 3300048915 Bacteria 5374
490 Ga0496112_0033214 3300048915 Bacteria 5014
491 Ga0496115_0122547 3300048918 Unclassified 2140
492 Ga0501040_0299279 3300049576 Bacteria 1150
493 Ga0501235_024326 3300049669 Bacteria 1352
494 nmdc:mga00v17_36304_c1 3300050491 Bacteria 2937
495 nmdc:mga0k408_34600_c1 3300050493 Bacteria 2893
496 nmdc:mga06z11_5944_c1 3300050494 Bacteria 4931
497 nmdc:mga04h51_43526_c1 3300050495 Bacteria 1477
498 nmdc:mga09592_52213_c2 3300050508 Bacteria 1938
499 nmdc:mga08y16_8907_c1 3300050511 Bacteria 10537
500 nmdc:mga0sz30_59708_c1 3300050516 Bacteria 1627
501 Ga0495619_0150619 3300053085 Unclassified 1605
502 Ga0500641_0003327 3300053096 Bacteria 5691
503 Ga0500618_001866 3300053125 Bacteria 8802
504 Ga0501082_0322958 3300060353 Bacteria 1345
505 2896184668 2896184354 Bacteria 3258548
506 Ga0070683_100007128
507 rootH2_10060713
508 rootH1_10058642
509 Ga0065707_10126637
510 Ga0070658_10081958
511 Ga0070676_10032227
512 Ga0070683_100005935
513 Ga0070683_100021515
514 Ga0070683_100026677
515 Ga0070683_100071875
516 Ga0070683_100388234
517 Ga0070670_100005335
518 Ga0068869_100010471
519 Ga0068869_100013580
520 Ga0068869_100161460
521 Ga0070666_10074402
522 Ga0068868_100047773
523 Ga0068868_100048878
524 Ga0068868_100088225
525 Ga0068868_100146699
526 Ga0070687_100100747
527 Ga0070661_100010035
528 Ga0070661_100028256
529 Ga0070661_100083687
530 Ga0070661_100298029
531 Ga0070668_100240566
532 Ga0070675_100116872
533 Ga0070671_100014395
534 Ga0070671_100109518
535 Ga0070674_100013518
536 Ga0070674_100047622
537 Ga0070673_100096229
538 Ga0070688_100157942
539 Ga0070688_100298777
540 Ga0070659_100027802
541 Ga0070659_100317977
542 Ga0070667_100004529
543 Ga0070667_100077135
544 Ga0070667_100078547
545 Ga0070667_100113817
546 Ga0070709_10000663
547 Ga0070709_10132489
548 Ga0070709_10141856
549 Ga0070714_100019354
550 Ga0070713_100000288
551 Ga0070713_100000708
552 Ga0070713_100458269
553 Ga0070701_10039701
554 Ga0070711_100000634
555 Ga0070711_100002849
556 Ga0070711_100127000
557 Ga0070678_100080826
558 Ga0070678_100100880
559 Ga0070662_100139991
560 Ga0070681_10000506
561 Ga0070681_10152762
562 Ga0070698_100009619
563 Ga0070684_100007653
564 Ga0070684_100009714
565 Ga0070684_100015732
566 Ga0070684_100080460
567 Ga0068853_100000074
568 Ga0068853_100041082
569 Ga0068853_100090912
570 Ga0068853_100103999
571 Ga0068853_100447834
572 Ga0070672_100091881
573 Ga0070672_100324107
574 Ga0070686_100031341
575 Ga0070693_100199754
576 Ga0070665_100208523
577 Ga0070665_100222952
578 Ga0068855_100001215
579 Ga0068855_100005244
580 Ga0068855_100023784
581 Ga0068855_100043779
582 Ga0068855_100073624
583 Ga0068855_100128952
584 Ga0068855_100252939
585 Ga0070664_100130798
586 Ga0068857_100001254
587 Ga0068857_100009287
588 Ga0068857_100036294
589 Ga0068857_100130938
590 Ga0068854_100023451
591 Ga0068854_100063707
592 Ga0068854_100178534
593 Ga0068854_100307618
594 Ga0068856_100001608
595 Ga0068856_100003189
596 Ga0068856_100003456
597 Ga0068856_100004477
598 Ga0068856_100016278
599 Ga0068856_100162284
600 Ga0068856_100346671
601 Ga0068852_100000073
602 Ga0068852_100011999
603 Ga0068852_100053654
604 Ga0068852_100164632
605 Ga0068859_100005531
606 Ga0068859_100069325
607 Ga0068864_100005109
608 Ga0068864_100158840
609 Ga0068851_10011616
610 Ga0068851_10030374
611 Ga0068851_10048543
612 Ga0068863_100020476
613 Ga0068863_100089408
614 Ga0068863_100191277
615 Ga0068858_100035706
616 Ga0068860_100014746
617 Ga0068860_100022828
618 Ga0068860_100024285
619 Ga0068860_100220016
620 Ga0068860_100515335
621 Ga0068862_100088349
622 Ga0068862_100125026
623 Ga0070717_10046582
624 Ga0075368_10023671
625 Ga0075364_10060635
626 Ga0075364_10127078
627 Ga0070715_10006180
628 Ga0070716_100006469
629 Ga0070716_100016010
630 Ga0070716_100069460
631 Ga0070712_100000525
632 Ga0070712_100010745
633 Ga0070712_100061455
634 Ga0075362_10013905
635 Ga0075362_10053698
636 Ga0075367_10015552
637 Ga0075366_10026565
638 Ga0097621_100000314
639 Ga0097621_100002954
640 Ga0097621_100004777
641 Ga0097621_100180199
642 Ga0097621_100230802
643 Ga0068871_100003196
644 Ga0068871_100007511
645 Ga0068871_100007846
646 Ga0068871_100113923
647 Ga0068871_100190608
648 Ga0075428_100088533
649 Ga0075428_100298805
650 Ga0075429_100144542
651 Ga0068865_100019216
652 Ga0068865_100132383
653 Ga0068865_100287895
654 Ga0097620_100005531
655 Ga0097620_100069326
656 Ga0105240_10003498
657 Ga0105240_10003973
658 Ga0105240_10011865
659 Ga0105240_10022727
660 Ga0105240_10028521
661 Ga0105240_10036164
662 Ga0105240_10057023
663 Ga0105240_10235120
664 Ga0105240_10299507
665 Ga0111539_10002910
666 Ga0105245_10003381
667 Ga0105245_10109361
668 Ga0105245_10277613
669 Ga0105243_10166570
670 Ga0105241_10000094
671 Ga0105241_10000111
672 Ga0105241_10002420
673 Ga0105241_10006612
674 Ga0105241_10013510
675 Ga0105241_10343027
676 Ga0105242_10012049
677 Ga0105242_10136598
678 Ga0105248_10000931
679 Ga0105248_10018480
680 Ga0105248_10035868
681 Ga0105248_10053790
682 Ga0105248_10411247
683 Ga0105248_10518753
684 Ga0105237_10003225
685 Ga0105237_10027057
686 Ga0105237_10030595
687 Ga0105237_10043554
688 Ga0105237_10163441
689 Ga0105237_10181385
690 Ga0105237_10199330
691 Ga0105237_10250307
692 Ga0105238_10000022
693 Ga0105238_10000064
694 Ga0105238_10009284
695 Ga0105238_10027625
696 Ga0105238_10040919
697 Ga0105238_10126508
698 Ga0105238_10193933
699 Ga0105238_10378042
700 Ga0105249_10145809
701 Ga0105249_10458391
702 Ga0105239_10004574
703 Ga0105239_10004929
704 Ga0105239_10015510
705 Ga0105239_10099293
706 Ga0105239_10364837
707 Ga0105246_10007035
708 Ga0105246_10091017
709 Ga0105246_10101320
710 Ga0157373_10054003
711 Ga0157373_10114011
712 Ga0157371_10014783
713 Ga0157369_10000522
714 Ga0157369_10001500
715 Ga0157369_10003062
716 Ga0157369_10003096
717 Ga0157369_10006657
718 Ga0157369_10014619
719 Ga0157369_10042140
720 Ga0157369_10052576
721 Ga0157369_10112118
722 Ga0157369_10337231
723 Ga0157369_10513930
724 Ga0157374_10000164
725 Ga0157374_10000577
726 Ga0157374_10019404
727 Ga0157374_10168009
728 Ga0157374_10368833
729 Ga0157378_10000204
730 Ga0157378_10011342
731 Ga0157378_10024633
732 Ga0157378_10040521
733 Ga0157378_10048951
734 Ga0157378_10054501
735 Ga0163162_10017773
736 Ga0163162_10026792
737 Ga0157372_10001046
738 Ga0157372_10005367
739 Ga0157372_10011480
740 Ga0157372_10011598
741 Ga0157372_10012290
742 Ga0157372_10015923
743 Ga0157372_10051100
744 Ga0157372_10111541
745 Ga0157372_10150689
746 Ga0157372_10196648
747 Ga0157372_10214842
748 Ga0157375_10013495
749 Ga0157375_10180989
750 Ga0163163_10029197
751 Ga0163163_10067674
752 Ga0163163_10129660
753 Ga0157380_10172170
754 Ga0157377_10054882
755 Ga0157379_10013336
756 Ga0157379_10020941
757 Ga0157379_10056928
758 Ga0157379_10101125
759 Ga0157379_10241870
760 Ga0157376_10003558
761 Ga0157376_10004502
762 Ga0157376_10007498
763 Ga0157376_10009345
764 Ga0157376_10073721
765 Ga0157376_10078851
766 Ga0163161_10092188
767 Ga0213876_10006383
768 Ga0213876_10021594
769 Ga0207656_10078368
770 Ga0207710_10005232
771 Ga0207680_10059138
772 Ga0207699_10017732
773 Ga0207699_10064024
774 Ga0207699_10133868
775 Ga0207645_10008105
776 Ga0207645_10117415
777 Ga0207705_10066477
778 Ga0207705_10150534
779 Ga0207654_10000055
780 Ga0207654_10001748
781 Ga0207654_10023681
782 Ga0207707_10001125
783 Ga0207695_10000096
784 Ga0207695_10000168
785 Ga0207695_10007098
786 Ga0207695_10013431
787 Ga0207695_10013487
788 Ga0207695_10016331
789 Ga0207695_10030629
790 Ga0207695_10144759
791 Ga0207695_10149098
792 Ga0207671_10000022
793 Ga0207671_10005196
794 Ga0207671_10125381
795 Ga0207671_10155086
796 Ga0207671_10208982
797 Ga0207693_10000010
798 Ga0207693_10000203
799 Ga0207693_10002101
800 Ga0207693_10053625
801 Ga0207663_10016513
802 Ga0207663_10029594
803 Ga0207660_10023311
804 Ga0207649_10010373
805 Ga0207652_10028705
806 Ga0207646_10401956
807 Ga0207694_10000009
808 Ga0207694_10009788
809 Ga0207694_10009895
810 Ga0207694_10039017
811 Ga0207694_10042176
812 Ga0207694_10051786
813 Ga0207694_10090948
814 Ga0207650_10111768
815 Ga0207659_10220404
816 Ga0207687_10008287
817 Ga0207687_10122196
818 Ga0207700_10001773
819 Ga0207700_10003811
820 Ga0207644_10142941
821 Ga0207706_10001497
822 Ga0207706_10257529
823 Ga0207669_10003763
824 Ga0207704_10015941
825 Ga0207704_10023357
826 Ga0207704_10369191
827 Ga0207665_10010521
828 Ga0207665_10020140
829 Ga0207665_10081571
830 Ga0207665_10157558
831 Ga0207691_10002031
832 Ga0207691_10010251
833 Ga0207711_10020458
834 Ga0207711_10028225
835 Ga0207689_10000353
836 Ga0207689_10001414
837 Ga0207689_10079258
838 Ga0207661_10017028
839 Ga0207661_10049491
840 Ga0207661_10088183
841 Ga0207661_10110880
842 Ga0207661_10168639
843 Ga0207679_10081087
844 Ga0207679_10249410
845 Ga0207667_10000370
846 Ga0207667_10012010
847 Ga0207667_10124328
848 Ga0207651_10097998
849 Ga0207651_10180473
850 Ga0207668_10293449
851 Ga0207640_10291852
852 Ga0207658_10074941
853 Ga0207677_10004837
854 Ga0207677_10427134
855 Ga0207703_10018683
856 Ga0207703_10029508
857 Ga0207703_10075075
858 Ga0207703_10097110
859 Ga0207639_10000065
860 Ga0207639_10024514
861 Ga0207639_10171914
862 Ga0207678_10043705
863 Ga0207708_10003824
864 Ga0207702_10001288
865 Ga0207702_10001772
866 Ga0207702_10008208
867 Ga0207702_10008647
868 Ga0207702_10015752
869 Ga0207702_10086025
870 Ga0207641_10012696
871 Ga0207641_10015820
872 Ga0207641_10316616
873 Ga0207648_10368797
874 Ga0207676_10027930
875 Ga0207676_10299078
876 Ga0207674_10002547
877 Ga0207674_10004444
878 Ga0207674_10006526
879 Ga0207674_10027214
880 Ga0207675_100110593
881 Ga0207683_10000883
882 Ga0207683_10006491
883 Ga0207698_10000028
884 Ga0207698_10075615
885 Ga0207428_10003247
886 Ga0265354_1000676
887 Ga0265354_1001392
888 Ga0268266_10041475
889 Ga0268266_10182961
890 Ga0268265_10064122
891 Ga0268265_10121818
892 Ga0268264_10014593
893 Ga0268264_10062250
894 Ga0268264_10096288
895 Ga0265338_10005268
896 Ga0265324_10002928
897 Ga0265770_1004679
898 Ga0265765_1000985
899 Ga0265760_10002706
900 Ga0265760_10003756
901 Ga0265332_10015284
902 Ga0265332_10074349
903 Ga0265320_10001745
904 Ga0265325_10003006
905 Ga0265329_10016115
906 Ga0265340_10011080
907 Ga0265339_10101875
908 Ga0265331_10004138
909 Ga0265331_10016601
910 Ga0265316_10003460
911 Ga0265316_10074430
912 Ga0307408_100038375
913 Ga0307408_100072470
914 Ga0307408_100170011
915 Ga0316579_10033319
916 Ga0265314_10004267
917 Ga0265314_10067059
918 Ga0265342_10019679
919 Ga0316578_10002573
920 Ga0307405_10008093
921 Ga0307405_10052448
922 Ga0316577_10003003
923 Ga0307413_10015851
924 Ga0307410_10039339
925 Ga0307406_10069205
926 Ga0307407_10021867
927 Ga0307407_10137788
928 Ga0307412_10047317
929 Ga0307409_100104577
930 Ga0307416_100280135
931 Ga0307416_100371668
932 Ga0307414_10029001
933 Ga0307411_10018346
934 Ga0307415_100030756
935 Ga0307415_100036810
936 Ga0316212_1001441
937 Ga0373947_0009182
938 Ga0373947_0163429
939 Ga0316582_0002658
940 Ga0316584_0001274
941 Ga0373925_0005308
942 Ga0395905_0008635
943 Ga0436364_0145533
944 Ga0436364_0330172
945 Ga0436364_0598181
946 Ga0436364_0612043
947 Ga0436364_0653530
948 Ga0395901_0015456
949 Ga0436365_0145100
950 Ga0436365_0283911
951 Ga0436365_0433973
952 Ga0436365_0802840
953 Ga0436365_1082953
954 Ga0436360_0786466
955 Ga0436360_0840616
956 Ga0436361_0046421
957 Ga0436361_0575470
958 Ga0436361_0747193
959 Ga0436361_0913485
960 Ga0436363_1132264
961 Ga0436363_1528194
962 Ga0436362_0005664
963 Ga0450920_002031
964 Ga0450894_002226
965 Ga0450895_000747
966 Ga0439464_0051743
967 Ga0450918_004526
968 Ga0466963_0104346
969 Ga0466967_0018091
970 Ga0495580_0002828
971 Ga0495580_0006378
972 Ga0495580_0091648
973 Ga0495582_0001020
974 Ga0495582_0050471
975 Ga0495628_0117643
976 Ga0495666_0055732
977 Ga0495640_0049105
978 Ga0495586_0126403
979 Ga0495645_0010184
980 Ga0495647_0029259
981 Ga0495658_0093270
982 Ga0495613_0123185
983 Ga0495624_0148424
984 Ga0495660_0009089
985 Ga0495581_0010538
986 Ga0495674_0154296
987 Ga0495676_0074497
988 Ga0495602_0083690
989 Ga0496102_0006774
990 Ga0496104_0352807
991 Ga0496106_0024042
992 Ga0496108_0359907
993 Ga0496112_0001123
994 Ga0496112_0028700
995 Ga0496112_0033214
996 Ga0496115_0122547
997 Ga0501040_0299279
998 Ga0501235_024326
999 nmdc:mga00v17_36304_c1
1000 nmdc:mga0k408_34600_c1
1001 nmdc:mga06z11_5944_c1
1002 nmdc:mga04h51_43526_c1
1003 nmdc:mga09592_52213_c2
1004 nmdc:mga08y16_8907_c1
1005 nmdc:mga0sz30_59708_c1
1006 Ga0495619_0150619
1007 Ga0500641_0003327
1008 Ga0500618_001866
1009 Ga0501082_0322958
1010 2896184668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

80

375

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7242 22 318
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7101 22 318
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.6868 23 319
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.68 23 319
3ij6-assembly2.cif.gz_D crystal structure of an uncharacterized metal-dependent hydrolase from lactobacillus acidophilus 0.6738 81 317
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.819 81 321 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7893 81 319 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7116 81 321 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7043 81 319 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.704 81 319 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A4R1DCK2-F1-model_v4 deleted 0.9879 195 320
AF-A0A7W1PCF0-F1-model_v4 Amidohydrolase family protein 0.9848 220 320 GO:0016787
AF-A0A520HF42-F1-model_v4 Amidohydrolase 0.9804 197 320 GO:0016787
AF-A0A1F5B0K9-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9733 132 321 GO:0016787
GO:0016831
AF-A0A4Q3VP37-F1-model_v4 Amidohydrolase 0.9696 131 320 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map