F456326

General Info

Members Datasets Scaffolds Average Seq Length
505 269 501 331

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100012083|Ga0068853_1000120834
Length 342
Sequence MKIAGRFPDTRMRRMRRDEFSRRLMRENRLTTDDLIYPCFVLDGKARAEPVESLPGIARKSIDLLLEEAHQCVLLGIPAIALFPVVPMPGKSDDAAEAWNPDGLVPRTIRALKEHFPDLGVITDVALDPYTSHGQDGLIDAADPTRYVLNEETIEALVKQALCHAEAGVDMVAPSDMMDGRIGAIRRALDRAGHQRVRILAYSAKYASNFYGPFRDAVGSAASLGGGVTSGNKYTYQMDPANGDEALREVHLDLDEGADMIMIKPGLPYLDIVRRVKETFGAPTAVYQVSGEYAMLKAATQNGWLDERAAVLEVLTSFKRAGADAILTYFAIAAARWLREDY

Samples

Sample ID Description Type Environment
1 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
2 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
3 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
172 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
194 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
195 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
196 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
197 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
269 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.2
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0
Rhizoplane 2.77
Rhizosphere 91.49
Stem 0
Stem Tuber 0
Unclassified 2.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000492 3300003215 Bacteria 25243
2 JGI25153J46596_10000624 3300003215 Bacteria 21680
3 Ga0070683_100003773 3300005329 Bacteria 12372
4 Ga0070683_100017074 3300005329 Bacteria 6406
5 Ga0070683_100044710 3300005329 Bacteria 4085
6 Ga0070690_100001976 3300005330 Bacteria 10925
7 Ga0070690_100018410 3300005330 Bacteria 4219
8 Ga0070670_100038842 3300005331 Bacteria 4093
9 Ga0070670_100120300 3300005331 Bacteria 2265
10 Ga0070670_100200663 3300005331 Bacteria 1733
11 Ga0070677_10075671 3300005333 Bacteria 1427
12 Ga0068869_100047408 3300005334 Bacteria 3103
13 Ga0070666_10000953 3300005335 Bacteria 17631
14 Ga0070666_10014158 3300005335 Bacteria 5075
15 Ga0070666_10030032 3300005335 Bacteria 3578
16 Ga0070680_100124162 3300005336 Bacteria 2156
17 Ga0068868_100068190 3300005338 Bacteria 2832
18 Ga0068868_100080515 3300005338 Bacteria 2610
19 Ga0068868_100127477 3300005338 Bacteria 2080
20 Ga0070660_100060694 3300005339 Bacteria 2935
21 Ga0070689_100002818 3300005340 Bacteria 11428
22 Ga0070689_100003205 3300005340 Bacteria 10840
23 Ga0070661_100002100 3300005344 Bacteria 13716
24 Ga0070661_100026097 3300005344 Bacteria 4199
25 Ga0070661_100292175 3300005344 Bacteria 1267
26 Ga0070668_100010367 3300005347 Bacteria 6921
27 Ga0070675_100205020 3300005354 Bacteria 1712
28 Ga0070671_100035349 3300005355 Bacteria 4139
29 Ga0070673_100002777 3300005364 Bacteria 10764
30 Ga0070673_100045036 3300005364 Bacteria 3419
31 Ga0070688_100000391 3300005365 Bacteria 22192
32 Ga0070688_100002581 3300005365 Bacteria 9178
33 Ga0070667_100092127 3300005367 Bacteria 2607
34 Ga0070703_10066576 3300005406 Bacteria 1192
35 Ga0070709_10007739 3300005434 Bacteria 5899
36 Ga0070714_100011657 3300005435 Bacteria 6979
37 Ga0070714_100020029 3300005435 Bacteria 5458
38 Ga0070714_100046041 3300005435 Bacteria 3699
39 Ga0070713_100268553 3300005436 Bacteria 1561
40 Ga0070710_10004401 3300005437 Bacteria 6667
41 Ga0070710_10049352 3300005437 Bacteria 2354
42 Ga0070710_10166380 3300005437 Bacteria 1371
43 Ga0070711_100200533 3300005439 Bacteria 1539
44 Ga0070694_100014953 3300005444 Bacteria 4862
45 Ga0070663_100017914 3300005455 Bacteria 4631
46 Ga0070663_100033468 3300005455 Bacteria 3551
47 Ga0070678_100002681 3300005456 Bacteria 9811
48 Ga0070678_100171473 3300005456 Bacteria 1768
49 Ga0070662_100017183 3300005457 Bacteria 4870
50 Ga0070662_100022041 3300005457 Bacteria 4356
51 Ga0070662_100047556 3300005457 Bacteria 3086
52 Ga0070681_10044844 3300005458 Bacteria 4427
53 Ga0070681_10100219 3300005458 Bacteria 2843
54 Ga0068867_100013472 3300005459 Bacteria 5793
55 Ga0070685_10015530 3300005466 Bacteria 4045
56 Ga0070706_100147529 3300005467 Bacteria 2196
57 Ga0070707_100024507 3300005468 Bacteria 5715
58 Ga0070707_100059284 3300005468 Bacteria 3672
59 Ga0070698_100110784 3300005471 Bacteria 2710
60 Ga0070699_100020992 3300005518 Bacteria 5630
61 Ga0070679_100087660 3300005530 Bacteria 3099
62 Ga0070679_100223892 3300005530 Bacteria 1841
63 Ga0070679_100300459 3300005530 Bacteria 1556
64 Ga0070679_100428221 3300005530 Bacteria 1268
65 Ga0070684_100002389 3300005535 Bacteria 13833
66 Ga0070684_100025550 3300005535 Bacteria 4966
67 Ga0070684_100042329 3300005535 Bacteria 3931
68 Ga0070684_100204338 3300005535 Bacteria 1800
69 Ga0070697_100007297 3300005536 Bacteria 8598
70 Ga0070697_100010158 3300005536 Bacteria 7345
71 Ga0068853_100012083 3300005539 Bacteria 7025
72 Ga0068853_100045310 3300005539 Bacteria 3766
73 Ga0068853_100050816 3300005539 Bacteria 3566
74 Ga0068853_100140296 3300005539 Bacteria 2169
75 Ga0068853_100257092 3300005539 Bacteria 1604
76 Ga0070672_100053344 3300005543 Bacteria 3161
77 Ga0070672_100115806 3300005543 Bacteria 2189
78 Ga0070693_100012260 3300005547 Bacteria 4335
79 Ga0070665_100000500 3300005548 Bacteria 56157
80 Ga0070665_100003582 3300005548 Bacteria 16453
81 Ga0070665_100152867 3300005548 Bacteria 2310
82 Ga0070704_100021784 3300005549 Bacteria 4160
83 Ga0068855_100022596 3300005563 Bacteria 7537
84 Ga0068855_100063378 3300005563 Bacteria 4314
85 Ga0068855_100093898 3300005563 Bacteria 3460
86 Ga0070664_100002891 3300005564 Bacteria 13902
87 Ga0070664_100040926 3300005564 Bacteria 3909
88 Ga0070664_100100771 3300005564 Bacteria 2511
89 Ga0068857_100056366 3300005577 Bacteria 3487
90 Ga0068854_100001870 3300005578 Bacteria 12831
91 Ga0068854_100002838 3300005578 Bacteria 10760
92 Ga0068854_100004550 3300005578 Bacteria 8749
93 Ga0068854_100027454 3300005578 Bacteria 3924
94 Ga0068856_100006058 3300005614 Bacteria 11883
95 Ga0068856_100125603 3300005614 Bacteria 2569
96 Ga0068856_100226145 3300005614 Bacteria 1886
97 Ga0070702_100148354 3300005615 Bacteria 1502
98 Ga0068852_100014257 3300005616 Bacteria 6110
99 Ga0068852_100185005 3300005616 Bacteria 1961
100 Ga0068852_100186355 3300005616 Bacteria 1955
101 Ga0068859_100003236 3300005617 Bacteria 16579
102 Ga0068859_100021624 3300005617 Bacteria 6455
103 Ga0068864_100001480 3300005618 Bacteria 19352
104 Ga0068864_100027559 3300005618 Bacteria 4799
105 Ga0068864_100400311 3300005618 Bacteria 1304
106 Ga0068866_10001308 3300005718 Bacteria 10792
107 Ga0068866_10021490 3300005718 Bacteria 2973
108 Ga0068851_10002512 3300005834 Bacteria 8064
109 Ga0068851_10002553 3300005834 Bacteria 8012
110 Ga0068863_100002303 3300005841 Bacteria 18979
111 Ga0068863_100003508 3300005841 Bacteria 15478
112 Ga0068863_100118109 3300005841 Bacteria 2527
113 Ga0068863_100225043 3300005841 Bacteria 1808
114 Ga0068858_100004483 3300005842 Bacteria 13689
115 Ga0068858_100009965 3300005842 Bacteria 9024
116 Ga0068858_100120062 3300005842 Bacteria 2458
117 Ga0068860_100017042 3300005843 Bacteria 7081
118 Ga0068860_100083826 3300005843 Bacteria 3032
119 Ga0068860_100128871 3300005843 Bacteria 2426
120 Ga0068862_100003861 3300005844 Bacteria 12759
121 Ga0068862_100048679 3300005844 Bacteria 3619
122 Ga0068862_100060726 3300005844 Bacteria 3248
123 Ga0068862_100075280 3300005844 Bacteria 2920
124 Ga0068862_100151654 3300005844 Bacteria 2063
125 Ga0070717_10154501 3300006028 Bacteria 1987
126 Ga0070712_100010690 3300006175 Bacteria 5797
127 Ga0097621_100136104 3300006237 Bacteria 2096
128 Ga0097621_100147204 3300006237 Bacteria 2017
129 Ga0097621_100402628 3300006237 Bacteria 1225
130 Ga0068871_100005265 3300006358 Bacteria 9057
131 Ga0068871_100074127 3300006358 Bacteria 2807
132 Ga0068871_100137736 3300006358 Bacteria 2074
133 Ga0068871_100144916 3300006358 Bacteria 2021
134 Ga0068871_100177312 3300006358 Bacteria 1830
135 Ga0075428_100066124 3300006844 Bacteria 3959
136 Ga0075434_100079228 3300006871 Bacteria 3281
137 Ga0075434_100398151 3300006871 Bacteria 1398
138 Ga0068865_100022190 3300006881 Bacteria 4137
139 Ga0068865_100028384 3300006881 Bacteria 3704
140 Ga0068865_100045419 3300006881 Bacteria 3011
141 Ga0075436_100259558 3300006914 Bacteria 1239
142 Ga0097620_100003236 3300006931 Bacteria 16579
143 Ga0097620_100021624 3300006931 Bacteria 6455
144 Ga0075435_100004989 3300007076 Bacteria 9212
145 Ga0105240_10000196 3300009093 Bacteria 123276
146 Ga0105240_10013319 3300009093 Bacteria 11304
147 Ga0105240_10019737 3300009093 Bacteria 9004
148 Ga0105240_10029644 3300009093 Bacteria 7124
149 Ga0105240_10049857 3300009093 Bacteria 5281
150 Ga0105240_10058730 3300009093 Bacteria 4801
151 Ga0105240_10081793 3300009093 Bacteria 3967
152 Ga0105240_10083233 3300009093 Bacteria 3927
153 Ga0105245_10117407 3300009098 Bacteria 2482
154 Ga0105245_10134877 3300009098 Bacteria 2319
155 Ga0105247_10043783 3300009101 Bacteria 2743
156 Ga0105241_10039536 3300009174 Bacteria 3558
157 Ga0105241_10208900 3300009174 Bacteria 1635
158 Ga0105242_10057368 3300009176 Bacteria 3189
159 Ga0105248_10015684 3300009177 Bacteria 8350
160 Ga0105248_10227902 3300009177 Bacteria 2097
161 Ga0105248_10259426 3300009177 Bacteria 1956
162 Ga0105248_10384697 3300009177 Bacteria 1580
163 Ga0105237_10009184 3300009545 Bacteria 10614
164 Ga0105237_10057965 3300009545 Bacteria 3876
165 Ga0105238_10018871 3300009551 Bacteria 7021
166 Ga0105238_10021424 3300009551 Bacteria 6583
167 Ga0105238_10091162 3300009551 Bacteria 3035
168 Ga0105238_10095202 3300009551 Bacteria 2965
169 Ga0105239_10001780 3300010375 Bacteria 28338
170 Ga0105239_10005029 3300010375 Bacteria 15613
171 Ga0105239_10007054 3300010375 Bacteria 12931
172 Ga0105239_10038663 3300010375 Bacteria 5229
173 Ga0105239_10105015 3300010375 Bacteria 3128
174 Ga0105239_10189928 3300010375 Bacteria 2299
175 Ga0105246_10104806 3300011119 Bacteria 2066
176 Ga0157373_10017035 3300013100 Bacteria 5291
177 Ga0157373_10122571 3300013100 Bacteria 1827
178 Ga0157373_10133627 3300013100 Bacteria 1744
179 Ga0157371_10010442 3300013102 Bacteria 7235
180 Ga0157370_10044444 3300013104 Bacteria 4270
181 Ga0157370_10062340 3300013104 Bacteria 3536
182 Ga0157370_10100152 3300013104 Bacteria 2715
183 Ga0157370_10179688 3300013104 Bacteria 1966
184 Ga0157370_10188472 3300013104 Bacteria 1915
185 Ga0157369_10013085 3300013105 Bacteria 9392
186 Ga0157369_10021113 3300013105 Bacteria 7279
187 Ga0157374_10000127 3300013296 Bacteria 69890
188 Ga0157374_10000922 3300013296 Bacteria 25588
189 Ga0157374_10029101 3300013296 Bacteria 4997
190 Ga0157378_10009053 3300013297 Bacteria 8665
191 Ga0157378_10030194 3300013297 Bacteria 4789
192 Ga0157378_10092120 3300013297 Bacteria 2757
193 Ga0157378_10104490 3300013297 Bacteria 2589
194 Ga0163162_10000061 3300013306 Bacteria 106351
195 Ga0163162_10025348 3300013306 Bacteria 5859
196 Ga0163162_10056092 3300013306 Bacteria 3968
197 Ga0163162_10069928 3300013306 Bacteria 3562
198 Ga0157372_10000822 3300013307 Bacteria 33604
199 Ga0157372_10025500 3300013307 Bacteria 6430
200 Ga0157372_10061152 3300013307 Bacteria 4216
201 Ga0163163_10000166 3300014325 Bacteria 69030
202 Ga0163163_10008748 3300014325 Bacteria 9007
203 Ga0157377_10022831 3300014745 Bacteria 3309
204 Ga0157379_10004862 3300014968 Bacteria 11538
205 Ga0157379_10016112 3300014968 Bacteria 6574
206 Ga0157376_10080383 3300014969 Bacteria 2796
207 Ga0157376_10218381 3300014969 Bacteria 1764
208 Ga0213872_10061799 3300021361 Bacteria 1693
209 Ga0209233_1000930 3300025261 Bacteria 12751
210 Ga0209758_1000169 3300025297 Bacteria 149782
211 Ga0209051_1018392 3300025303 Bacteria 3093
212 Ga0209257_1002268 3300025304 Bacteria 19622
213 Ga0207656_10000819 3300025321 Bacteria 10142
214 Ga0207656_10055598 3300025321 Bacteria 1723
215 Ga0207713_1030216 3300025735 Bacteria 2415
216 Ga0207692_10038162 3300025898 Bacteria 2355
217 Ga0207692_10070559 3300025898 Bacteria 1839
218 Ga0207692_10113070 3300025898 Bacteria 1508
219 Ga0207642_10010089 3300025899 Bacteria 3313
220 Ga0207680_10005524 3300025903 Bacteria 6041
221 Ga0207647_10000277 3300025904 Bacteria 41661
222 Ga0207647_10001196 3300025904 Bacteria 19992
223 Ga0207699_10005933 3300025906 Bacteria 5876
224 Ga0207699_10029168 3300025906 Bacteria 3074
225 Ga0207699_10177840 3300025906 Bacteria 1428
226 Ga0207699_10238786 3300025906 Bacteria 1248
227 Ga0207645_10088484 3300025907 Bacteria 1991
228 Ga0207643_10011302 3300025908 Bacteria 4821
229 Ga0207705_10174346 3300025909 Bacteria 1620
230 Ga0207684_10029143 3300025910 Bacteria 4702
231 Ga0207654_10066653 3300025911 Bacteria 2124
232 Ga0207654_10070124 3300025911 Bacteria 2080
233 Ga0207707_10002828 3300025912 Bacteria 15472
234 Ga0207707_10023500 3300025912 Bacteria 5392
235 Ga0207707_10231711 3300025912 Bacteria 1607
236 Ga0207695_10000040 3300025913 Bacteria 452787
237 Ga0207695_10000271 3300025913 Bacteria 129900
238 Ga0207695_10000554 3300025913 Bacteria 76895
239 Ga0207695_10013099 3300025913 Bacteria 9900
240 Ga0207695_10023565 3300025913 Bacteria 6949
241 Ga0207671_10007196 3300025914 Bacteria 9697
242 Ga0207671_10019252 3300025914 Bacteria 5223
243 Ga0207671_10025050 3300025914 Bacteria 4483
244 Ga0207671_10088409 3300025914 Bacteria 2331
245 Ga0207671_10226768 3300025914 Bacteria 1465
246 Ga0207671_10272923 3300025914 Bacteria 1332
247 Ga0207693_10055062 3300025915 Bacteria 3121
248 Ga0207693_10125258 3300025915 Bacteria 2019
249 Ga0207663_10017301 3300025916 Bacteria 4013
250 Ga0207663_10049863 3300025916 Bacteria 2599
251 Ga0207663_10161653 3300025916 Bacteria 1581
252 Ga0207657_10000258 3300025919 Bacteria 56256
253 Ga0207657_10002002 3300025919 Bacteria 22017
254 Ga0207657_10013571 3300025919 Bacteria 7992
255 Ga0207649_10010017 3300025920 Bacteria 5198
256 Ga0207649_10110393 3300025920 Bacteria 1836
257 Ga0207649_10141242 3300025920 Bacteria 1648
258 Ga0207652_10033685 3300025921 Bacteria 4314
259 Ga0207646_10005024 3300025922 Bacteria 14083
260 Ga0207646_10254288 3300025922 Bacteria 1587
261 Ga0207681_10057436 3300025923 Bacteria 2660
262 Ga0207694_10001531 3300025924 Bacteria 19673
263 Ga0207650_10039382 3300025925 Bacteria 3455
264 Ga0207659_10287396 3300025926 Bacteria 1346
265 Ga0207687_10005040 3300025927 Bacteria 8744
266 Ga0207687_10106189 3300025927 Bacteria 2076
267 Ga0207700_10075988 3300025928 Bacteria 2605
268 Ga0207664_10003464 3300025929 Bacteria 10524
269 Ga0207664_10005531 3300025929 Bacteria 8648
270 Ga0207664_10114967 3300025929 Bacteria 2243
271 Ga0207644_10034298 3300025931 Bacteria 3550
272 Ga0207706_10000792 3300025933 Bacteria 32696
273 Ga0207706_10004354 3300025933 Bacteria 13299
274 Ga0207706_10026328 3300025933 Bacteria 5206
275 Ga0207706_10037181 3300025933 Bacteria 4323
276 Ga0207670_10005050 3300025936 Bacteria 7195
277 Ga0207704_10018150 3300025938 Bacteria 3666
278 Ga0207704_10051413 3300025938 Bacteria 2492
279 Ga0207704_10093272 3300025938 Bacteria 1984
280 Ga0207665_10124638 3300025939 Bacteria 1823
281 Ga0207691_10012494 3300025940 Bacteria 8143
282 Ga0207711_10000087 3300025941 Bacteria 98302
283 Ga0207711_10233636 3300025941 Bacteria 1684
284 Ga0207711_10364277 3300025941 Bacteria 1340
285 Ga0207689_10010154 3300025942 Bacteria 8114
286 Ga0207689_10067477 3300025942 Bacteria 2939
287 Ga0207689_10126462 3300025942 Bacteria 2103
288 Ga0207689_10204167 3300025942 Bacteria 1632
289 Ga0207661_10257907 3300025944 Bacteria 1552
290 Ga0207679_10034308 3300025945 Bacteria 3578
291 Ga0207679_10100106 3300025945 Bacteria 2264
292 Ga0207679_10276974 3300025945 Bacteria 1437
293 Ga0207667_10002136 3300025949 Bacteria 24781
294 Ga0207667_10052079 3300025949 Bacteria 4313
295 Ga0207667_10064737 3300025949 Bacteria 3815
296 Ga0207651_10009898 3300025960 Bacteria 5248
297 Ga0207651_10230400 3300025960 Bacteria 1503
298 Ga0207712_10000168 3300025961 Bacteria 67505
299 Ga0207668_10035920 3300025972 Bacteria 3305
300 Ga0207640_10033832 3300025981 Bacteria 3184
301 Ga0207640_10346834 3300025981 Bacteria 1191
302 Ga0207658_10027527 3300025986 Bacteria 3994
303 Ga0207658_10092499 3300025986 Bacteria 2349
304 Ga0207658_10307672 3300025986 Bacteria 1368
305 Ga0207677_10003044 3300026023 Bacteria 8866
306 Ga0207677_10325297 3300026023 Bacteria 1279
307 Ga0207703_10000194 3300026035 Bacteria 70509
308 Ga0207703_10000522 3300026035 Bacteria 39489
309 Ga0207703_10022991 3300026035 Bacteria 4894
310 Ga0207703_10028086 3300026035 Bacteria 4431
311 Ga0207703_10033977 3300026035 Bacteria 4045
312 Ga0207639_10000218 3300026041 Bacteria 42765
313 Ga0207639_10019751 3300026041 Bacteria 4811
314 Ga0207639_10176427 3300026041 Bacteria 1814
315 Ga0207678_10010597 3300026067 Bacteria 8099
316 Ga0207678_10012550 3300026067 Bacteria 7443
317 Ga0207678_10014155 3300026067 Bacteria 7012
318 Ga0207678_10069350 3300026067 Bacteria 3023
319 Ga0207678_10256621 3300026067 Bacteria 1498
320 Ga0207702_10006391 3300026078 Bacteria 10169
321 Ga0207702_10022768 3300026078 Bacteria 5197
322 Ga0207702_10027813 3300026078 Bacteria 4697
323 Ga0207702_10092971 3300026078 Bacteria 2644
324 Ga0207641_10016815 3300026088 Bacteria 5989
325 Ga0207641_10061619 3300026088 Bacteria 3200
326 Ga0207641_10305411 3300026088 Bacteria 1504
327 Ga0207676_10000140 3300026095 Bacteria 62993
328 Ga0207676_10024476 3300026095 Bacteria 4467
329 Ga0207674_10000429 3300026116 Bacteria 54858
330 Ga0207674_10013722 3300026116 Bacteria 8969
331 Ga0207674_10043728 3300026116 Bacteria 4618
332 Ga0207683_10000717 3300026121 Bacteria 30124
333 Ga0207698_10001159 3300026142 Bacteria 15352
334 Ga0207698_10043803 3300026142 Bacteria 3356
335 Ga0207698_10159856 3300026142 Bacteria 1969
336 Ga0209969_1011648 3300027360 Bacteria 1265
337 Ga0209971_1005698 3300027682 Bacteria 2951
338 Ga0209974_10000642 3300027876 Bacteria 11791
339 Ga0209974_10009412 3300027876 Bacteria 3315
340 Ga0268266_10000007 3300028379 Bacteria 1372921
341 Ga0268265_10002190 3300028380 Bacteria 15082
342 Ga0268265_10054312 3300028380 Bacteria 3039
343 Ga0268265_10059918 3300028380 Bacteria 2915
344 Ga0268264_10042390 3300028381 Bacteria 3767
345 Ga0265334_10004878 3300028573 Bacteria 5898
346 Ga0265338_10011128 3300028800 Bacteria 10430
347 Ga0268256_1011030 3300030500 Bacteria 2894
348 Ga0265327_10017906 3300031251 Bacteria 4418
349 Ga0265313_10002274 3300031595 Bacteria 16848
350 Ga0316575_10004094 3300031665 Bacteria 5112
351 Ga0316575_10019443 3300031665 Bacteria 2597
352 Ga0316575_10056301 3300031665 Bacteria 1566
353 Ga0316575_10060985 3300031665 Bacteria 1507
354 Ga0316579_10002057 3300031691 Bacteria 7540
355 Ga0316579_10096420 3300031691 Bacteria 1414
356 Ga0316576_10031081 3300031727 Bacteria 3787
357 Ga0316576_10056263 3300031727 Bacteria 2872
358 Ga0316578_10027773 3300031728 Bacteria 3200
359 Ga0316578_10096449 3300031728 Bacteria 1770
360 Ga0307409_100145499 3300031995 Bacteria 2049
361 Ga0307414_10079148 3300032004 Bacteria 2398
362 Ga0316583_10004127 3300032133 Bacteria 5165
363 Ga0316583_10009697 3300032133 Bacteria 3470
364 Ga0316585_10000053 3300032137 Bacteria 18633
365 Ga0316580_10032249 3300032139 Bacteria 1622
366 Ga0307507_10055672 3300033179 Bacteria 3746
367 Ga0316587_1014579 3300033529 Bacteria 1297
368 Ga0373934_0009608 3300035086 Bacteria 3626
369 Ga0373923_0065437 3300035111 Bacteria 1551
370 Ga0373945_0016593 3300035116 Bacteria 2485
371 Ga0373954_0031283 3300035118 Bacteria 2456
372 Ga0373956_0019961 3300035119 Bacteria 2846
373 Ga0373957_0003466 3300035120 Bacteria 4664
374 Ga0373946_0108356 3300035171 Bacteria 1254
375 Ga0373955_0003437 3300035172 Bacteria 6960
376 Ga0316574_0001169 3300035398 Bacteria 12129
377 Ga0316574_0015011 3300035398 Bacteria 4487
378 Ga0316574_0019747 3300035398 Bacteria 3980
379 Ga0316574_0034199 3300035398 Bacteria 3097
380 Ga0316574_0038057 3300035398 Bacteria 2952
381 Ga0316574_0056040 3300035398 Bacteria 2465
382 Ga0316574_0083474 3300035398 Bacteria 2031
383 Ga0373924_0008014 3300035410 Bacteria 3823
384 Ga0373931_0071543 3300035691 Bacteria 1895
385 Ga0373927_0021524 3300035695 Bacteria 4227
386 Ga0373927_0099144 3300035695 Bacteria 1894
387 Ga0373933_0135642 3300035724 Bacteria 1550
388 Ga0373937_0070392 3300036401 Bacteria 3226
389 Ga0316582_0002176 3300036647 Bacteria 9093
390 Ga0316582_0007417 3300036647 Bacteria 5834
391 Ga0316582_0009716 3300036647 Bacteria 5232
392 Ga0316582_0015688 3300036647 Bacteria 4342
393 Ga0316584_0041153 3300036712 Bacteria 3445
394 Ga0316584_0187146 3300036712 Bacteria 1531
395 Ga0373925_0028363 3300037068 Bacteria 4101
396 Ga0373925_0138625 3300037068 Bacteria 1902
397 Ga0395901_0453599 3300038443 Bacteria 1311
398 Ga0400484_43797 3300038725 Bacteria 5009
399 Ga0400490_15683 3300038726 Bacteria 5070
400 Ga0400490_45494 3300038726 Bacteria 40576
401 Ga0400491_29664 3300038727 Bacteria 3309
402 Ga0400488_50269 3300038741 Bacteria 1608
403 Ga0400486_16325 3300038742 Bacteria 3227
404 Ga0400483_066104 3300039062 Bacteria 1722
405 Ga0400483_161823 3300039062 Bacteria 2580
406 Ga0400487_66289 3300039110 Bacteria 57838
407 Ga0436361_0962722 3300039447 Bacteria 4784
408 Ga0439446_0012949 3300042156 Bacteria 2283
409 Ga0439434_0025434 3300042435 Bacteria 1786
410 Ga0439435_0000327 3300042436 Bacteria 7177
411 Ga0450918_009064 3300042531 Bacteria 1746
412 Ga0451577_0002624 3300042876 Bacteria 21065
413 Ga0451577_0002812 3300042876 Bacteria 20062
414 Ga0453684_0546987 3300044712 Bacteria 1276
415 Ga0495603_0030735 3300046455 Bacteria 3235
416 Ga0495662_0119880 3300046476 Bacteria 1291
417 Ga0495664_0081349 3300046477 Bacteria 1942
418 Ga0495648_0005997 3300046524 Bacteria 9985
419 Ga0495663_0001763 3300046525 Bacteria 6708
420 Ga0495645_0089689 3300046543 Bacteria 2198
421 Ga0495588_0134787 3300046674 Bacteria 1303
422 Ga0495623_0042829 3300046679 Bacteria 2882
423 Ga0496103_0100451 3300048906 Bacteria 1831
424 Ga0496103_0205086 3300048906 Bacteria 1268
425 Ga0496104_0004559 3300048907 Bacteria 12076
426 Ga0496106_0184025 3300048909 Bacteria 1659
427 Ga0496106_0246983 3300048909 Bacteria 1426
428 Ga0496107_0096247 3300048910 Bacteria 2166
429 Ga0496109_0008584 3300048912 Bacteria 8695
430 Ga0496110_0125556 3300048913 Bacteria 2315
431 Ga0496111_0290658 3300048914 Bacteria 1212
432 Ga0496112_0003465 3300048915 Bacteria 13044
433 Ga0496112_0048405 3300048915 Bacteria 4168
434 Ga0496112_0200712 3300048915 Bacteria 1954
435 Ga0496114_0004669 3300048917 Bacteria 10648
436 Ga0496115_0211148 3300048918 Bacteria 1603
437 Ga0496118_0017687 3300048921 Bacteria 6473
438 Ga0501031_0114248 3300049568 Bacteria 1763
439 Ga0501032_0034055 3300049569 Bacteria 3488
440 Ga0501033_0143909 3300049570 Bacteria 1723
441 Ga0501034_0012647 3300049571 Bacteria 8708
442 Ga0501036_0070959 3300049572 Bacteria 2946
443 Ga0501037_0003749 3300049573 Bacteria 11030
444 Ga0501037_0022614 3300049573 Bacteria 4649
445 Ga0501038_0061754 3300049574 Bacteria 3204
446 Ga0501038_0167837 3300049574 Bacteria 1779
447 Ga0501039_0057449 3300049575 Bacteria 3013
448 Ga0501039_0309866 3300049575 Bacteria 1241
449 Ga0501040_0000005 3300049576 Bacteria 99976
450 Ga0501040_0127160 3300049576 Bacteria 1790
451 Ga0501041_0006345 3300049577 Bacteria 6919
452 Ga0501041_0105801 3300049577 Bacteria 1744
453 Ga0501042_0000156 3300049578 Bacteria 30727
454 Ga0501042_0003945 3300049578 Bacteria 9389
455 Ga0501042_0133705 3300049578 Bacteria 1788
456 Ga0501043_0002645 3300049579 Bacteria 15061
457 Ga0501043_0016348 3300049579 Bacteria 5820
458 Ga0501043_0063642 3300049579 Bacteria 2897
459 Ga0501046_0007052 3300049580 Bacteria 9898
460 Ga0501046_0015573 3300049580 Bacteria 6387
461 Ga0501047_0071906 3300049581 Bacteria 3329
462 Ga0501047_0451552 3300049581 Bacteria 1115
463 Ga0501048_0017341 3300049582 Bacteria 5306
464 Ga0501068_0046090 3300049584 Bacteria 2628
465 Ga0501068_0047317 3300049584 Bacteria 2595
466 Ga0501069_0030302 3300049585 Bacteria 2971
467 Ga0501070_0035023 3300049586 Bacteria 4196
468 Ga0501071_0013135 3300049587 Bacteria 5637
469 Ga0501072_0006441 3300049588 Bacteria 8939
470 Ga0501073_0032437 3300049589 Bacteria 3723
471 Ga0501073_0263334 3300049589 Bacteria 1190
472 Ga0501074_0003015 3300049590 Bacteria 11859
473 Ga0501074_0051446 3300049590 Bacteria 2973
474 Ga0501074_0286382 3300049590 Bacteria 1171
475 Ga0501075_0046658 3300049591 Bacteria 3254
476 Ga0501075_0114578 3300049591 Bacteria 2050
477 Ga0501075_0217282 3300049591 Bacteria 1458
478 Ga0501076_0023013 3300049592 Bacteria 4796
479 Ga0501076_0230416 3300049592 Bacteria 1514
480 Ga0501079_0033160 3300049741 Bacteria 3972
481 Ga0501079_0172476 3300049741 Bacteria 1687
482 Ga0501080_0120951 3300049742 Bacteria 2426
483 Ga0501083_0028135 3300049744 Bacteria 3876
484 Ga0501083_0080349 3300049744 Bacteria 2162
485 Ga0501035_0028378 3300049822 Bacteria 5109
486 Ga0501044_0200627 3300049823 Bacteria 1953
487 Ga0501045_0008257 3300049824 Bacteria 7250
488 nmdc:mga0n895_13463_c1 3300050512 Bacteria 7380
489 nmdc:mga0n895_98804_c1 3300050512 Bacteria 2926
490 nmdc:mga0rr50_2380_c1 3300050513 Bacteria 10581
491 nmdc:mga0a205_9389_c1 3300050515 Bacteria 8938
492 Ga0500578_0011893 3300053086 Bacteria 5621
493 Ga0500651_0004026 3300053093 Bacteria 8159
494 Ga0500641_0000270 3300053096 Bacteria 19388
495 Ga0500595_006524 3300053119 Bacteria 4938
496 Ga0500642_0001055 3300053130 Bacteria 7954
497 Ga0500658_0034866 3300053134 Bacteria 1989
498 Ga0500568_0003919 3300053139 Bacteria 8100
499 Ga0500577_0007617 3300053142 Bacteria 3046
500 Ga0500616_0001361 3300053153 Bacteria 23773
501 Ga0530510_0002503 3300061734 Bacteria 12626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0030735 Ga0495603_0030735_20_862 277
2 3300046674 Ga0495588_0134787 Ga0495588_0134787_20_862 277
3 3300035691 Ga0373931_0071543 Ga0373931_0071543_16_909 293
4 3300005468 Ga0070707_100024507 Ga0070707_1000245074 306
5 3300005536 Ga0070697_100010158 Ga0070697_1000101585 306
6 3300005614 Ga0068856_100226145 Ga0068856_1002261451 306
7 3300005843 Ga0068860_100128871 Ga0068860_1001288713 306
8 3300006175 Ga0070712_100010690 Ga0070712_1000106904 306
9 3300006237 Ga0097621_100147204 Ga0097621_1001472043 306
10 3300006871 Ga0075434_100079228 Ga0075434_1000792281 306
11 3300006914 Ga0075436_100259558 Ga0075436_1002595581 306
12 3300007076 Ga0075435_100004989 Ga0075435_1000049895 306
13 3300025898 Ga0207692_10113070 Ga0207692_101130702 306
14 3300025906 Ga0207699_10005933 Ga0207699_100059333 306
15 3300025910 Ga0207684_10029143 Ga0207684_100291432 306
16 3300025922 Ga0207646_10005024 Ga0207646_1000502410 306
17 3300025928 Ga0207700_10075988 Ga0207700_100759882 306
18 3300025960 Ga0207651_10009898 Ga0207651_100098985 306
19 3300025986 Ga0207658_10027527 Ga0207658_100275273 306
20 3300026023 Ga0207677_10325297 Ga0207677_103252972 306
21 3300028381 Ga0268264_10042390 Ga0268264_100423903 306
22 3300037068 Ga0373925_0138625 Ga0373925_0138625_20_949 306
23 3300038725 Ga0400484_43797 Ga0400484_43797_3822_4751 306
24 3300049578 Ga0501042_0133705 Ga0501042_0133705_826_1755 306
25 3300009093 Ga0105240_10000196 Ga0105240_1000019696 307
26 3300035398 Ga0316574_0038057 Ga0316574_0038057_1897_2832 307
27 3300036647 Ga0316582_0002176 Ga0316582_0002176_6559_7494 307
28 3300036712 Ga0316584_0187146 Ga0316584_0187146_186_1121 307
29 3300049573 Ga0501037_0022614 Ga0501037_0022614_1445_2377 307
30 3300049589 Ga0501073_0263334 Ga0501073_0263334_244_1176 307
31 3300049590 Ga0501074_0003015 Ga0501074_0003015_3386_4318 307
32 3300031728 Ga0316578_10096449 Ga0316578_100964492 308
33 3300049568 Ga0501031_0114248 Ga0501031_0114248_10_945 308
34 3300013297 Ga0157378_10030194 Ga0157378_100301944 315
35 3300038726 Ga0400490_45494 Ga0400490_45494_14292_15248 315
36 3300038727 Ga0400491_29664 Ga0400491_29664_63_1019 315
37 3300039110 Ga0400487_66289 Ga0400487_66289_31735_32691 315
38 3300005330 Ga0070690_100001976 Ga0070690_1000019767 316
39 3300005331 Ga0070670_100200663 Ga0070670_1002006631 316
40 3300005333 Ga0070677_10075671 Ga0070677_100756712 316
41 3300005334 Ga0068869_100047408 Ga0068869_1000474083 316
42 3300005335 Ga0070666_10030032 Ga0070666_100300323 316
43 3300005338 Ga0068868_100068190 Ga0068868_1000681902 316
44 3300005340 Ga0070689_100002818 Ga0070689_1000028181 316
45 3300005355 Ga0070671_100035349 Ga0070671_1000353492 316
46 3300005364 Ga0070673_100002777 Ga0070673_1000027773 316
47 3300005365 Ga0070688_100000391 Ga0070688_10000039114 316
48 3300005367 Ga0070667_100092127 Ga0070667_1000921273 316
49 3300005436 Ga0070713_100268553 Ga0070713_1002685532 316
50 3300005437 Ga0070710_10004401 Ga0070710_100044014 316
51 3300005439 Ga0070711_100200533 Ga0070711_1002005332 316
52 3300005456 Ga0070678_100002681 Ga0070678_1000026813 316
53 3300005457 Ga0070662_100017183 Ga0070662_1000171833 316
54 3300005459 Ga0068867_100013472 Ga0068867_1000134725 316
55 3300005547 Ga0070693_100012260 Ga0070693_1000122603 316
56 3300005548 Ga0070665_100003582 Ga0070665_1000035823 316
57 3300005615 Ga0070702_100148354 Ga0070702_1001483541 316
58 3300005617 Ga0068859_100003236 Ga0068859_10000323612 316
59 3300005618 Ga0068864_100001480 Ga0068864_10000148017 316
60 3300005718 Ga0068866_10001308 Ga0068866_100013088 316
61 3300005841 Ga0068863_100002303 Ga0068863_1000023035 316
62 3300005842 Ga0068858_100009965 Ga0068858_10000996511 316
63 3300006358 Ga0068871_100074127 Ga0068871_1000741273 316
64 3300006358 Ga0068871_100144916 Ga0068871_1001449161 316
65 3300006871 Ga0075434_100398151 Ga0075434_1003981512 316
66 3300006881 Ga0068865_100028384 Ga0068865_1000283842 316
67 3300006931 Ga0097620_100003236 Ga0097620_10000323612 316
68 3300013104 Ga0157370_10179688 Ga0157370_101796882 316
69 3300013306 Ga0163162_10025348 Ga0163162_100253482 316
70 3300025908 Ga0207643_10011302 Ga0207643_100113027 316
71 3300025915 Ga0207693_10055062 Ga0207693_100550623 316
72 3300025916 Ga0207663_10017301 Ga0207663_100173016 316
73 3300025923 Ga0207681_10057436 Ga0207681_100574362 316
74 3300025927 Ga0207687_10005040 Ga0207687_100050403 316
75 3300025927 Ga0207687_10106189 Ga0207687_101061891 316
76 3300025931 Ga0207644_10034298 Ga0207644_100342983 316
77 3300025933 Ga0207706_10004354 Ga0207706_100043543 316
78 3300025936 Ga0207670_10005050 Ga0207670_100050501 316
79 3300025938 Ga0207704_10093272 Ga0207704_100932722 316
80 3300025941 Ga0207711_10000087 Ga0207711_1000008711 316
81 3300025942 Ga0207689_10067477 Ga0207689_100674773 316
82 3300026023 Ga0207677_10003044 Ga0207677_100030449 316
83 3300026035 Ga0207703_10000522 Ga0207703_1000052225 316
84 3300026067 Ga0207678_10069350 Ga0207678_100693503 316
85 3300026078 Ga0207702_10027813 Ga0207702_100278136 316
86 3300026095 Ga0207676_10000140 Ga0207676_1000014047 316
87 3300026121 Ga0207683_10000717 Ga0207683_100007178 316
88 3300035171 Ga0373946_0108356 Ga0373946_0108356_11_970 316
89 3300035695 Ga0373927_0021524 Ga0373927_0021524_2738_3697 316
90 3300035695 Ga0373927_0099144 Ga0373927_0099144_919_1878 316
91 3300039062 Ga0400483_161823 Ga0400483_161823_882_1841 316
92 3300046525 Ga0495663_0001763 Ga0495663_0001763_2417_3376 316
93 3300005530 Ga0070679_100300459 Ga0070679_1003004592 317
94 3300005841 Ga0068863_100118109 Ga0068863_1001181092 317
95 3300005844 Ga0068862_100075280 Ga0068862_1000752804 317
96 3300009093 Ga0105240_10029644 Ga0105240_100296443 317
97 3300013100 Ga0157373_10122571 Ga0157373_101225712 317
98 3300013104 Ga0157370_10044444 Ga0157370_100444443 317
99 3300027682 Ga0209971_1005698 Ga0209971_10056983 317
100 3300027876 Ga0209974_10009412 Ga0209974_100094125 317
101 3300028573 Ga0265334_10004878 Ga0265334_100048782 317
102 3300028800 Ga0265338_10011128 Ga0265338_100111288 317
103 3300031251 Ga0265327_10017906 Ga0265327_100179066 317
104 3300031595 Ga0265313_10002274 Ga0265313_100022743 317
105 3300035398 Ga0316574_0001169 Ga0316574_0001169_7859_8824 317
106 3300035398 Ga0316574_0056040 Ga0316574_0056040_121_1086 317
107 3300036647 Ga0316582_0007417 Ga0316582_0007417_3526_4491 317
108 3300042156 Ga0439446_0012949 Ga0439446_0012949_366_1334 317
109 3300042435 Ga0439434_0025434 Ga0439434_0025434_633_1601 317
110 3300042436 Ga0439435_0000327 Ga0439435_0000327_1707_2675 317
111 3300042531 Ga0450918_009064 Ga0450918_009064_423_1391 317
112 3300049569 Ga0501032_0034055 Ga0501032_0034055_1231_2193 317
113 3300049573 Ga0501037_0003749 Ga0501037_0003749_3345_4307 317
114 3300049575 Ga0501039_0309866 Ga0501039_0309866_83_1048 317
115 3300049577 Ga0501041_0105801 Ga0501041_0105801_239_1204 317
116 3300049580 Ga0501046_0015573 Ga0501046_0015573_4178_5140 317
117 3300049585 Ga0501069_0030302 Ga0501069_0030302_1673_2635 317
118 3300049586 Ga0501070_0035023 Ga0501070_0035023_2089_3051 317
119 3300049590 Ga0501074_0286382 Ga0501074_0286382_185_1147 317
120 3300049741 Ga0501079_0172476 Ga0501079_0172476_266_1228 317
121 3300038741 Ga0400488_50269 Ga0400488_50269_68_1033 318
122 3300026035 Ga0207703_10033977 Ga0207703_100339772 319
123 3300035398 Ga0316574_0019747 Ga0316574_0019747_993_1961 319
124 3300039062 Ga0400483_066104 Ga0400483_066104_724_1692 319
125 3300009551 Ga0105238_10018871 Ga0105238_100188717 320
126 3300013100 Ga0157373_10133627 Ga0157373_101336272 320
127 3300013104 Ga0157370_10062340 Ga0157370_100623402 320
128 3300013307 Ga0157372_10000822 Ga0157372_1000082232 320
129 3300035398 Ga0316574_0083474 Ga0316574_0083474_749_1723 320
130 3300036647 Ga0316582_0009716 Ga0316582_0009716_3251_4225 320
131 3300036712 Ga0316584_0041153 Ga0316584_0041153_1911_2885 320
132 3300038726 Ga0400490_15683 Ga0400490_15683_1789_2760 320
133 3300038742 Ga0400486_16325 Ga0400486_16325_1454_2425 320
134 3300042876 Ga0451577_0002624 Ga0451577_0002624_4512_5489 320
135 3300044712 Ga0453684_0546987 Ga0453684_0546987_203_1180 320
136 3300049574 Ga0501038_0061754 Ga0501038_0061754_142_1113 320
137 3300049581 Ga0501047_0451552 Ga0501047_0451552_109_1077 322
138 iso_pu_bacteria 2842757796 2842761082 322
139 3300032004 Ga0307414_10079148 Ga0307414_100791483 326
140 3300005329 Ga0070683_100003773 Ga0070683_10000377315 327
141 3300005335 Ga0070666_10000953 Ga0070666_100009532 327
142 3300005335 Ga0070666_10014158 Ga0070666_100141583 327
143 3300005339 Ga0070660_100060694 Ga0070660_1000606942 327
144 3300005344 Ga0070661_100002100 Ga0070661_1000021009 327
145 3300005455 Ga0070663_100017914 Ga0070663_1000179146 327
146 3300005455 Ga0070663_100033468 Ga0070663_1000334686 327
147 3300005457 Ga0070662_100022041 Ga0070662_1000220414 327
148 3300005457 Ga0070662_100047556 Ga0070662_1000475563 327
149 3300005530 Ga0070679_100087660 Ga0070679_1000876602 327
150 3300005535 Ga0070684_100042329 Ga0070684_1000423292 327
151 3300005539 Ga0068853_100045310 Ga0068853_1000453102 327
152 3300005539 Ga0068853_100050816 Ga0068853_1000508165 327
153 3300005539 Ga0068853_100257092 Ga0068853_1002570922 327
154 3300005548 Ga0070665_100000500 Ga0070665_1000005006 327
155 3300005563 Ga0068855_100022596 Ga0068855_1000225967 327
156 3300005564 Ga0070664_100040926 Ga0070664_1000409262 327
157 3300005577 Ga0068857_100056366 Ga0068857_1000563662 327
158 3300005578 Ga0068854_100002838 Ga0068854_10000283813 327
159 3300005578 Ga0068854_100027454 Ga0068854_1000274545 327
160 3300005616 Ga0068852_100014257 Ga0068852_1000142573 327
161 3300005618 Ga0068864_100027559 Ga0068864_1000275595 327
162 3300005834 Ga0068851_10002553 Ga0068851_1000255310 327
163 3300005841 Ga0068863_100003508 Ga0068863_10000350815 327
164 3300005842 Ga0068858_100004483 Ga0068858_10000448312 327
165 3300005843 Ga0068860_100017042 Ga0068860_1000170422 327
166 3300005844 Ga0068862_100060726 Ga0068862_1000607263 327
167 3300006028 Ga0070717_10154501 Ga0070717_101545012 327
168 3300006237 Ga0097621_100136104 Ga0097621_1001361042 327
169 3300006358 Ga0068871_100137736 Ga0068871_1001377362 327
170 3300006881 Ga0068865_100022190 Ga0068865_1000221903 327
171 3300006881 Ga0068865_100045419 Ga0068865_1000454192 327
172 3300009093 Ga0105240_10013319 Ga0105240_100133199 327
173 3300009093 Ga0105240_10019737 Ga0105240_100197372 327
174 3300009093 Ga0105240_10058730 Ga0105240_100587306 327
175 3300009093 Ga0105240_10083233 Ga0105240_100832332 327
176 3300009098 Ga0105245_10117407 Ga0105245_101174073 327
177 3300009174 Ga0105241_10208900 Ga0105241_102089002 327
178 3300009177 Ga0105248_10227902 Ga0105248_102279022 327
179 3300009545 Ga0105237_10009184 Ga0105237_100091846 327
180 3300009551 Ga0105238_10095202 Ga0105238_100952022 327
181 3300010375 Ga0105239_10007054 Ga0105239_1000705410 327
182 3300010375 Ga0105239_10105015 Ga0105239_101050152 327
183 3300010375 Ga0105239_10189928 Ga0105239_101899283 327
184 3300013105 Ga0157369_10013085 Ga0157369_1001308512 327
185 3300013296 Ga0157374_10029101 Ga0157374_100291012 327
186 3300013297 Ga0157378_10092120 Ga0157378_100921203 327
187 3300013306 Ga0163162_10000061 Ga0163162_1000006188 327
188 3300013307 Ga0157372_10025500 Ga0157372_100255007 327
189 3300014325 Ga0163163_10000166 Ga0163163_1000016622 327
190 3300014968 Ga0157379_10004862 Ga0157379_100048624 327
191 3300025261 Ga0209233_1000930 Ga0209233_10009307 327
192 3300025321 Ga0207656_10000819 Ga0207656_100008192 327
193 3300025903 Ga0207680_10005524 Ga0207680_100055242 327
194 3300025904 Ga0207647_10000277 Ga0207647_1000027740 327
195 3300025904 Ga0207647_10001196 Ga0207647_1000119624 327
196 3300025913 Ga0207695_10000040 Ga0207695_10000040400 327
197 3300025913 Ga0207695_10000271 Ga0207695_1000027190 327
198 3300025913 Ga0207695_10013099 Ga0207695_100130998 327
199 3300025914 Ga0207671_10007196 Ga0207671_1000719611 327
200 3300025914 Ga0207671_10019252 Ga0207671_100192522 327
201 3300025914 Ga0207671_10025050 Ga0207671_100250502 327
202 3300025914 Ga0207671_10272923 Ga0207671_102729232 327
203 3300025919 Ga0207657_10013571 Ga0207657_100135719 327
204 3300025920 Ga0207649_10010017 Ga0207649_100100176 327
205 3300025920 Ga0207649_10141242 Ga0207649_101412421 327
206 3300025924 Ga0207694_10001531 Ga0207694_100015318 327
207 3300025933 Ga0207706_10000792 Ga0207706_100007927 327
208 3300025933 Ga0207706_10026328 Ga0207706_100263283 327
209 3300025938 Ga0207704_10051413 Ga0207704_100514132 327
210 3300025941 Ga0207711_10233636 Ga0207711_102336361 327
211 3300025949 Ga0207667_10052079 Ga0207667_100520795 327
212 3300025961 Ga0207712_10000168 Ga0207712_1000016846 327
213 3300025981 Ga0207640_10033832 Ga0207640_100338322 327
214 3300025986 Ga0207658_10092499 Ga0207658_100924992 327
215 3300026035 Ga0207703_10000194 Ga0207703_1000019446 327
216 3300026035 Ga0207703_10028086 Ga0207703_100280864 327
217 3300026041 Ga0207639_10000218 Ga0207639_1000021839 327
218 3300026041 Ga0207639_10176427 Ga0207639_101764272 327
219 3300026067 Ga0207678_10010597 Ga0207678_100105977 327
220 3300026067 Ga0207678_10012550 Ga0207678_100125509 327
221 3300026078 Ga0207702_10006391 Ga0207702_100063914 327
222 3300026078 Ga0207702_10022768 Ga0207702_100227686 327
223 3300026088 Ga0207641_10016815 Ga0207641_100168157 327
224 3300026088 Ga0207641_10061619 Ga0207641_100616192 327
225 3300026095 Ga0207676_10024476 Ga0207676_100244763 327
226 3300026116 Ga0207674_10043728 Ga0207674_100437282 327
227 3300026142 Ga0207698_10043803 Ga0207698_100438035 327
228 3300028379 Ga0268266_10000007 Ga0268266_10000007266 327
229 3300033179 Ga0307507_10055672 Ga0307507_100556722 327
230 3300048906 Ga0496103_0205086 Ga0496103_0205086_14_1009 327
231 3300048921 Ga0496118_0017687 Ga0496118_0017687_5394_6389 327
232 iso_pu_bacteria 2842805378 2842807965 329
233 iso_pu_bacteria 2974298342 2974302070 329
234 iso_pu_bacteria 8011350971 8011351064 329
235 3300005338 Ga0068868_100080515 Ga0068868_1000805152 330
236 3300005444 Ga0070694_100014953 Ga0070694_1000149532 330
237 3300005467 Ga0070706_100147529 Ga0070706_1001475292 330
238 3300005468 Ga0070707_100059284 Ga0070707_1000592843 330
239 3300005471 Ga0070698_100110784 Ga0070698_1001107843 330
240 3300005535 Ga0070684_100025550 Ga0070684_1000255506 330
241 3300005536 Ga0070697_100007297 Ga0070697_1000072973 330
242 3300005578 Ga0068854_100004550 Ga0068854_1000045508 330
243 3300025906 Ga0207699_10029168 Ga0207699_100291682 330
244 3300025906 Ga0207699_10238786 Ga0207699_102387861 330
245 3300025911 Ga0207654_10070124 Ga0207654_100701243 330
246 3300025914 Ga0207671_10226768 Ga0207671_102267682 330
247 3300025915 Ga0207693_10125258 Ga0207693_101252582 330
248 3300025919 Ga0207657_10002002 Ga0207657_1000200216 330
249 3300025922 Ga0207646_10254288 Ga0207646_102542881 330
250 3300025933 Ga0207706_10037181 Ga0207706_100371813 330
251 3300025939 Ga0207665_10124638 Ga0207665_101246382 330
252 3300025941 Ga0207711_10364277 Ga0207711_103642771 330
253 3300025944 Ga0207661_10257907 Ga0207661_102579072 330
254 3300025981 Ga0207640_10346834 Ga0207640_103468342 330
255 3300026067 Ga0207678_10256621 Ga0207678_102566212 330
256 3300026116 Ga0207674_10013722 Ga0207674_100137223 330
257 3300050512 nmdc:mga0n895_13463_c1 nmdc:mga0n895_13463_c1_3960_4961 330
258 3300050513 nmdc:mga0rr50_2380_c1 nmdc:mga0rr50_2380_c1_998_1999 330
259 3300050515 nmdc:mga0a205_9389_c1 nmdc:mga0a205_9389_c1_2425_3426 330
260 3300005329 Ga0070683_100017074 Ga0070683_1000170743 331
261 3300005340 Ga0070689_100003205 Ga0070689_1000032058 331
262 3300005344 Ga0070661_100026097 Ga0070661_1000260974 331
263 3300005344 Ga0070661_100292175 Ga0070661_1002921752 331
264 3300005347 Ga0070668_100010367 Ga0070668_1000103672 331
265 3300005365 Ga0070688_100002581 Ga0070688_1000025818 331
266 3300005435 Ga0070714_100020029 Ga0070714_1000200293 331
267 3300005435 Ga0070714_100046041 Ga0070714_1000460413 331
268 3300005456 Ga0070678_100171473 Ga0070678_1001714732 331
269 3300005458 Ga0070681_10044844 Ga0070681_100448443 331
270 3300005458 Ga0070681_10100219 Ga0070681_101002194 331
271 3300005466 Ga0070685_10015530 Ga0070685_100155304 331
272 3300005530 Ga0070679_100428221 Ga0070679_1004282211 331
273 3300005535 Ga0070684_100002389 Ga0070684_10000238912 331
274 3300005535 Ga0070684_100204338 Ga0070684_1002043382 331
275 3300005543 Ga0070672_100115806 Ga0070672_1001158061 331
276 3300005563 Ga0068855_100063378 Ga0068855_1000633782 331
277 3300005563 Ga0068855_100093898 Ga0068855_1000938981 331
278 3300005564 Ga0070664_100002891 Ga0070664_10000289111 331
279 3300005564 Ga0070664_100100771 Ga0070664_1001007712 331
280 3300005578 Ga0068854_100001870 Ga0068854_1000018701 331
281 3300005614 Ga0068856_100006058 Ga0068856_1000060583 331
282 3300005614 Ga0068856_100125603 Ga0068856_1001256032 331
283 3300005616 Ga0068852_100186355 Ga0068852_1001863552 331
284 3300005834 Ga0068851_10002512 Ga0068851_100025127 331
285 3300006358 Ga0068871_100177312 Ga0068871_1001773122 331
286 3300009093 Ga0105240_10081793 Ga0105240_100817933 331
287 3300009177 Ga0105248_10015684 Ga0105248_100156844 331
288 3300009551 Ga0105238_10021424 Ga0105238_100214245 331
289 3300010375 Ga0105239_10005029 Ga0105239_1000502910 331
290 3300013100 Ga0157373_10017035 Ga0157373_100170353 331
291 3300013102 Ga0157371_10010442 Ga0157371_100104422 331
292 3300013104 Ga0157370_10188472 Ga0157370_101884722 331
293 3300025321 Ga0207656_10055598 Ga0207656_100555982 331
294 3300025909 Ga0207705_10174346 Ga0207705_101743462 331
295 3300025911 Ga0207654_10066653 Ga0207654_100666532 331
296 3300025912 Ga0207707_10002828 Ga0207707_100028285 331
297 3300025912 Ga0207707_10023500 Ga0207707_100235004 331
298 3300025912 Ga0207707_10231711 Ga0207707_102317112 331
299 3300025919 Ga0207657_10000258 Ga0207657_1000025827 331
300 3300025921 Ga0207652_10033685 Ga0207652_100336854 331
301 3300025929 Ga0207664_10114967 Ga0207664_101149672 331
302 3300025945 Ga0207679_10100106 Ga0207679_101001062 331
303 3300025949 Ga0207667_10002136 Ga0207667_1000213614 331
304 3300025949 Ga0207667_10064737 Ga0207667_100647373 331
305 3300025972 Ga0207668_10035920 Ga0207668_100359201 331
306 3300026067 Ga0207678_10014155 Ga0207678_100141553 331
307 3300026078 Ga0207702_10092971 Ga0207702_100929712 331
308 3300026116 Ga0207674_10000429 Ga0207674_1000042938 331
309 3300026142 Ga0207698_10001159 Ga0207698_1000115910 331
310 3300038443 Ga0395901_0453599 Ga0395901_0453599_14_1033 331
311 3300049571 Ga0501034_0012647 Ga0501034_0012647_4150_5157 331
312 3300049572 Ga0501036_0070959 Ga0501036_0070959_1864_2868 331
313 3300049579 Ga0501043_0002645 Ga0501043_0002645_7509_8513 331
314 3300049588 Ga0501072_0006441 Ga0501072_0006441_5785_6792 331
315 3300005329 Ga0070683_100044710 Ga0070683_1000447103 332
316 3300005331 Ga0070670_100120300 Ga0070670_1001203002 332
317 3300005336 Ga0070680_100124162 Ga0070680_1001241622 332
318 3300005406 Ga0070703_10066576 Ga0070703_100665761 332
319 3300005435 Ga0070714_100011657 Ga0070714_1000116575 332
320 3300005437 Ga0070710_10049352 Ga0070710_100493523 332
321 3300005530 Ga0070679_100223892 Ga0070679_1002238922 332
322 3300005539 Ga0068853_100140296 Ga0068853_1001402963 332
323 3300005549 Ga0070704_100021784 Ga0070704_1000217843 332
324 3300005616 Ga0068852_100185005 Ga0068852_1001850052 332
325 3300009098 Ga0105245_10134877 Ga0105245_101348771 332
326 3300009101 Ga0105247_10043783 Ga0105247_100437832 332
327 3300009174 Ga0105241_10039536 Ga0105241_100395361 332
328 3300009176 Ga0105242_10057368 Ga0105242_100573681 332
329 3300009177 Ga0105248_10259426 Ga0105248_102594262 332
330 3300009177 Ga0105248_10384697 Ga0105248_103846971 332
331 3300009551 Ga0105238_10091162 Ga0105238_100911623 332
332 3300010375 Ga0105239_10038663 Ga0105239_100386634 332
333 3300011119 Ga0105246_10104806 Ga0105246_101048063 332
334 3300013104 Ga0157370_10100152 Ga0157370_101001522 332
335 3300013296 Ga0157374_10000922 Ga0157374_1000092210 332
336 3300013297 Ga0157378_10104490 Ga0157378_101044902 332
337 3300013306 Ga0163162_10069928 Ga0163162_100699281 332
338 3300014325 Ga0163163_10008748 Ga0163163_1000874811 332
339 3300014745 Ga0157377_10022831 Ga0157377_100228313 332
340 3300014968 Ga0157379_10016112 Ga0157379_100161126 332
341 3300014969 Ga0157376_10080383 Ga0157376_100803831 332
342 3300014969 Ga0157376_10218381 Ga0157376_102183812 332
343 3300025898 Ga0207692_10038162 Ga0207692_100381621 332
344 3300025916 Ga0207663_10161653 Ga0207663_101616532 332
345 3300025929 Ga0207664_10003464 Ga0207664_100034645 332
346 3300025942 Ga0207689_10204167 Ga0207689_102041672 332
347 3300025945 Ga0207679_10034308 Ga0207679_100343083 332
348 3300027360 Ga0209969_1011648 Ga0209969_10116481 332
349 3300027876 Ga0209974_10000642 Ga0209974_1000064210 332
350 3300031665 Ga0316575_10004094 Ga0316575_100040942 332
351 3300032133 Ga0316583_10004127 Ga0316583_100041272 332
352 3300035086 Ga0373934_0009608 Ga0373934_0009608_203_1210 332
353 3300035111 Ga0373923_0065437 Ga0373923_0065437_511_1518 332
354 3300035116 Ga0373945_0016593 Ga0373945_0016593_1198_2205 332
355 3300035118 Ga0373954_0031283 Ga0373954_0031283_379_1386 332
356 3300035119 Ga0373956_0019961 Ga0373956_0019961_1254_2261 332
357 3300035120 Ga0373957_0003466 Ga0373957_0003466_1343_2350 332
358 3300035172 Ga0373955_0003437 Ga0373955_0003437_460_1467 332
359 3300035398 Ga0316574_0034199 Ga0316574_0034199_1995_3002 332
360 3300035410 Ga0373924_0008014 Ga0373924_0008014_916_1923 332
361 3300035724 Ga0373933_0135642 Ga0373933_0135642_179_1186 332
362 3300036401 Ga0373937_0070392 Ga0373937_0070392_1022_2029 332
363 3300036647 Ga0316582_0015688 Ga0316582_0015688_3198_4205 332
364 3300037068 Ga0373925_0028363 Ga0373925_0028363_1593_2600 332
365 3300046476 Ga0495662_0119880 Ga0495662_0119880_270_1277 332
366 3300046477 Ga0495664_0081349 Ga0495664_0081349_919_1926 332
367 3300046543 Ga0495645_0089689 Ga0495645_0089689_110_1117 332
368 3300046679 Ga0495623_0042829 Ga0495623_0042829_139_1146 332
369 3300048906 Ga0496103_0100451 Ga0496103_0100451_53_1060 332
370 3300048907 Ga0496104_0004559 Ga0496104_0004559_8799_9806 332
371 3300048909 Ga0496106_0184025 Ga0496106_0184025_190_1197 332
372 3300048909 Ga0496106_0246983 Ga0496106_0246983_318_1325 332
373 3300048910 Ga0496107_0096247 Ga0496107_0096247_1143_2150 332
374 3300048912 Ga0496109_0008584 Ga0496109_0008584_3839_4846 332
375 3300048913 Ga0496110_0125556 Ga0496110_0125556_1266_2273 332
376 3300048914 Ga0496111_0290658 Ga0496111_0290658_158_1165 332
377 3300048915 Ga0496112_0003465 Ga0496112_0003465_6111_7118 332
378 3300048915 Ga0496112_0048405 Ga0496112_0048405_125_1132 332
379 3300048917 Ga0496114_0004669 Ga0496114_0004669_131_1138 332
380 3300048918 Ga0496115_0211148 Ga0496115_0211148_571_1578 332
381 3300050512 nmdc:mga0n895_98804_c1 nmdc:mga0n895_98804_c1_1669_2676 332
382 3300005330 Ga0070690_100018410 Ga0070690_1000184104 333
383 3300005331 Ga0070670_100038842 Ga0070670_1000388423 333
384 3300005338 Ga0068868_100127477 Ga0068868_1001274772 333
385 3300005354 Ga0070675_100205020 Ga0070675_1002050202 333
386 3300005364 Ga0070673_100045036 Ga0070673_1000450363 333
387 3300005434 Ga0070709_10007739 Ga0070709_100077393 333
388 3300005437 Ga0070710_10166380 Ga0070710_101663801 333
389 3300005518 Ga0070699_100020992 Ga0070699_1000209923 333
390 3300005539 Ga0068853_100012083 Ga0068853_1000120834 333
391 3300005543 Ga0070672_100053344 Ga0070672_1000533443 333
392 3300005548 Ga0070665_100152867 Ga0070665_1001528671 333
393 3300005617 Ga0068859_100021624 Ga0068859_1000216246 333
394 3300005618 Ga0068864_100400311 Ga0068864_1004003111 333
395 3300005718 Ga0068866_10021490 Ga0068866_100214901 333
396 3300005841 Ga0068863_100225043 Ga0068863_1002250432 333
397 3300005842 Ga0068858_100120062 Ga0068858_1001200622 333
398 3300005843 Ga0068860_100083826 Ga0068860_1000838262 333
399 3300005844 Ga0068862_100048679 Ga0068862_1000486793 333
400 3300005844 Ga0068862_100151654 Ga0068862_1001516542 333
401 3300006237 Ga0097621_100402628 Ga0097621_1004026281 333
402 3300006358 Ga0068871_100005265 Ga0068871_1000052656 333
403 3300006844 Ga0075428_100066124 Ga0075428_1000661244 333
404 3300006931 Ga0097620_100021624 Ga0097620_1000216243 333
405 3300009093 Ga0105240_10049857 Ga0105240_100498573 333
406 3300009545 Ga0105237_10057965 Ga0105237_100579653 333
407 3300013105 Ga0157369_10021113 Ga0157369_1002111310 333
408 3300013297 Ga0157378_10009053 Ga0157378_100090534 333
409 3300013306 Ga0163162_10056092 Ga0163162_100560922 333
410 3300013307 Ga0157372_10061152 Ga0157372_100611522 333
411 3300025898 Ga0207692_10070559 Ga0207692_100705592 333
412 3300025899 Ga0207642_10010089 Ga0207642_100100893 333
413 3300025906 Ga0207699_10177840 Ga0207699_101778401 333
414 3300025907 Ga0207645_10088484 Ga0207645_100884841 333
415 3300025913 Ga0207695_10023565 Ga0207695_100235655 333
416 3300025914 Ga0207671_10088409 Ga0207671_100884092 333
417 3300025916 Ga0207663_10049863 Ga0207663_100498633 333
418 3300025920 Ga0207649_10110393 Ga0207649_101103932 333
419 3300025925 Ga0207650_10039382 Ga0207650_100393823 333
420 3300025926 Ga0207659_10287396 Ga0207659_102873962 333
421 3300025929 Ga0207664_10005531 Ga0207664_100055318 333
422 3300025938 Ga0207704_10018150 Ga0207704_100181503 333
423 3300025940 Ga0207691_10012494 Ga0207691_100124948 333
424 3300025942 Ga0207689_10010154 Ga0207689_100101541 333
425 3300025942 Ga0207689_10126462 Ga0207689_101264621 333
426 3300025945 Ga0207679_10276974 Ga0207679_102769742 333
427 3300025960 Ga0207651_10230400 Ga0207651_102304001 333
428 3300025986 Ga0207658_10307672 Ga0207658_103076721 333
429 3300026035 Ga0207703_10022991 Ga0207703_100229914 333
430 3300026041 Ga0207639_10019751 Ga0207639_100197513 333
431 3300026088 Ga0207641_10305411 Ga0207641_103054111 333
432 3300028380 Ga0268265_10054312 Ga0268265_100543122 333
433 3300028380 Ga0268265_10059918 Ga0268265_100599182 333
434 3300031665 Ga0316575_10056301 Ga0316575_100563012 333
435 3300031691 Ga0316579_10096420 Ga0316579_100964201 333
436 3300031727 Ga0316576_10056263 Ga0316576_100562634 333
437 3300031995 Ga0307409_100145499 Ga0307409_1001454993 333
438 3300033529 Ga0316587_1014579 Ga0316587_10145792 333
439 3300035398 Ga0316574_0015011 Ga0316574_0015011_2718_3728 333
440 3300046524 Ga0495648_0005997 Ga0495648_0005997_1554_2567 333
441 3300048915 Ga0496112_0200712 Ga0496112_0200712_851_1864 333
442 3300049591 Ga0501075_0217282 Ga0501075_0217282_187_1206 333
443 3300025735 Ga0207713_1030216 Ga0207713_10302161 334
444 3300025913 Ga0207695_10000554 Ga0207695_1000055459 334
445 3300030500 Ga0268256_1011030 Ga0268256_10110302 334
446 3300049570 Ga0501033_0143909 Ga0501033_0143909_184_1203 334
447 3300049574 Ga0501038_0167837 Ga0501038_0167837_319_1338 334
448 3300049575 Ga0501039_0057449 Ga0501039_0057449_1676_2695 334
449 3300049576 Ga0501040_0127160 Ga0501040_0127160_139_1158 334
450 3300049577 Ga0501041_0006345 Ga0501041_0006345_5282_6301 334
451 3300049578 Ga0501042_0003945 Ga0501042_0003945_7850_8869 334
452 3300049579 Ga0501043_0016348 Ga0501043_0016348_1865_2884 334
453 3300049580 Ga0501046_0007052 Ga0501046_0007052_967_1986 334
454 3300049582 Ga0501048_0017341 Ga0501048_0017341_19_1038 334
455 3300049584 Ga0501068_0047317 Ga0501068_0047317_794_1813 334
456 3300049587 Ga0501071_0013135 Ga0501071_0013135_4458_5477 334
457 3300049590 Ga0501074_0051446 Ga0501074_0051446_93_1112 334
458 3300049591 Ga0501075_0046658 Ga0501075_0046658_1469_2488 334
459 3300049591 Ga0501075_0114578 Ga0501075_0114578_26_1045 334
460 3300049592 Ga0501076_0023013 Ga0501076_0023013_3376_4395 334
461 3300049592 Ga0501076_0230416 Ga0501076_0230416_108_1127 334
462 3300049741 Ga0501079_0033160 Ga0501079_0033160_2623_3642 334
463 3300049744 Ga0501083_0080349 Ga0501083_0080349_641_1660 334
464 3300049822 Ga0501035_0028378 Ga0501035_0028378_300_1319 334
465 3300049824 Ga0501045_0008257 Ga0501045_0008257_5913_6932 334
466 3300061734 Ga0530510_0002503 Ga0530510_0002503_3266_4285 334
467 3300010375 Ga0105239_10001780 Ga0105239_100017809 335
468 3300013296 Ga0157374_10000127 Ga0157374_1000012736 335
469 3300021361 Ga0213872_10061799 Ga0213872_100617991 335
470 3300026142 Ga0207698_10159856 Ga0207698_101598562 335
471 3300031665 Ga0316575_10019443 Ga0316575_100194432 335
472 3300031665 Ga0316575_10060985 Ga0316575_100609851 335
473 3300031691 Ga0316579_10002057 Ga0316579_100020578 335
474 3300031727 Ga0316576_10031081 Ga0316576_100310813 335
475 3300031728 Ga0316578_10027773 Ga0316578_100277732 335
476 3300032133 Ga0316583_10009697 Ga0316583_100096971 335
477 3300032137 Ga0316585_10000053 Ga0316585_1000005318 335
478 3300032139 Ga0316580_10032249 Ga0316580_100322491 335
479 3300039447 Ga0436361_0962722 Ga0436361_0962722_3057_4073 335
480 3300042876 Ga0451577_0002812 Ga0451577_0002812_6097_7113 335
481 3300049576 Ga0501040_0000005 Ga0501040_0000005_30478_31497 335
482 3300049578 Ga0501042_0000156 Ga0501042_0000156_17699_18718 335
483 3300053139 Ga0500568_0003919 Ga0500568_0003919_1853_2878 336
484 3300049579 Ga0501043_0063642 Ga0501043_0063642_243_1262 339
485 3300053096 Ga0500641_0000270 Ga0500641_0000270_10169_11191 339
486 3300053119 Ga0500595_006524 Ga0500595_006524_41_1060 339
487 3300053134 Ga0500658_0034866 Ga0500658_0034866_729_1748 339
488 3300003215 JGI25153J46596_10000492 JGI25153J46596_100004926 340
489 3300003215 JGI25153J46596_10000624 JGI25153J46596_1000062411 340
490 3300005844 Ga0068862_100003861 Ga0068862_1000038611 340
491 3300025297 Ga0209758_1000169 Ga0209758_100016987 340
492 3300025303 Ga0209051_1018392 Ga0209051_10183923 340
493 3300025304 Ga0209257_1002268 Ga0209257_100226811 340
494 3300028380 Ga0268265_10002190 Ga0268265_1000219010 340
495 3300049581 Ga0501047_0071906 Ga0501047_0071906_1381_2418 340
496 3300049584 Ga0501068_0046090 Ga0501068_0046090_1549_2586 340
497 3300049589 Ga0501073_0032437 Ga0501073_0032437_747_1784 340
498 3300049742 Ga0501080_0120951 Ga0501080_0120951_1231_2268 340
499 3300049744 Ga0501083_0028135 Ga0501083_0028135_843_1880 340
500 3300049823 Ga0501044_0200627 Ga0501044_0200627_749_1774 340
501 3300053086 Ga0500578_0011893 Ga0500578_0011893_2505_3536 340
502 3300053093 Ga0500651_0004026 Ga0500651_0004026_6053_7075 340
503 3300053130 Ga0500642_0001055 Ga0500642_0001055_4877_5917 340
504 3300053142 Ga0500577_0007617 Ga0500577_0007617_1594_2616 340
505 3300053153 Ga0500616_0001361 Ga0500616_0001361_16386_17420 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00490

ALAD

Delta-aminolevulinic acid dehydratase

9

337

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c1h-assembly1.cif.gz_A the x-ray structure of chlorobium vibrioforme 5-aminolaevulinic acid dehydratase complexed with a diacid inhibitor 0.9788 17 337
1w54-assembly1.cif.gz_A stepwise introduction of a zinc binding site into porphobilinogen synthase from pseudomonas aeruginosa (mutation d139c) 0.9766 17 338
1w5m-assembly1.cif.gz_B stepwise introduction of zinc binding site into porphobilinogen synthase of pseudomonas aeruginosa (mutations a129c and d139c) 0.9765 13 338
1w5m-assembly1.cif.gz_A stepwise introduction of zinc binding site into porphobilinogen synthase of pseudomonas aeruginosa (mutations a129c and d139c) 0.9761 13 338
1gzg-assembly1.cif.gz_A complex of a mg2-dependent porphobilinogen synthase from pseudomonas aeruginosa (mutant d139n) with 5-fluorolevulinic acid 0.9759 13 338
ID Description Score Start End Superfamily
2c19A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.97 9 338 3.20.20.70
af_P9WMP5_2_329_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9688 11 337 3.20.20.70
1i8jA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9647 17 340 3.20.20.70
af_Q60178_5_334_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9612 12 336 3.20.20.70
af_P9WMP5_2_329_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9601 11 337 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A849TES1-F1-model_v4 Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) 0.9961 246 338 GO:0004655
GO:0005829
GO:0006782
GO:0008270
AF-A0A340XQS9-F1-model_v4 deleted 0.9926 61 287
AF-A0A6L4AB02-F1-model_v4 Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) 0.9908 235 338 GO:0004655
GO:0005829
GO:0006782
GO:0008270
AF-A0A1W1D7K8-F1-model_v4 porphobilinogen synthase (EC 4.2.1.24) (Porphobilinogen synthase) 0.9902 237 337 GO:0004655
GO:0005829
GO:0006782
GO:0008270
AF-A0A3C2C4A2-F1-model_v4 Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) 0.9899 235 339 GO:0004655
GO:0005829
GO:0006782
GO:0008270

Feature Viewer

pLDDT pTM Quality
91.22 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map