F456326
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 505 | 269 | 501 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100012083|Ga0068853_1000120834 |
| Length | 342 |
| Sequence | MKIAGRFPDTRMRRMRRDEFSRRLMRENRLTTDDLIYPCFVLDGKARAEPVESLPGIARKSIDLLLEEAHQCVLLGIPAIALFPVVPMPGKSDDAAEAWNPDGLVPRTIRALKEHFPDLGVITDVALDPYTSHGQDGLIDAADPTRYVLNEETIEALVKQALCHAEAGVDMVAPSDMMDGRIGAIRRALDRAGHQRVRILAYSAKYASNFYGPFRDAVGSAASLGGGVTSGNKYTYQMDPANGDEALREVHLDLDEGADMIMIKPGLPYLDIVRRVKETFGAPTAVYQVSGEYAMLKAATQNGWLDERAAVLEVLTSFKRAGADAILTYFAIAAARWLREDY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 2 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 3 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 165 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 166 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 167 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 171 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 172 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 173 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 174 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 190 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 194 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 195 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 196 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 197 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 198 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 199 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 200 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 201 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 204 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 260 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 261 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 262 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 263 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 264 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 265 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 269 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.97 |
| Nodule | 0 |
| Rhizoplane | 2.77 |
| Rhizosphere | 91.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000492 | 3300003215 | Bacteria | 25243 |
| 2 | JGI25153J46596_10000624 | 3300003215 | Bacteria | 21680 |
| 3 | Ga0070683_100003773 | 3300005329 | Bacteria | 12372 |
| 4 | Ga0070683_100017074 | 3300005329 | Bacteria | 6406 |
| 5 | Ga0070683_100044710 | 3300005329 | Bacteria | 4085 |
| 6 | Ga0070690_100001976 | 3300005330 | Bacteria | 10925 |
| 7 | Ga0070690_100018410 | 3300005330 | Bacteria | 4219 |
| 8 | Ga0070670_100038842 | 3300005331 | Bacteria | 4093 |
| 9 | Ga0070670_100120300 | 3300005331 | Bacteria | 2265 |
| 10 | Ga0070670_100200663 | 3300005331 | Bacteria | 1733 |
| 11 | Ga0070677_10075671 | 3300005333 | Bacteria | 1427 |
| 12 | Ga0068869_100047408 | 3300005334 | Bacteria | 3103 |
| 13 | Ga0070666_10000953 | 3300005335 | Bacteria | 17631 |
| 14 | Ga0070666_10014158 | 3300005335 | Bacteria | 5075 |
| 15 | Ga0070666_10030032 | 3300005335 | Bacteria | 3578 |
| 16 | Ga0070680_100124162 | 3300005336 | Bacteria | 2156 |
| 17 | Ga0068868_100068190 | 3300005338 | Bacteria | 2832 |
| 18 | Ga0068868_100080515 | 3300005338 | Bacteria | 2610 |
| 19 | Ga0068868_100127477 | 3300005338 | Bacteria | 2080 |
| 20 | Ga0070660_100060694 | 3300005339 | Bacteria | 2935 |
| 21 | Ga0070689_100002818 | 3300005340 | Bacteria | 11428 |
| 22 | Ga0070689_100003205 | 3300005340 | Bacteria | 10840 |
| 23 | Ga0070661_100002100 | 3300005344 | Bacteria | 13716 |
| 24 | Ga0070661_100026097 | 3300005344 | Bacteria | 4199 |
| 25 | Ga0070661_100292175 | 3300005344 | Bacteria | 1267 |
| 26 | Ga0070668_100010367 | 3300005347 | Bacteria | 6921 |
| 27 | Ga0070675_100205020 | 3300005354 | Bacteria | 1712 |
| 28 | Ga0070671_100035349 | 3300005355 | Bacteria | 4139 |
| 29 | Ga0070673_100002777 | 3300005364 | Bacteria | 10764 |
| 30 | Ga0070673_100045036 | 3300005364 | Bacteria | 3419 |
| 31 | Ga0070688_100000391 | 3300005365 | Bacteria | 22192 |
| 32 | Ga0070688_100002581 | 3300005365 | Bacteria | 9178 |
| 33 | Ga0070667_100092127 | 3300005367 | Bacteria | 2607 |
| 34 | Ga0070703_10066576 | 3300005406 | Bacteria | 1192 |
| 35 | Ga0070709_10007739 | 3300005434 | Bacteria | 5899 |
| 36 | Ga0070714_100011657 | 3300005435 | Bacteria | 6979 |
| 37 | Ga0070714_100020029 | 3300005435 | Bacteria | 5458 |
| 38 | Ga0070714_100046041 | 3300005435 | Bacteria | 3699 |
| 39 | Ga0070713_100268553 | 3300005436 | Bacteria | 1561 |
| 40 | Ga0070710_10004401 | 3300005437 | Bacteria | 6667 |
| 41 | Ga0070710_10049352 | 3300005437 | Bacteria | 2354 |
| 42 | Ga0070710_10166380 | 3300005437 | Bacteria | 1371 |
| 43 | Ga0070711_100200533 | 3300005439 | Bacteria | 1539 |
| 44 | Ga0070694_100014953 | 3300005444 | Bacteria | 4862 |
| 45 | Ga0070663_100017914 | 3300005455 | Bacteria | 4631 |
| 46 | Ga0070663_100033468 | 3300005455 | Bacteria | 3551 |
| 47 | Ga0070678_100002681 | 3300005456 | Bacteria | 9811 |
| 48 | Ga0070678_100171473 | 3300005456 | Bacteria | 1768 |
| 49 | Ga0070662_100017183 | 3300005457 | Bacteria | 4870 |
| 50 | Ga0070662_100022041 | 3300005457 | Bacteria | 4356 |
| 51 | Ga0070662_100047556 | 3300005457 | Bacteria | 3086 |
| 52 | Ga0070681_10044844 | 3300005458 | Bacteria | 4427 |
| 53 | Ga0070681_10100219 | 3300005458 | Bacteria | 2843 |
| 54 | Ga0068867_100013472 | 3300005459 | Bacteria | 5793 |
| 55 | Ga0070685_10015530 | 3300005466 | Bacteria | 4045 |
| 56 | Ga0070706_100147529 | 3300005467 | Bacteria | 2196 |
| 57 | Ga0070707_100024507 | 3300005468 | Bacteria | 5715 |
| 58 | Ga0070707_100059284 | 3300005468 | Bacteria | 3672 |
| 59 | Ga0070698_100110784 | 3300005471 | Bacteria | 2710 |
| 60 | Ga0070699_100020992 | 3300005518 | Bacteria | 5630 |
| 61 | Ga0070679_100087660 | 3300005530 | Bacteria | 3099 |
| 62 | Ga0070679_100223892 | 3300005530 | Bacteria | 1841 |
| 63 | Ga0070679_100300459 | 3300005530 | Bacteria | 1556 |
| 64 | Ga0070679_100428221 | 3300005530 | Bacteria | 1268 |
| 65 | Ga0070684_100002389 | 3300005535 | Bacteria | 13833 |
| 66 | Ga0070684_100025550 | 3300005535 | Bacteria | 4966 |
| 67 | Ga0070684_100042329 | 3300005535 | Bacteria | 3931 |
| 68 | Ga0070684_100204338 | 3300005535 | Bacteria | 1800 |
| 69 | Ga0070697_100007297 | 3300005536 | Bacteria | 8598 |
| 70 | Ga0070697_100010158 | 3300005536 | Bacteria | 7345 |
| 71 | Ga0068853_100012083 | 3300005539 | Bacteria | 7025 |
| 72 | Ga0068853_100045310 | 3300005539 | Bacteria | 3766 |
| 73 | Ga0068853_100050816 | 3300005539 | Bacteria | 3566 |
| 74 | Ga0068853_100140296 | 3300005539 | Bacteria | 2169 |
| 75 | Ga0068853_100257092 | 3300005539 | Bacteria | 1604 |
| 76 | Ga0070672_100053344 | 3300005543 | Bacteria | 3161 |
| 77 | Ga0070672_100115806 | 3300005543 | Bacteria | 2189 |
| 78 | Ga0070693_100012260 | 3300005547 | Bacteria | 4335 |
| 79 | Ga0070665_100000500 | 3300005548 | Bacteria | 56157 |
| 80 | Ga0070665_100003582 | 3300005548 | Bacteria | 16453 |
| 81 | Ga0070665_100152867 | 3300005548 | Bacteria | 2310 |
| 82 | Ga0070704_100021784 | 3300005549 | Bacteria | 4160 |
| 83 | Ga0068855_100022596 | 3300005563 | Bacteria | 7537 |
| 84 | Ga0068855_100063378 | 3300005563 | Bacteria | 4314 |
| 85 | Ga0068855_100093898 | 3300005563 | Bacteria | 3460 |
| 86 | Ga0070664_100002891 | 3300005564 | Bacteria | 13902 |
| 87 | Ga0070664_100040926 | 3300005564 | Bacteria | 3909 |
| 88 | Ga0070664_100100771 | 3300005564 | Bacteria | 2511 |
| 89 | Ga0068857_100056366 | 3300005577 | Bacteria | 3487 |
| 90 | Ga0068854_100001870 | 3300005578 | Bacteria | 12831 |
| 91 | Ga0068854_100002838 | 3300005578 | Bacteria | 10760 |
| 92 | Ga0068854_100004550 | 3300005578 | Bacteria | 8749 |
| 93 | Ga0068854_100027454 | 3300005578 | Bacteria | 3924 |
| 94 | Ga0068856_100006058 | 3300005614 | Bacteria | 11883 |
| 95 | Ga0068856_100125603 | 3300005614 | Bacteria | 2569 |
| 96 | Ga0068856_100226145 | 3300005614 | Bacteria | 1886 |
| 97 | Ga0070702_100148354 | 3300005615 | Bacteria | 1502 |
| 98 | Ga0068852_100014257 | 3300005616 | Bacteria | 6110 |
| 99 | Ga0068852_100185005 | 3300005616 | Bacteria | 1961 |
| 100 | Ga0068852_100186355 | 3300005616 | Bacteria | 1955 |
| 101 | Ga0068859_100003236 | 3300005617 | Bacteria | 16579 |
| 102 | Ga0068859_100021624 | 3300005617 | Bacteria | 6455 |
| 103 | Ga0068864_100001480 | 3300005618 | Bacteria | 19352 |
| 104 | Ga0068864_100027559 | 3300005618 | Bacteria | 4799 |
| 105 | Ga0068864_100400311 | 3300005618 | Bacteria | 1304 |
| 106 | Ga0068866_10001308 | 3300005718 | Bacteria | 10792 |
| 107 | Ga0068866_10021490 | 3300005718 | Bacteria | 2973 |
| 108 | Ga0068851_10002512 | 3300005834 | Bacteria | 8064 |
| 109 | Ga0068851_10002553 | 3300005834 | Bacteria | 8012 |
| 110 | Ga0068863_100002303 | 3300005841 | Bacteria | 18979 |
| 111 | Ga0068863_100003508 | 3300005841 | Bacteria | 15478 |
| 112 | Ga0068863_100118109 | 3300005841 | Bacteria | 2527 |
| 113 | Ga0068863_100225043 | 3300005841 | Bacteria | 1808 |
| 114 | Ga0068858_100004483 | 3300005842 | Bacteria | 13689 |
| 115 | Ga0068858_100009965 | 3300005842 | Bacteria | 9024 |
| 116 | Ga0068858_100120062 | 3300005842 | Bacteria | 2458 |
| 117 | Ga0068860_100017042 | 3300005843 | Bacteria | 7081 |
| 118 | Ga0068860_100083826 | 3300005843 | Bacteria | 3032 |
| 119 | Ga0068860_100128871 | 3300005843 | Bacteria | 2426 |
| 120 | Ga0068862_100003861 | 3300005844 | Bacteria | 12759 |
| 121 | Ga0068862_100048679 | 3300005844 | Bacteria | 3619 |
| 122 | Ga0068862_100060726 | 3300005844 | Bacteria | 3248 |
| 123 | Ga0068862_100075280 | 3300005844 | Bacteria | 2920 |
| 124 | Ga0068862_100151654 | 3300005844 | Bacteria | 2063 |
| 125 | Ga0070717_10154501 | 3300006028 | Bacteria | 1987 |
| 126 | Ga0070712_100010690 | 3300006175 | Bacteria | 5797 |
| 127 | Ga0097621_100136104 | 3300006237 | Bacteria | 2096 |
| 128 | Ga0097621_100147204 | 3300006237 | Bacteria | 2017 |
| 129 | Ga0097621_100402628 | 3300006237 | Bacteria | 1225 |
| 130 | Ga0068871_100005265 | 3300006358 | Bacteria | 9057 |
| 131 | Ga0068871_100074127 | 3300006358 | Bacteria | 2807 |
| 132 | Ga0068871_100137736 | 3300006358 | Bacteria | 2074 |
| 133 | Ga0068871_100144916 | 3300006358 | Bacteria | 2021 |
| 134 | Ga0068871_100177312 | 3300006358 | Bacteria | 1830 |
| 135 | Ga0075428_100066124 | 3300006844 | Bacteria | 3959 |
| 136 | Ga0075434_100079228 | 3300006871 | Bacteria | 3281 |
| 137 | Ga0075434_100398151 | 3300006871 | Bacteria | 1398 |
| 138 | Ga0068865_100022190 | 3300006881 | Bacteria | 4137 |
| 139 | Ga0068865_100028384 | 3300006881 | Bacteria | 3704 |
| 140 | Ga0068865_100045419 | 3300006881 | Bacteria | 3011 |
| 141 | Ga0075436_100259558 | 3300006914 | Bacteria | 1239 |
| 142 | Ga0097620_100003236 | 3300006931 | Bacteria | 16579 |
| 143 | Ga0097620_100021624 | 3300006931 | Bacteria | 6455 |
| 144 | Ga0075435_100004989 | 3300007076 | Bacteria | 9212 |
| 145 | Ga0105240_10000196 | 3300009093 | Bacteria | 123276 |
| 146 | Ga0105240_10013319 | 3300009093 | Bacteria | 11304 |
| 147 | Ga0105240_10019737 | 3300009093 | Bacteria | 9004 |
| 148 | Ga0105240_10029644 | 3300009093 | Bacteria | 7124 |
| 149 | Ga0105240_10049857 | 3300009093 | Bacteria | 5281 |
| 150 | Ga0105240_10058730 | 3300009093 | Bacteria | 4801 |
| 151 | Ga0105240_10081793 | 3300009093 | Bacteria | 3967 |
| 152 | Ga0105240_10083233 | 3300009093 | Bacteria | 3927 |
| 153 | Ga0105245_10117407 | 3300009098 | Bacteria | 2482 |
| 154 | Ga0105245_10134877 | 3300009098 | Bacteria | 2319 |
| 155 | Ga0105247_10043783 | 3300009101 | Bacteria | 2743 |
| 156 | Ga0105241_10039536 | 3300009174 | Bacteria | 3558 |
| 157 | Ga0105241_10208900 | 3300009174 | Bacteria | 1635 |
| 158 | Ga0105242_10057368 | 3300009176 | Bacteria | 3189 |
| 159 | Ga0105248_10015684 | 3300009177 | Bacteria | 8350 |
| 160 | Ga0105248_10227902 | 3300009177 | Bacteria | 2097 |
| 161 | Ga0105248_10259426 | 3300009177 | Bacteria | 1956 |
| 162 | Ga0105248_10384697 | 3300009177 | Bacteria | 1580 |
| 163 | Ga0105237_10009184 | 3300009545 | Bacteria | 10614 |
| 164 | Ga0105237_10057965 | 3300009545 | Bacteria | 3876 |
| 165 | Ga0105238_10018871 | 3300009551 | Bacteria | 7021 |
| 166 | Ga0105238_10021424 | 3300009551 | Bacteria | 6583 |
| 167 | Ga0105238_10091162 | 3300009551 | Bacteria | 3035 |
| 168 | Ga0105238_10095202 | 3300009551 | Bacteria | 2965 |
| 169 | Ga0105239_10001780 | 3300010375 | Bacteria | 28338 |
| 170 | Ga0105239_10005029 | 3300010375 | Bacteria | 15613 |
| 171 | Ga0105239_10007054 | 3300010375 | Bacteria | 12931 |
| 172 | Ga0105239_10038663 | 3300010375 | Bacteria | 5229 |
| 173 | Ga0105239_10105015 | 3300010375 | Bacteria | 3128 |
| 174 | Ga0105239_10189928 | 3300010375 | Bacteria | 2299 |
| 175 | Ga0105246_10104806 | 3300011119 | Bacteria | 2066 |
| 176 | Ga0157373_10017035 | 3300013100 | Bacteria | 5291 |
| 177 | Ga0157373_10122571 | 3300013100 | Bacteria | 1827 |
| 178 | Ga0157373_10133627 | 3300013100 | Bacteria | 1744 |
| 179 | Ga0157371_10010442 | 3300013102 | Bacteria | 7235 |
| 180 | Ga0157370_10044444 | 3300013104 | Bacteria | 4270 |
| 181 | Ga0157370_10062340 | 3300013104 | Bacteria | 3536 |
| 182 | Ga0157370_10100152 | 3300013104 | Bacteria | 2715 |
| 183 | Ga0157370_10179688 | 3300013104 | Bacteria | 1966 |
| 184 | Ga0157370_10188472 | 3300013104 | Bacteria | 1915 |
| 185 | Ga0157369_10013085 | 3300013105 | Bacteria | 9392 |
| 186 | Ga0157369_10021113 | 3300013105 | Bacteria | 7279 |
| 187 | Ga0157374_10000127 | 3300013296 | Bacteria | 69890 |
| 188 | Ga0157374_10000922 | 3300013296 | Bacteria | 25588 |
| 189 | Ga0157374_10029101 | 3300013296 | Bacteria | 4997 |
| 190 | Ga0157378_10009053 | 3300013297 | Bacteria | 8665 |
| 191 | Ga0157378_10030194 | 3300013297 | Bacteria | 4789 |
| 192 | Ga0157378_10092120 | 3300013297 | Bacteria | 2757 |
| 193 | Ga0157378_10104490 | 3300013297 | Bacteria | 2589 |
| 194 | Ga0163162_10000061 | 3300013306 | Bacteria | 106351 |
| 195 | Ga0163162_10025348 | 3300013306 | Bacteria | 5859 |
| 196 | Ga0163162_10056092 | 3300013306 | Bacteria | 3968 |
| 197 | Ga0163162_10069928 | 3300013306 | Bacteria | 3562 |
| 198 | Ga0157372_10000822 | 3300013307 | Bacteria | 33604 |
| 199 | Ga0157372_10025500 | 3300013307 | Bacteria | 6430 |
| 200 | Ga0157372_10061152 | 3300013307 | Bacteria | 4216 |
| 201 | Ga0163163_10000166 | 3300014325 | Bacteria | 69030 |
| 202 | Ga0163163_10008748 | 3300014325 | Bacteria | 9007 |
| 203 | Ga0157377_10022831 | 3300014745 | Bacteria | 3309 |
| 204 | Ga0157379_10004862 | 3300014968 | Bacteria | 11538 |
| 205 | Ga0157379_10016112 | 3300014968 | Bacteria | 6574 |
| 206 | Ga0157376_10080383 | 3300014969 | Bacteria | 2796 |
| 207 | Ga0157376_10218381 | 3300014969 | Bacteria | 1764 |
| 208 | Ga0213872_10061799 | 3300021361 | Bacteria | 1693 |
| 209 | Ga0209233_1000930 | 3300025261 | Bacteria | 12751 |
| 210 | Ga0209758_1000169 | 3300025297 | Bacteria | 149782 |
| 211 | Ga0209051_1018392 | 3300025303 | Bacteria | 3093 |
| 212 | Ga0209257_1002268 | 3300025304 | Bacteria | 19622 |
| 213 | Ga0207656_10000819 | 3300025321 | Bacteria | 10142 |
| 214 | Ga0207656_10055598 | 3300025321 | Bacteria | 1723 |
| 215 | Ga0207713_1030216 | 3300025735 | Bacteria | 2415 |
| 216 | Ga0207692_10038162 | 3300025898 | Bacteria | 2355 |
| 217 | Ga0207692_10070559 | 3300025898 | Bacteria | 1839 |
| 218 | Ga0207692_10113070 | 3300025898 | Bacteria | 1508 |
| 219 | Ga0207642_10010089 | 3300025899 | Bacteria | 3313 |
| 220 | Ga0207680_10005524 | 3300025903 | Bacteria | 6041 |
| 221 | Ga0207647_10000277 | 3300025904 | Bacteria | 41661 |
| 222 | Ga0207647_10001196 | 3300025904 | Bacteria | 19992 |
| 223 | Ga0207699_10005933 | 3300025906 | Bacteria | 5876 |
| 224 | Ga0207699_10029168 | 3300025906 | Bacteria | 3074 |
| 225 | Ga0207699_10177840 | 3300025906 | Bacteria | 1428 |
| 226 | Ga0207699_10238786 | 3300025906 | Bacteria | 1248 |
| 227 | Ga0207645_10088484 | 3300025907 | Bacteria | 1991 |
| 228 | Ga0207643_10011302 | 3300025908 | Bacteria | 4821 |
| 229 | Ga0207705_10174346 | 3300025909 | Bacteria | 1620 |
| 230 | Ga0207684_10029143 | 3300025910 | Bacteria | 4702 |
| 231 | Ga0207654_10066653 | 3300025911 | Bacteria | 2124 |
| 232 | Ga0207654_10070124 | 3300025911 | Bacteria | 2080 |
| 233 | Ga0207707_10002828 | 3300025912 | Bacteria | 15472 |
| 234 | Ga0207707_10023500 | 3300025912 | Bacteria | 5392 |
| 235 | Ga0207707_10231711 | 3300025912 | Bacteria | 1607 |
| 236 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 237 | Ga0207695_10000271 | 3300025913 | Bacteria | 129900 |
| 238 | Ga0207695_10000554 | 3300025913 | Bacteria | 76895 |
| 239 | Ga0207695_10013099 | 3300025913 | Bacteria | 9900 |
| 240 | Ga0207695_10023565 | 3300025913 | Bacteria | 6949 |
| 241 | Ga0207671_10007196 | 3300025914 | Bacteria | 9697 |
| 242 | Ga0207671_10019252 | 3300025914 | Bacteria | 5223 |
| 243 | Ga0207671_10025050 | 3300025914 | Bacteria | 4483 |
| 244 | Ga0207671_10088409 | 3300025914 | Bacteria | 2331 |
| 245 | Ga0207671_10226768 | 3300025914 | Bacteria | 1465 |
| 246 | Ga0207671_10272923 | 3300025914 | Bacteria | 1332 |
| 247 | Ga0207693_10055062 | 3300025915 | Bacteria | 3121 |
| 248 | Ga0207693_10125258 | 3300025915 | Bacteria | 2019 |
| 249 | Ga0207663_10017301 | 3300025916 | Bacteria | 4013 |
| 250 | Ga0207663_10049863 | 3300025916 | Bacteria | 2599 |
| 251 | Ga0207663_10161653 | 3300025916 | Bacteria | 1581 |
| 252 | Ga0207657_10000258 | 3300025919 | Bacteria | 56256 |
| 253 | Ga0207657_10002002 | 3300025919 | Bacteria | 22017 |
| 254 | Ga0207657_10013571 | 3300025919 | Bacteria | 7992 |
| 255 | Ga0207649_10010017 | 3300025920 | Bacteria | 5198 |
| 256 | Ga0207649_10110393 | 3300025920 | Bacteria | 1836 |
| 257 | Ga0207649_10141242 | 3300025920 | Bacteria | 1648 |
| 258 | Ga0207652_10033685 | 3300025921 | Bacteria | 4314 |
| 259 | Ga0207646_10005024 | 3300025922 | Bacteria | 14083 |
| 260 | Ga0207646_10254288 | 3300025922 | Bacteria | 1587 |
| 261 | Ga0207681_10057436 | 3300025923 | Bacteria | 2660 |
| 262 | Ga0207694_10001531 | 3300025924 | Bacteria | 19673 |
| 263 | Ga0207650_10039382 | 3300025925 | Bacteria | 3455 |
| 264 | Ga0207659_10287396 | 3300025926 | Bacteria | 1346 |
| 265 | Ga0207687_10005040 | 3300025927 | Bacteria | 8744 |
| 266 | Ga0207687_10106189 | 3300025927 | Bacteria | 2076 |
| 267 | Ga0207700_10075988 | 3300025928 | Bacteria | 2605 |
| 268 | Ga0207664_10003464 | 3300025929 | Bacteria | 10524 |
| 269 | Ga0207664_10005531 | 3300025929 | Bacteria | 8648 |
| 270 | Ga0207664_10114967 | 3300025929 | Bacteria | 2243 |
| 271 | Ga0207644_10034298 | 3300025931 | Bacteria | 3550 |
| 272 | Ga0207706_10000792 | 3300025933 | Bacteria | 32696 |
| 273 | Ga0207706_10004354 | 3300025933 | Bacteria | 13299 |
| 274 | Ga0207706_10026328 | 3300025933 | Bacteria | 5206 |
| 275 | Ga0207706_10037181 | 3300025933 | Bacteria | 4323 |
| 276 | Ga0207670_10005050 | 3300025936 | Bacteria | 7195 |
| 277 | Ga0207704_10018150 | 3300025938 | Bacteria | 3666 |
| 278 | Ga0207704_10051413 | 3300025938 | Bacteria | 2492 |
| 279 | Ga0207704_10093272 | 3300025938 | Bacteria | 1984 |
| 280 | Ga0207665_10124638 | 3300025939 | Bacteria | 1823 |
| 281 | Ga0207691_10012494 | 3300025940 | Bacteria | 8143 |
| 282 | Ga0207711_10000087 | 3300025941 | Bacteria | 98302 |
| 283 | Ga0207711_10233636 | 3300025941 | Bacteria | 1684 |
| 284 | Ga0207711_10364277 | 3300025941 | Bacteria | 1340 |
| 285 | Ga0207689_10010154 | 3300025942 | Bacteria | 8114 |
| 286 | Ga0207689_10067477 | 3300025942 | Bacteria | 2939 |
| 287 | Ga0207689_10126462 | 3300025942 | Bacteria | 2103 |
| 288 | Ga0207689_10204167 | 3300025942 | Bacteria | 1632 |
| 289 | Ga0207661_10257907 | 3300025944 | Bacteria | 1552 |
| 290 | Ga0207679_10034308 | 3300025945 | Bacteria | 3578 |
| 291 | Ga0207679_10100106 | 3300025945 | Bacteria | 2264 |
| 292 | Ga0207679_10276974 | 3300025945 | Bacteria | 1437 |
| 293 | Ga0207667_10002136 | 3300025949 | Bacteria | 24781 |
| 294 | Ga0207667_10052079 | 3300025949 | Bacteria | 4313 |
| 295 | Ga0207667_10064737 | 3300025949 | Bacteria | 3815 |
| 296 | Ga0207651_10009898 | 3300025960 | Bacteria | 5248 |
| 297 | Ga0207651_10230400 | 3300025960 | Bacteria | 1503 |
| 298 | Ga0207712_10000168 | 3300025961 | Bacteria | 67505 |
| 299 | Ga0207668_10035920 | 3300025972 | Bacteria | 3305 |
| 300 | Ga0207640_10033832 | 3300025981 | Bacteria | 3184 |
| 301 | Ga0207640_10346834 | 3300025981 | Bacteria | 1191 |
| 302 | Ga0207658_10027527 | 3300025986 | Bacteria | 3994 |
| 303 | Ga0207658_10092499 | 3300025986 | Bacteria | 2349 |
| 304 | Ga0207658_10307672 | 3300025986 | Bacteria | 1368 |
| 305 | Ga0207677_10003044 | 3300026023 | Bacteria | 8866 |
| 306 | Ga0207677_10325297 | 3300026023 | Bacteria | 1279 |
| 307 | Ga0207703_10000194 | 3300026035 | Bacteria | 70509 |
| 308 | Ga0207703_10000522 | 3300026035 | Bacteria | 39489 |
| 309 | Ga0207703_10022991 | 3300026035 | Bacteria | 4894 |
| 310 | Ga0207703_10028086 | 3300026035 | Bacteria | 4431 |
| 311 | Ga0207703_10033977 | 3300026035 | Bacteria | 4045 |
| 312 | Ga0207639_10000218 | 3300026041 | Bacteria | 42765 |
| 313 | Ga0207639_10019751 | 3300026041 | Bacteria | 4811 |
| 314 | Ga0207639_10176427 | 3300026041 | Bacteria | 1814 |
| 315 | Ga0207678_10010597 | 3300026067 | Bacteria | 8099 |
| 316 | Ga0207678_10012550 | 3300026067 | Bacteria | 7443 |
| 317 | Ga0207678_10014155 | 3300026067 | Bacteria | 7012 |
| 318 | Ga0207678_10069350 | 3300026067 | Bacteria | 3023 |
| 319 | Ga0207678_10256621 | 3300026067 | Bacteria | 1498 |
| 320 | Ga0207702_10006391 | 3300026078 | Bacteria | 10169 |
| 321 | Ga0207702_10022768 | 3300026078 | Bacteria | 5197 |
| 322 | Ga0207702_10027813 | 3300026078 | Bacteria | 4697 |
| 323 | Ga0207702_10092971 | 3300026078 | Bacteria | 2644 |
| 324 | Ga0207641_10016815 | 3300026088 | Bacteria | 5989 |
| 325 | Ga0207641_10061619 | 3300026088 | Bacteria | 3200 |
| 326 | Ga0207641_10305411 | 3300026088 | Bacteria | 1504 |
| 327 | Ga0207676_10000140 | 3300026095 | Bacteria | 62993 |
| 328 | Ga0207676_10024476 | 3300026095 | Bacteria | 4467 |
| 329 | Ga0207674_10000429 | 3300026116 | Bacteria | 54858 |
| 330 | Ga0207674_10013722 | 3300026116 | Bacteria | 8969 |
| 331 | Ga0207674_10043728 | 3300026116 | Bacteria | 4618 |
| 332 | Ga0207683_10000717 | 3300026121 | Bacteria | 30124 |
| 333 | Ga0207698_10001159 | 3300026142 | Bacteria | 15352 |
| 334 | Ga0207698_10043803 | 3300026142 | Bacteria | 3356 |
| 335 | Ga0207698_10159856 | 3300026142 | Bacteria | 1969 |
| 336 | Ga0209969_1011648 | 3300027360 | Bacteria | 1265 |
| 337 | Ga0209971_1005698 | 3300027682 | Bacteria | 2951 |
| 338 | Ga0209974_10000642 | 3300027876 | Bacteria | 11791 |
| 339 | Ga0209974_10009412 | 3300027876 | Bacteria | 3315 |
| 340 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 341 | Ga0268265_10002190 | 3300028380 | Bacteria | 15082 |
| 342 | Ga0268265_10054312 | 3300028380 | Bacteria | 3039 |
| 343 | Ga0268265_10059918 | 3300028380 | Bacteria | 2915 |
| 344 | Ga0268264_10042390 | 3300028381 | Bacteria | 3767 |
| 345 | Ga0265334_10004878 | 3300028573 | Bacteria | 5898 |
| 346 | Ga0265338_10011128 | 3300028800 | Bacteria | 10430 |
| 347 | Ga0268256_1011030 | 3300030500 | Bacteria | 2894 |
| 348 | Ga0265327_10017906 | 3300031251 | Bacteria | 4418 |
| 349 | Ga0265313_10002274 | 3300031595 | Bacteria | 16848 |
| 350 | Ga0316575_10004094 | 3300031665 | Bacteria | 5112 |
| 351 | Ga0316575_10019443 | 3300031665 | Bacteria | 2597 |
| 352 | Ga0316575_10056301 | 3300031665 | Bacteria | 1566 |
| 353 | Ga0316575_10060985 | 3300031665 | Bacteria | 1507 |
| 354 | Ga0316579_10002057 | 3300031691 | Bacteria | 7540 |
| 355 | Ga0316579_10096420 | 3300031691 | Bacteria | 1414 |
| 356 | Ga0316576_10031081 | 3300031727 | Bacteria | 3787 |
| 357 | Ga0316576_10056263 | 3300031727 | Bacteria | 2872 |
| 358 | Ga0316578_10027773 | 3300031728 | Bacteria | 3200 |
| 359 | Ga0316578_10096449 | 3300031728 | Bacteria | 1770 |
| 360 | Ga0307409_100145499 | 3300031995 | Bacteria | 2049 |
| 361 | Ga0307414_10079148 | 3300032004 | Bacteria | 2398 |
| 362 | Ga0316583_10004127 | 3300032133 | Bacteria | 5165 |
| 363 | Ga0316583_10009697 | 3300032133 | Bacteria | 3470 |
| 364 | Ga0316585_10000053 | 3300032137 | Bacteria | 18633 |
| 365 | Ga0316580_10032249 | 3300032139 | Bacteria | 1622 |
| 366 | Ga0307507_10055672 | 3300033179 | Bacteria | 3746 |
| 367 | Ga0316587_1014579 | 3300033529 | Bacteria | 1297 |
| 368 | Ga0373934_0009608 | 3300035086 | Bacteria | 3626 |
| 369 | Ga0373923_0065437 | 3300035111 | Bacteria | 1551 |
| 370 | Ga0373945_0016593 | 3300035116 | Bacteria | 2485 |
| 371 | Ga0373954_0031283 | 3300035118 | Bacteria | 2456 |
| 372 | Ga0373956_0019961 | 3300035119 | Bacteria | 2846 |
| 373 | Ga0373957_0003466 | 3300035120 | Bacteria | 4664 |
| 374 | Ga0373946_0108356 | 3300035171 | Bacteria | 1254 |
| 375 | Ga0373955_0003437 | 3300035172 | Bacteria | 6960 |
| 376 | Ga0316574_0001169 | 3300035398 | Bacteria | 12129 |
| 377 | Ga0316574_0015011 | 3300035398 | Bacteria | 4487 |
| 378 | Ga0316574_0019747 | 3300035398 | Bacteria | 3980 |
| 379 | Ga0316574_0034199 | 3300035398 | Bacteria | 3097 |
| 380 | Ga0316574_0038057 | 3300035398 | Bacteria | 2952 |
| 381 | Ga0316574_0056040 | 3300035398 | Bacteria | 2465 |
| 382 | Ga0316574_0083474 | 3300035398 | Bacteria | 2031 |
| 383 | Ga0373924_0008014 | 3300035410 | Bacteria | 3823 |
| 384 | Ga0373931_0071543 | 3300035691 | Bacteria | 1895 |
| 385 | Ga0373927_0021524 | 3300035695 | Bacteria | 4227 |
| 386 | Ga0373927_0099144 | 3300035695 | Bacteria | 1894 |
| 387 | Ga0373933_0135642 | 3300035724 | Bacteria | 1550 |
| 388 | Ga0373937_0070392 | 3300036401 | Bacteria | 3226 |
| 389 | Ga0316582_0002176 | 3300036647 | Bacteria | 9093 |
| 390 | Ga0316582_0007417 | 3300036647 | Bacteria | 5834 |
| 391 | Ga0316582_0009716 | 3300036647 | Bacteria | 5232 |
| 392 | Ga0316582_0015688 | 3300036647 | Bacteria | 4342 |
| 393 | Ga0316584_0041153 | 3300036712 | Bacteria | 3445 |
| 394 | Ga0316584_0187146 | 3300036712 | Bacteria | 1531 |
| 395 | Ga0373925_0028363 | 3300037068 | Bacteria | 4101 |
| 396 | Ga0373925_0138625 | 3300037068 | Bacteria | 1902 |
| 397 | Ga0395901_0453599 | 3300038443 | Bacteria | 1311 |
| 398 | Ga0400484_43797 | 3300038725 | Bacteria | 5009 |
| 399 | Ga0400490_15683 | 3300038726 | Bacteria | 5070 |
| 400 | Ga0400490_45494 | 3300038726 | Bacteria | 40576 |
| 401 | Ga0400491_29664 | 3300038727 | Bacteria | 3309 |
| 402 | Ga0400488_50269 | 3300038741 | Bacteria | 1608 |
| 403 | Ga0400486_16325 | 3300038742 | Bacteria | 3227 |
| 404 | Ga0400483_066104 | 3300039062 | Bacteria | 1722 |
| 405 | Ga0400483_161823 | 3300039062 | Bacteria | 2580 |
| 406 | Ga0400487_66289 | 3300039110 | Bacteria | 57838 |
| 407 | Ga0436361_0962722 | 3300039447 | Bacteria | 4784 |
| 408 | Ga0439446_0012949 | 3300042156 | Bacteria | 2283 |
| 409 | Ga0439434_0025434 | 3300042435 | Bacteria | 1786 |
| 410 | Ga0439435_0000327 | 3300042436 | Bacteria | 7177 |
| 411 | Ga0450918_009064 | 3300042531 | Bacteria | 1746 |
| 412 | Ga0451577_0002624 | 3300042876 | Bacteria | 21065 |
| 413 | Ga0451577_0002812 | 3300042876 | Bacteria | 20062 |
| 414 | Ga0453684_0546987 | 3300044712 | Bacteria | 1276 |
| 415 | Ga0495603_0030735 | 3300046455 | Bacteria | 3235 |
| 416 | Ga0495662_0119880 | 3300046476 | Bacteria | 1291 |
| 417 | Ga0495664_0081349 | 3300046477 | Bacteria | 1942 |
| 418 | Ga0495648_0005997 | 3300046524 | Bacteria | 9985 |
| 419 | Ga0495663_0001763 | 3300046525 | Bacteria | 6708 |
| 420 | Ga0495645_0089689 | 3300046543 | Bacteria | 2198 |
| 421 | Ga0495588_0134787 | 3300046674 | Bacteria | 1303 |
| 422 | Ga0495623_0042829 | 3300046679 | Bacteria | 2882 |
| 423 | Ga0496103_0100451 | 3300048906 | Bacteria | 1831 |
| 424 | Ga0496103_0205086 | 3300048906 | Bacteria | 1268 |
| 425 | Ga0496104_0004559 | 3300048907 | Bacteria | 12076 |
| 426 | Ga0496106_0184025 | 3300048909 | Bacteria | 1659 |
| 427 | Ga0496106_0246983 | 3300048909 | Bacteria | 1426 |
| 428 | Ga0496107_0096247 | 3300048910 | Bacteria | 2166 |
| 429 | Ga0496109_0008584 | 3300048912 | Bacteria | 8695 |
| 430 | Ga0496110_0125556 | 3300048913 | Bacteria | 2315 |
| 431 | Ga0496111_0290658 | 3300048914 | Bacteria | 1212 |
| 432 | Ga0496112_0003465 | 3300048915 | Bacteria | 13044 |
| 433 | Ga0496112_0048405 | 3300048915 | Bacteria | 4168 |
| 434 | Ga0496112_0200712 | 3300048915 | Bacteria | 1954 |
| 435 | Ga0496114_0004669 | 3300048917 | Bacteria | 10648 |
| 436 | Ga0496115_0211148 | 3300048918 | Bacteria | 1603 |
| 437 | Ga0496118_0017687 | 3300048921 | Bacteria | 6473 |
| 438 | Ga0501031_0114248 | 3300049568 | Bacteria | 1763 |
| 439 | Ga0501032_0034055 | 3300049569 | Bacteria | 3488 |
| 440 | Ga0501033_0143909 | 3300049570 | Bacteria | 1723 |
| 441 | Ga0501034_0012647 | 3300049571 | Bacteria | 8708 |
| 442 | Ga0501036_0070959 | 3300049572 | Bacteria | 2946 |
| 443 | Ga0501037_0003749 | 3300049573 | Bacteria | 11030 |
| 444 | Ga0501037_0022614 | 3300049573 | Bacteria | 4649 |
| 445 | Ga0501038_0061754 | 3300049574 | Bacteria | 3204 |
| 446 | Ga0501038_0167837 | 3300049574 | Bacteria | 1779 |
| 447 | Ga0501039_0057449 | 3300049575 | Bacteria | 3013 |
| 448 | Ga0501039_0309866 | 3300049575 | Bacteria | 1241 |
| 449 | Ga0501040_0000005 | 3300049576 | Bacteria | 99976 |
| 450 | Ga0501040_0127160 | 3300049576 | Bacteria | 1790 |
| 451 | Ga0501041_0006345 | 3300049577 | Bacteria | 6919 |
| 452 | Ga0501041_0105801 | 3300049577 | Bacteria | 1744 |
| 453 | Ga0501042_0000156 | 3300049578 | Bacteria | 30727 |
| 454 | Ga0501042_0003945 | 3300049578 | Bacteria | 9389 |
| 455 | Ga0501042_0133705 | 3300049578 | Bacteria | 1788 |
| 456 | Ga0501043_0002645 | 3300049579 | Bacteria | 15061 |
| 457 | Ga0501043_0016348 | 3300049579 | Bacteria | 5820 |
| 458 | Ga0501043_0063642 | 3300049579 | Bacteria | 2897 |
| 459 | Ga0501046_0007052 | 3300049580 | Bacteria | 9898 |
| 460 | Ga0501046_0015573 | 3300049580 | Bacteria | 6387 |
| 461 | Ga0501047_0071906 | 3300049581 | Bacteria | 3329 |
| 462 | Ga0501047_0451552 | 3300049581 | Bacteria | 1115 |
| 463 | Ga0501048_0017341 | 3300049582 | Bacteria | 5306 |
| 464 | Ga0501068_0046090 | 3300049584 | Bacteria | 2628 |
| 465 | Ga0501068_0047317 | 3300049584 | Bacteria | 2595 |
| 466 | Ga0501069_0030302 | 3300049585 | Bacteria | 2971 |
| 467 | Ga0501070_0035023 | 3300049586 | Bacteria | 4196 |
| 468 | Ga0501071_0013135 | 3300049587 | Bacteria | 5637 |
| 469 | Ga0501072_0006441 | 3300049588 | Bacteria | 8939 |
| 470 | Ga0501073_0032437 | 3300049589 | Bacteria | 3723 |
| 471 | Ga0501073_0263334 | 3300049589 | Bacteria | 1190 |
| 472 | Ga0501074_0003015 | 3300049590 | Bacteria | 11859 |
| 473 | Ga0501074_0051446 | 3300049590 | Bacteria | 2973 |
| 474 | Ga0501074_0286382 | 3300049590 | Bacteria | 1171 |
| 475 | Ga0501075_0046658 | 3300049591 | Bacteria | 3254 |
| 476 | Ga0501075_0114578 | 3300049591 | Bacteria | 2050 |
| 477 | Ga0501075_0217282 | 3300049591 | Bacteria | 1458 |
| 478 | Ga0501076_0023013 | 3300049592 | Bacteria | 4796 |
| 479 | Ga0501076_0230416 | 3300049592 | Bacteria | 1514 |
| 480 | Ga0501079_0033160 | 3300049741 | Bacteria | 3972 |
| 481 | Ga0501079_0172476 | 3300049741 | Bacteria | 1687 |
| 482 | Ga0501080_0120951 | 3300049742 | Bacteria | 2426 |
| 483 | Ga0501083_0028135 | 3300049744 | Bacteria | 3876 |
| 484 | Ga0501083_0080349 | 3300049744 | Bacteria | 2162 |
| 485 | Ga0501035_0028378 | 3300049822 | Bacteria | 5109 |
| 486 | Ga0501044_0200627 | 3300049823 | Bacteria | 1953 |
| 487 | Ga0501045_0008257 | 3300049824 | Bacteria | 7250 |
| 488 | nmdc:mga0n895_13463_c1 | 3300050512 | Bacteria | 7380 |
| 489 | nmdc:mga0n895_98804_c1 | 3300050512 | Bacteria | 2926 |
| 490 | nmdc:mga0rr50_2380_c1 | 3300050513 | Bacteria | 10581 |
| 491 | nmdc:mga0a205_9389_c1 | 3300050515 | Bacteria | 8938 |
| 492 | Ga0500578_0011893 | 3300053086 | Bacteria | 5621 |
| 493 | Ga0500651_0004026 | 3300053093 | Bacteria | 8159 |
| 494 | Ga0500641_0000270 | 3300053096 | Bacteria | 19388 |
| 495 | Ga0500595_006524 | 3300053119 | Bacteria | 4938 |
| 496 | Ga0500642_0001055 | 3300053130 | Bacteria | 7954 |
| 497 | Ga0500658_0034866 | 3300053134 | Bacteria | 1989 |
| 498 | Ga0500568_0003919 | 3300053139 | Bacteria | 8100 |
| 499 | Ga0500577_0007617 | 3300053142 | Bacteria | 3046 |
| 500 | Ga0500616_0001361 | 3300053153 | Bacteria | 23773 |
| 501 | Ga0530510_0002503 | 3300061734 | Bacteria | 12626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046455 | Ga0495603_0030735 | Ga0495603_0030735_20_862 | 277 |
| 2 | 3300046674 | Ga0495588_0134787 | Ga0495588_0134787_20_862 | 277 |
| 3 | 3300035691 | Ga0373931_0071543 | Ga0373931_0071543_16_909 | 293 |
| 4 | 3300005468 | Ga0070707_100024507 | Ga0070707_1000245074 | 306 |
| 5 | 3300005536 | Ga0070697_100010158 | Ga0070697_1000101585 | 306 |
| 6 | 3300005614 | Ga0068856_100226145 | Ga0068856_1002261451 | 306 |
| 7 | 3300005843 | Ga0068860_100128871 | Ga0068860_1001288713 | 306 |
| 8 | 3300006175 | Ga0070712_100010690 | Ga0070712_1000106904 | 306 |
| 9 | 3300006237 | Ga0097621_100147204 | Ga0097621_1001472043 | 306 |
| 10 | 3300006871 | Ga0075434_100079228 | Ga0075434_1000792281 | 306 |
| 11 | 3300006914 | Ga0075436_100259558 | Ga0075436_1002595581 | 306 |
| 12 | 3300007076 | Ga0075435_100004989 | Ga0075435_1000049895 | 306 |
| 13 | 3300025898 | Ga0207692_10113070 | Ga0207692_101130702 | 306 |
| 14 | 3300025906 | Ga0207699_10005933 | Ga0207699_100059333 | 306 |
| 15 | 3300025910 | Ga0207684_10029143 | Ga0207684_100291432 | 306 |
| 16 | 3300025922 | Ga0207646_10005024 | Ga0207646_1000502410 | 306 |
| 17 | 3300025928 | Ga0207700_10075988 | Ga0207700_100759882 | 306 |
| 18 | 3300025960 | Ga0207651_10009898 | Ga0207651_100098985 | 306 |
| 19 | 3300025986 | Ga0207658_10027527 | Ga0207658_100275273 | 306 |
| 20 | 3300026023 | Ga0207677_10325297 | Ga0207677_103252972 | 306 |
| 21 | 3300028381 | Ga0268264_10042390 | Ga0268264_100423903 | 306 |
| 22 | 3300037068 | Ga0373925_0138625 | Ga0373925_0138625_20_949 | 306 |
| 23 | 3300038725 | Ga0400484_43797 | Ga0400484_43797_3822_4751 | 306 |
| 24 | 3300049578 | Ga0501042_0133705 | Ga0501042_0133705_826_1755 | 306 |
| 25 | 3300009093 | Ga0105240_10000196 | Ga0105240_1000019696 | 307 |
| 26 | 3300035398 | Ga0316574_0038057 | Ga0316574_0038057_1897_2832 | 307 |
| 27 | 3300036647 | Ga0316582_0002176 | Ga0316582_0002176_6559_7494 | 307 |
| 28 | 3300036712 | Ga0316584_0187146 | Ga0316584_0187146_186_1121 | 307 |
| 29 | 3300049573 | Ga0501037_0022614 | Ga0501037_0022614_1445_2377 | 307 |
| 30 | 3300049589 | Ga0501073_0263334 | Ga0501073_0263334_244_1176 | 307 |
| 31 | 3300049590 | Ga0501074_0003015 | Ga0501074_0003015_3386_4318 | 307 |
| 32 | 3300031728 | Ga0316578_10096449 | Ga0316578_100964492 | 308 |
| 33 | 3300049568 | Ga0501031_0114248 | Ga0501031_0114248_10_945 | 308 |
| 34 | 3300013297 | Ga0157378_10030194 | Ga0157378_100301944 | 315 |
| 35 | 3300038726 | Ga0400490_45494 | Ga0400490_45494_14292_15248 | 315 |
| 36 | 3300038727 | Ga0400491_29664 | Ga0400491_29664_63_1019 | 315 |
| 37 | 3300039110 | Ga0400487_66289 | Ga0400487_66289_31735_32691 | 315 |
| 38 | 3300005330 | Ga0070690_100001976 | Ga0070690_1000019767 | 316 |
| 39 | 3300005331 | Ga0070670_100200663 | Ga0070670_1002006631 | 316 |
| 40 | 3300005333 | Ga0070677_10075671 | Ga0070677_100756712 | 316 |
| 41 | 3300005334 | Ga0068869_100047408 | Ga0068869_1000474083 | 316 |
| 42 | 3300005335 | Ga0070666_10030032 | Ga0070666_100300323 | 316 |
| 43 | 3300005338 | Ga0068868_100068190 | Ga0068868_1000681902 | 316 |
| 44 | 3300005340 | Ga0070689_100002818 | Ga0070689_1000028181 | 316 |
| 45 | 3300005355 | Ga0070671_100035349 | Ga0070671_1000353492 | 316 |
| 46 | 3300005364 | Ga0070673_100002777 | Ga0070673_1000027773 | 316 |
| 47 | 3300005365 | Ga0070688_100000391 | Ga0070688_10000039114 | 316 |
| 48 | 3300005367 | Ga0070667_100092127 | Ga0070667_1000921273 | 316 |
| 49 | 3300005436 | Ga0070713_100268553 | Ga0070713_1002685532 | 316 |
| 50 | 3300005437 | Ga0070710_10004401 | Ga0070710_100044014 | 316 |
| 51 | 3300005439 | Ga0070711_100200533 | Ga0070711_1002005332 | 316 |
| 52 | 3300005456 | Ga0070678_100002681 | Ga0070678_1000026813 | 316 |
| 53 | 3300005457 | Ga0070662_100017183 | Ga0070662_1000171833 | 316 |
| 54 | 3300005459 | Ga0068867_100013472 | Ga0068867_1000134725 | 316 |
| 55 | 3300005547 | Ga0070693_100012260 | Ga0070693_1000122603 | 316 |
| 56 | 3300005548 | Ga0070665_100003582 | Ga0070665_1000035823 | 316 |
| 57 | 3300005615 | Ga0070702_100148354 | Ga0070702_1001483541 | 316 |
| 58 | 3300005617 | Ga0068859_100003236 | Ga0068859_10000323612 | 316 |
| 59 | 3300005618 | Ga0068864_100001480 | Ga0068864_10000148017 | 316 |
| 60 | 3300005718 | Ga0068866_10001308 | Ga0068866_100013088 | 316 |
| 61 | 3300005841 | Ga0068863_100002303 | Ga0068863_1000023035 | 316 |
| 62 | 3300005842 | Ga0068858_100009965 | Ga0068858_10000996511 | 316 |
| 63 | 3300006358 | Ga0068871_100074127 | Ga0068871_1000741273 | 316 |
| 64 | 3300006358 | Ga0068871_100144916 | Ga0068871_1001449161 | 316 |
| 65 | 3300006871 | Ga0075434_100398151 | Ga0075434_1003981512 | 316 |
| 66 | 3300006881 | Ga0068865_100028384 | Ga0068865_1000283842 | 316 |
| 67 | 3300006931 | Ga0097620_100003236 | Ga0097620_10000323612 | 316 |
| 68 | 3300013104 | Ga0157370_10179688 | Ga0157370_101796882 | 316 |
| 69 | 3300013306 | Ga0163162_10025348 | Ga0163162_100253482 | 316 |
| 70 | 3300025908 | Ga0207643_10011302 | Ga0207643_100113027 | 316 |
| 71 | 3300025915 | Ga0207693_10055062 | Ga0207693_100550623 | 316 |
| 72 | 3300025916 | Ga0207663_10017301 | Ga0207663_100173016 | 316 |
| 73 | 3300025923 | Ga0207681_10057436 | Ga0207681_100574362 | 316 |
| 74 | 3300025927 | Ga0207687_10005040 | Ga0207687_100050403 | 316 |
| 75 | 3300025927 | Ga0207687_10106189 | Ga0207687_101061891 | 316 |
| 76 | 3300025931 | Ga0207644_10034298 | Ga0207644_100342983 | 316 |
| 77 | 3300025933 | Ga0207706_10004354 | Ga0207706_100043543 | 316 |
| 78 | 3300025936 | Ga0207670_10005050 | Ga0207670_100050501 | 316 |
| 79 | 3300025938 | Ga0207704_10093272 | Ga0207704_100932722 | 316 |
| 80 | 3300025941 | Ga0207711_10000087 | Ga0207711_1000008711 | 316 |
| 81 | 3300025942 | Ga0207689_10067477 | Ga0207689_100674773 | 316 |
| 82 | 3300026023 | Ga0207677_10003044 | Ga0207677_100030449 | 316 |
| 83 | 3300026035 | Ga0207703_10000522 | Ga0207703_1000052225 | 316 |
| 84 | 3300026067 | Ga0207678_10069350 | Ga0207678_100693503 | 316 |
| 85 | 3300026078 | Ga0207702_10027813 | Ga0207702_100278136 | 316 |
| 86 | 3300026095 | Ga0207676_10000140 | Ga0207676_1000014047 | 316 |
| 87 | 3300026121 | Ga0207683_10000717 | Ga0207683_100007178 | 316 |
| 88 | 3300035171 | Ga0373946_0108356 | Ga0373946_0108356_11_970 | 316 |
| 89 | 3300035695 | Ga0373927_0021524 | Ga0373927_0021524_2738_3697 | 316 |
| 90 | 3300035695 | Ga0373927_0099144 | Ga0373927_0099144_919_1878 | 316 |
| 91 | 3300039062 | Ga0400483_161823 | Ga0400483_161823_882_1841 | 316 |
| 92 | 3300046525 | Ga0495663_0001763 | Ga0495663_0001763_2417_3376 | 316 |
| 93 | 3300005530 | Ga0070679_100300459 | Ga0070679_1003004592 | 317 |
| 94 | 3300005841 | Ga0068863_100118109 | Ga0068863_1001181092 | 317 |
| 95 | 3300005844 | Ga0068862_100075280 | Ga0068862_1000752804 | 317 |
| 96 | 3300009093 | Ga0105240_10029644 | Ga0105240_100296443 | 317 |
| 97 | 3300013100 | Ga0157373_10122571 | Ga0157373_101225712 | 317 |
| 98 | 3300013104 | Ga0157370_10044444 | Ga0157370_100444443 | 317 |
| 99 | 3300027682 | Ga0209971_1005698 | Ga0209971_10056983 | 317 |
| 100 | 3300027876 | Ga0209974_10009412 | Ga0209974_100094125 | 317 |
| 101 | 3300028573 | Ga0265334_10004878 | Ga0265334_100048782 | 317 |
| 102 | 3300028800 | Ga0265338_10011128 | Ga0265338_100111288 | 317 |
| 103 | 3300031251 | Ga0265327_10017906 | Ga0265327_100179066 | 317 |
| 104 | 3300031595 | Ga0265313_10002274 | Ga0265313_100022743 | 317 |
| 105 | 3300035398 | Ga0316574_0001169 | Ga0316574_0001169_7859_8824 | 317 |
| 106 | 3300035398 | Ga0316574_0056040 | Ga0316574_0056040_121_1086 | 317 |
| 107 | 3300036647 | Ga0316582_0007417 | Ga0316582_0007417_3526_4491 | 317 |
| 108 | 3300042156 | Ga0439446_0012949 | Ga0439446_0012949_366_1334 | 317 |
| 109 | 3300042435 | Ga0439434_0025434 | Ga0439434_0025434_633_1601 | 317 |
| 110 | 3300042436 | Ga0439435_0000327 | Ga0439435_0000327_1707_2675 | 317 |
| 111 | 3300042531 | Ga0450918_009064 | Ga0450918_009064_423_1391 | 317 |
| 112 | 3300049569 | Ga0501032_0034055 | Ga0501032_0034055_1231_2193 | 317 |
| 113 | 3300049573 | Ga0501037_0003749 | Ga0501037_0003749_3345_4307 | 317 |
| 114 | 3300049575 | Ga0501039_0309866 | Ga0501039_0309866_83_1048 | 317 |
| 115 | 3300049577 | Ga0501041_0105801 | Ga0501041_0105801_239_1204 | 317 |
| 116 | 3300049580 | Ga0501046_0015573 | Ga0501046_0015573_4178_5140 | 317 |
| 117 | 3300049585 | Ga0501069_0030302 | Ga0501069_0030302_1673_2635 | 317 |
| 118 | 3300049586 | Ga0501070_0035023 | Ga0501070_0035023_2089_3051 | 317 |
| 119 | 3300049590 | Ga0501074_0286382 | Ga0501074_0286382_185_1147 | 317 |
| 120 | 3300049741 | Ga0501079_0172476 | Ga0501079_0172476_266_1228 | 317 |
| 121 | 3300038741 | Ga0400488_50269 | Ga0400488_50269_68_1033 | 318 |
| 122 | 3300026035 | Ga0207703_10033977 | Ga0207703_100339772 | 319 |
| 123 | 3300035398 | Ga0316574_0019747 | Ga0316574_0019747_993_1961 | 319 |
| 124 | 3300039062 | Ga0400483_066104 | Ga0400483_066104_724_1692 | 319 |
| 125 | 3300009551 | Ga0105238_10018871 | Ga0105238_100188717 | 320 |
| 126 | 3300013100 | Ga0157373_10133627 | Ga0157373_101336272 | 320 |
| 127 | 3300013104 | Ga0157370_10062340 | Ga0157370_100623402 | 320 |
| 128 | 3300013307 | Ga0157372_10000822 | Ga0157372_1000082232 | 320 |
| 129 | 3300035398 | Ga0316574_0083474 | Ga0316574_0083474_749_1723 | 320 |
| 130 | 3300036647 | Ga0316582_0009716 | Ga0316582_0009716_3251_4225 | 320 |
| 131 | 3300036712 | Ga0316584_0041153 | Ga0316584_0041153_1911_2885 | 320 |
| 132 | 3300038726 | Ga0400490_15683 | Ga0400490_15683_1789_2760 | 320 |
| 133 | 3300038742 | Ga0400486_16325 | Ga0400486_16325_1454_2425 | 320 |
| 134 | 3300042876 | Ga0451577_0002624 | Ga0451577_0002624_4512_5489 | 320 |
| 135 | 3300044712 | Ga0453684_0546987 | Ga0453684_0546987_203_1180 | 320 |
| 136 | 3300049574 | Ga0501038_0061754 | Ga0501038_0061754_142_1113 | 320 |
| 137 | 3300049581 | Ga0501047_0451552 | Ga0501047_0451552_109_1077 | 322 |
| 138 | iso_pu_bacteria | 2842757796 | 2842761082 | 322 |
| 139 | 3300032004 | Ga0307414_10079148 | Ga0307414_100791483 | 326 |
| 140 | 3300005329 | Ga0070683_100003773 | Ga0070683_10000377315 | 327 |
| 141 | 3300005335 | Ga0070666_10000953 | Ga0070666_100009532 | 327 |
| 142 | 3300005335 | Ga0070666_10014158 | Ga0070666_100141583 | 327 |
| 143 | 3300005339 | Ga0070660_100060694 | Ga0070660_1000606942 | 327 |
| 144 | 3300005344 | Ga0070661_100002100 | Ga0070661_1000021009 | 327 |
| 145 | 3300005455 | Ga0070663_100017914 | Ga0070663_1000179146 | 327 |
| 146 | 3300005455 | Ga0070663_100033468 | Ga0070663_1000334686 | 327 |
| 147 | 3300005457 | Ga0070662_100022041 | Ga0070662_1000220414 | 327 |
| 148 | 3300005457 | Ga0070662_100047556 | Ga0070662_1000475563 | 327 |
| 149 | 3300005530 | Ga0070679_100087660 | Ga0070679_1000876602 | 327 |
| 150 | 3300005535 | Ga0070684_100042329 | Ga0070684_1000423292 | 327 |
| 151 | 3300005539 | Ga0068853_100045310 | Ga0068853_1000453102 | 327 |
| 152 | 3300005539 | Ga0068853_100050816 | Ga0068853_1000508165 | 327 |
| 153 | 3300005539 | Ga0068853_100257092 | Ga0068853_1002570922 | 327 |
| 154 | 3300005548 | Ga0070665_100000500 | Ga0070665_1000005006 | 327 |
| 155 | 3300005563 | Ga0068855_100022596 | Ga0068855_1000225967 | 327 |
| 156 | 3300005564 | Ga0070664_100040926 | Ga0070664_1000409262 | 327 |
| 157 | 3300005577 | Ga0068857_100056366 | Ga0068857_1000563662 | 327 |
| 158 | 3300005578 | Ga0068854_100002838 | Ga0068854_10000283813 | 327 |
| 159 | 3300005578 | Ga0068854_100027454 | Ga0068854_1000274545 | 327 |
| 160 | 3300005616 | Ga0068852_100014257 | Ga0068852_1000142573 | 327 |
| 161 | 3300005618 | Ga0068864_100027559 | Ga0068864_1000275595 | 327 |
| 162 | 3300005834 | Ga0068851_10002553 | Ga0068851_1000255310 | 327 |
| 163 | 3300005841 | Ga0068863_100003508 | Ga0068863_10000350815 | 327 |
| 164 | 3300005842 | Ga0068858_100004483 | Ga0068858_10000448312 | 327 |
| 165 | 3300005843 | Ga0068860_100017042 | Ga0068860_1000170422 | 327 |
| 166 | 3300005844 | Ga0068862_100060726 | Ga0068862_1000607263 | 327 |
| 167 | 3300006028 | Ga0070717_10154501 | Ga0070717_101545012 | 327 |
| 168 | 3300006237 | Ga0097621_100136104 | Ga0097621_1001361042 | 327 |
| 169 | 3300006358 | Ga0068871_100137736 | Ga0068871_1001377362 | 327 |
| 170 | 3300006881 | Ga0068865_100022190 | Ga0068865_1000221903 | 327 |
| 171 | 3300006881 | Ga0068865_100045419 | Ga0068865_1000454192 | 327 |
| 172 | 3300009093 | Ga0105240_10013319 | Ga0105240_100133199 | 327 |
| 173 | 3300009093 | Ga0105240_10019737 | Ga0105240_100197372 | 327 |
| 174 | 3300009093 | Ga0105240_10058730 | Ga0105240_100587306 | 327 |
| 175 | 3300009093 | Ga0105240_10083233 | Ga0105240_100832332 | 327 |
| 176 | 3300009098 | Ga0105245_10117407 | Ga0105245_101174073 | 327 |
| 177 | 3300009174 | Ga0105241_10208900 | Ga0105241_102089002 | 327 |
| 178 | 3300009177 | Ga0105248_10227902 | Ga0105248_102279022 | 327 |
| 179 | 3300009545 | Ga0105237_10009184 | Ga0105237_100091846 | 327 |
| 180 | 3300009551 | Ga0105238_10095202 | Ga0105238_100952022 | 327 |
| 181 | 3300010375 | Ga0105239_10007054 | Ga0105239_1000705410 | 327 |
| 182 | 3300010375 | Ga0105239_10105015 | Ga0105239_101050152 | 327 |
| 183 | 3300010375 | Ga0105239_10189928 | Ga0105239_101899283 | 327 |
| 184 | 3300013105 | Ga0157369_10013085 | Ga0157369_1001308512 | 327 |
| 185 | 3300013296 | Ga0157374_10029101 | Ga0157374_100291012 | 327 |
| 186 | 3300013297 | Ga0157378_10092120 | Ga0157378_100921203 | 327 |
| 187 | 3300013306 | Ga0163162_10000061 | Ga0163162_1000006188 | 327 |
| 188 | 3300013307 | Ga0157372_10025500 | Ga0157372_100255007 | 327 |
| 189 | 3300014325 | Ga0163163_10000166 | Ga0163163_1000016622 | 327 |
| 190 | 3300014968 | Ga0157379_10004862 | Ga0157379_100048624 | 327 |
| 191 | 3300025261 | Ga0209233_1000930 | Ga0209233_10009307 | 327 |
| 192 | 3300025321 | Ga0207656_10000819 | Ga0207656_100008192 | 327 |
| 193 | 3300025903 | Ga0207680_10005524 | Ga0207680_100055242 | 327 |
| 194 | 3300025904 | Ga0207647_10000277 | Ga0207647_1000027740 | 327 |
| 195 | 3300025904 | Ga0207647_10001196 | Ga0207647_1000119624 | 327 |
| 196 | 3300025913 | Ga0207695_10000040 | Ga0207695_10000040400 | 327 |
| 197 | 3300025913 | Ga0207695_10000271 | Ga0207695_1000027190 | 327 |
| 198 | 3300025913 | Ga0207695_10013099 | Ga0207695_100130998 | 327 |
| 199 | 3300025914 | Ga0207671_10007196 | Ga0207671_1000719611 | 327 |
| 200 | 3300025914 | Ga0207671_10019252 | Ga0207671_100192522 | 327 |
| 201 | 3300025914 | Ga0207671_10025050 | Ga0207671_100250502 | 327 |
| 202 | 3300025914 | Ga0207671_10272923 | Ga0207671_102729232 | 327 |
| 203 | 3300025919 | Ga0207657_10013571 | Ga0207657_100135719 | 327 |
| 204 | 3300025920 | Ga0207649_10010017 | Ga0207649_100100176 | 327 |
| 205 | 3300025920 | Ga0207649_10141242 | Ga0207649_101412421 | 327 |
| 206 | 3300025924 | Ga0207694_10001531 | Ga0207694_100015318 | 327 |
| 207 | 3300025933 | Ga0207706_10000792 | Ga0207706_100007927 | 327 |
| 208 | 3300025933 | Ga0207706_10026328 | Ga0207706_100263283 | 327 |
| 209 | 3300025938 | Ga0207704_10051413 | Ga0207704_100514132 | 327 |
| 210 | 3300025941 | Ga0207711_10233636 | Ga0207711_102336361 | 327 |
| 211 | 3300025949 | Ga0207667_10052079 | Ga0207667_100520795 | 327 |
| 212 | 3300025961 | Ga0207712_10000168 | Ga0207712_1000016846 | 327 |
| 213 | 3300025981 | Ga0207640_10033832 | Ga0207640_100338322 | 327 |
| 214 | 3300025986 | Ga0207658_10092499 | Ga0207658_100924992 | 327 |
| 215 | 3300026035 | Ga0207703_10000194 | Ga0207703_1000019446 | 327 |
| 216 | 3300026035 | Ga0207703_10028086 | Ga0207703_100280864 | 327 |
| 217 | 3300026041 | Ga0207639_10000218 | Ga0207639_1000021839 | 327 |
| 218 | 3300026041 | Ga0207639_10176427 | Ga0207639_101764272 | 327 |
| 219 | 3300026067 | Ga0207678_10010597 | Ga0207678_100105977 | 327 |
| 220 | 3300026067 | Ga0207678_10012550 | Ga0207678_100125509 | 327 |
| 221 | 3300026078 | Ga0207702_10006391 | Ga0207702_100063914 | 327 |
| 222 | 3300026078 | Ga0207702_10022768 | Ga0207702_100227686 | 327 |
| 223 | 3300026088 | Ga0207641_10016815 | Ga0207641_100168157 | 327 |
| 224 | 3300026088 | Ga0207641_10061619 | Ga0207641_100616192 | 327 |
| 225 | 3300026095 | Ga0207676_10024476 | Ga0207676_100244763 | 327 |
| 226 | 3300026116 | Ga0207674_10043728 | Ga0207674_100437282 | 327 |
| 227 | 3300026142 | Ga0207698_10043803 | Ga0207698_100438035 | 327 |
| 228 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007266 | 327 |
| 229 | 3300033179 | Ga0307507_10055672 | Ga0307507_100556722 | 327 |
| 230 | 3300048906 | Ga0496103_0205086 | Ga0496103_0205086_14_1009 | 327 |
| 231 | 3300048921 | Ga0496118_0017687 | Ga0496118_0017687_5394_6389 | 327 |
| 232 | iso_pu_bacteria | 2842805378 | 2842807965 | 329 |
| 233 | iso_pu_bacteria | 2974298342 | 2974302070 | 329 |
| 234 | iso_pu_bacteria | 8011350971 | 8011351064 | 329 |
| 235 | 3300005338 | Ga0068868_100080515 | Ga0068868_1000805152 | 330 |
| 236 | 3300005444 | Ga0070694_100014953 | Ga0070694_1000149532 | 330 |
| 237 | 3300005467 | Ga0070706_100147529 | Ga0070706_1001475292 | 330 |
| 238 | 3300005468 | Ga0070707_100059284 | Ga0070707_1000592843 | 330 |
| 239 | 3300005471 | Ga0070698_100110784 | Ga0070698_1001107843 | 330 |
| 240 | 3300005535 | Ga0070684_100025550 | Ga0070684_1000255506 | 330 |
| 241 | 3300005536 | Ga0070697_100007297 | Ga0070697_1000072973 | 330 |
| 242 | 3300005578 | Ga0068854_100004550 | Ga0068854_1000045508 | 330 |
| 243 | 3300025906 | Ga0207699_10029168 | Ga0207699_100291682 | 330 |
| 244 | 3300025906 | Ga0207699_10238786 | Ga0207699_102387861 | 330 |
| 245 | 3300025911 | Ga0207654_10070124 | Ga0207654_100701243 | 330 |
| 246 | 3300025914 | Ga0207671_10226768 | Ga0207671_102267682 | 330 |
| 247 | 3300025915 | Ga0207693_10125258 | Ga0207693_101252582 | 330 |
| 248 | 3300025919 | Ga0207657_10002002 | Ga0207657_1000200216 | 330 |
| 249 | 3300025922 | Ga0207646_10254288 | Ga0207646_102542881 | 330 |
| 250 | 3300025933 | Ga0207706_10037181 | Ga0207706_100371813 | 330 |
| 251 | 3300025939 | Ga0207665_10124638 | Ga0207665_101246382 | 330 |
| 252 | 3300025941 | Ga0207711_10364277 | Ga0207711_103642771 | 330 |
| 253 | 3300025944 | Ga0207661_10257907 | Ga0207661_102579072 | 330 |
| 254 | 3300025981 | Ga0207640_10346834 | Ga0207640_103468342 | 330 |
| 255 | 3300026067 | Ga0207678_10256621 | Ga0207678_102566212 | 330 |
| 256 | 3300026116 | Ga0207674_10013722 | Ga0207674_100137223 | 330 |
| 257 | 3300050512 | nmdc:mga0n895_13463_c1 | nmdc:mga0n895_13463_c1_3960_4961 | 330 |
| 258 | 3300050513 | nmdc:mga0rr50_2380_c1 | nmdc:mga0rr50_2380_c1_998_1999 | 330 |
| 259 | 3300050515 | nmdc:mga0a205_9389_c1 | nmdc:mga0a205_9389_c1_2425_3426 | 330 |
| 260 | 3300005329 | Ga0070683_100017074 | Ga0070683_1000170743 | 331 |
| 261 | 3300005340 | Ga0070689_100003205 | Ga0070689_1000032058 | 331 |
| 262 | 3300005344 | Ga0070661_100026097 | Ga0070661_1000260974 | 331 |
| 263 | 3300005344 | Ga0070661_100292175 | Ga0070661_1002921752 | 331 |
| 264 | 3300005347 | Ga0070668_100010367 | Ga0070668_1000103672 | 331 |
| 265 | 3300005365 | Ga0070688_100002581 | Ga0070688_1000025818 | 331 |
| 266 | 3300005435 | Ga0070714_100020029 | Ga0070714_1000200293 | 331 |
| 267 | 3300005435 | Ga0070714_100046041 | Ga0070714_1000460413 | 331 |
| 268 | 3300005456 | Ga0070678_100171473 | Ga0070678_1001714732 | 331 |
| 269 | 3300005458 | Ga0070681_10044844 | Ga0070681_100448443 | 331 |
| 270 | 3300005458 | Ga0070681_10100219 | Ga0070681_101002194 | 331 |
| 271 | 3300005466 | Ga0070685_10015530 | Ga0070685_100155304 | 331 |
| 272 | 3300005530 | Ga0070679_100428221 | Ga0070679_1004282211 | 331 |
| 273 | 3300005535 | Ga0070684_100002389 | Ga0070684_10000238912 | 331 |
| 274 | 3300005535 | Ga0070684_100204338 | Ga0070684_1002043382 | 331 |
| 275 | 3300005543 | Ga0070672_100115806 | Ga0070672_1001158061 | 331 |
| 276 | 3300005563 | Ga0068855_100063378 | Ga0068855_1000633782 | 331 |
| 277 | 3300005563 | Ga0068855_100093898 | Ga0068855_1000938981 | 331 |
| 278 | 3300005564 | Ga0070664_100002891 | Ga0070664_10000289111 | 331 |
| 279 | 3300005564 | Ga0070664_100100771 | Ga0070664_1001007712 | 331 |
| 280 | 3300005578 | Ga0068854_100001870 | Ga0068854_1000018701 | 331 |
| 281 | 3300005614 | Ga0068856_100006058 | Ga0068856_1000060583 | 331 |
| 282 | 3300005614 | Ga0068856_100125603 | Ga0068856_1001256032 | 331 |
| 283 | 3300005616 | Ga0068852_100186355 | Ga0068852_1001863552 | 331 |
| 284 | 3300005834 | Ga0068851_10002512 | Ga0068851_100025127 | 331 |
| 285 | 3300006358 | Ga0068871_100177312 | Ga0068871_1001773122 | 331 |
| 286 | 3300009093 | Ga0105240_10081793 | Ga0105240_100817933 | 331 |
| 287 | 3300009177 | Ga0105248_10015684 | Ga0105248_100156844 | 331 |
| 288 | 3300009551 | Ga0105238_10021424 | Ga0105238_100214245 | 331 |
| 289 | 3300010375 | Ga0105239_10005029 | Ga0105239_1000502910 | 331 |
| 290 | 3300013100 | Ga0157373_10017035 | Ga0157373_100170353 | 331 |
| 291 | 3300013102 | Ga0157371_10010442 | Ga0157371_100104422 | 331 |
| 292 | 3300013104 | Ga0157370_10188472 | Ga0157370_101884722 | 331 |
| 293 | 3300025321 | Ga0207656_10055598 | Ga0207656_100555982 | 331 |
| 294 | 3300025909 | Ga0207705_10174346 | Ga0207705_101743462 | 331 |
| 295 | 3300025911 | Ga0207654_10066653 | Ga0207654_100666532 | 331 |
| 296 | 3300025912 | Ga0207707_10002828 | Ga0207707_100028285 | 331 |
| 297 | 3300025912 | Ga0207707_10023500 | Ga0207707_100235004 | 331 |
| 298 | 3300025912 | Ga0207707_10231711 | Ga0207707_102317112 | 331 |
| 299 | 3300025919 | Ga0207657_10000258 | Ga0207657_1000025827 | 331 |
| 300 | 3300025921 | Ga0207652_10033685 | Ga0207652_100336854 | 331 |
| 301 | 3300025929 | Ga0207664_10114967 | Ga0207664_101149672 | 331 |
| 302 | 3300025945 | Ga0207679_10100106 | Ga0207679_101001062 | 331 |
| 303 | 3300025949 | Ga0207667_10002136 | Ga0207667_1000213614 | 331 |
| 304 | 3300025949 | Ga0207667_10064737 | Ga0207667_100647373 | 331 |
| 305 | 3300025972 | Ga0207668_10035920 | Ga0207668_100359201 | 331 |
| 306 | 3300026067 | Ga0207678_10014155 | Ga0207678_100141553 | 331 |
| 307 | 3300026078 | Ga0207702_10092971 | Ga0207702_100929712 | 331 |
| 308 | 3300026116 | Ga0207674_10000429 | Ga0207674_1000042938 | 331 |
| 309 | 3300026142 | Ga0207698_10001159 | Ga0207698_1000115910 | 331 |
| 310 | 3300038443 | Ga0395901_0453599 | Ga0395901_0453599_14_1033 | 331 |
| 311 | 3300049571 | Ga0501034_0012647 | Ga0501034_0012647_4150_5157 | 331 |
| 312 | 3300049572 | Ga0501036_0070959 | Ga0501036_0070959_1864_2868 | 331 |
| 313 | 3300049579 | Ga0501043_0002645 | Ga0501043_0002645_7509_8513 | 331 |
| 314 | 3300049588 | Ga0501072_0006441 | Ga0501072_0006441_5785_6792 | 331 |
| 315 | 3300005329 | Ga0070683_100044710 | Ga0070683_1000447103 | 332 |
| 316 | 3300005331 | Ga0070670_100120300 | Ga0070670_1001203002 | 332 |
| 317 | 3300005336 | Ga0070680_100124162 | Ga0070680_1001241622 | 332 |
| 318 | 3300005406 | Ga0070703_10066576 | Ga0070703_100665761 | 332 |
| 319 | 3300005435 | Ga0070714_100011657 | Ga0070714_1000116575 | 332 |
| 320 | 3300005437 | Ga0070710_10049352 | Ga0070710_100493523 | 332 |
| 321 | 3300005530 | Ga0070679_100223892 | Ga0070679_1002238922 | 332 |
| 322 | 3300005539 | Ga0068853_100140296 | Ga0068853_1001402963 | 332 |
| 323 | 3300005549 | Ga0070704_100021784 | Ga0070704_1000217843 | 332 |
| 324 | 3300005616 | Ga0068852_100185005 | Ga0068852_1001850052 | 332 |
| 325 | 3300009098 | Ga0105245_10134877 | Ga0105245_101348771 | 332 |
| 326 | 3300009101 | Ga0105247_10043783 | Ga0105247_100437832 | 332 |
| 327 | 3300009174 | Ga0105241_10039536 | Ga0105241_100395361 | 332 |
| 328 | 3300009176 | Ga0105242_10057368 | Ga0105242_100573681 | 332 |
| 329 | 3300009177 | Ga0105248_10259426 | Ga0105248_102594262 | 332 |
| 330 | 3300009177 | Ga0105248_10384697 | Ga0105248_103846971 | 332 |
| 331 | 3300009551 | Ga0105238_10091162 | Ga0105238_100911623 | 332 |
| 332 | 3300010375 | Ga0105239_10038663 | Ga0105239_100386634 | 332 |
| 333 | 3300011119 | Ga0105246_10104806 | Ga0105246_101048063 | 332 |
| 334 | 3300013104 | Ga0157370_10100152 | Ga0157370_101001522 | 332 |
| 335 | 3300013296 | Ga0157374_10000922 | Ga0157374_1000092210 | 332 |
| 336 | 3300013297 | Ga0157378_10104490 | Ga0157378_101044902 | 332 |
| 337 | 3300013306 | Ga0163162_10069928 | Ga0163162_100699281 | 332 |
| 338 | 3300014325 | Ga0163163_10008748 | Ga0163163_1000874811 | 332 |
| 339 | 3300014745 | Ga0157377_10022831 | Ga0157377_100228313 | 332 |
| 340 | 3300014968 | Ga0157379_10016112 | Ga0157379_100161126 | 332 |
| 341 | 3300014969 | Ga0157376_10080383 | Ga0157376_100803831 | 332 |
| 342 | 3300014969 | Ga0157376_10218381 | Ga0157376_102183812 | 332 |
| 343 | 3300025898 | Ga0207692_10038162 | Ga0207692_100381621 | 332 |
| 344 | 3300025916 | Ga0207663_10161653 | Ga0207663_101616532 | 332 |
| 345 | 3300025929 | Ga0207664_10003464 | Ga0207664_100034645 | 332 |
| 346 | 3300025942 | Ga0207689_10204167 | Ga0207689_102041672 | 332 |
| 347 | 3300025945 | Ga0207679_10034308 | Ga0207679_100343083 | 332 |
| 348 | 3300027360 | Ga0209969_1011648 | Ga0209969_10116481 | 332 |
| 349 | 3300027876 | Ga0209974_10000642 | Ga0209974_1000064210 | 332 |
| 350 | 3300031665 | Ga0316575_10004094 | Ga0316575_100040942 | 332 |
| 351 | 3300032133 | Ga0316583_10004127 | Ga0316583_100041272 | 332 |
| 352 | 3300035086 | Ga0373934_0009608 | Ga0373934_0009608_203_1210 | 332 |
| 353 | 3300035111 | Ga0373923_0065437 | Ga0373923_0065437_511_1518 | 332 |
| 354 | 3300035116 | Ga0373945_0016593 | Ga0373945_0016593_1198_2205 | 332 |
| 355 | 3300035118 | Ga0373954_0031283 | Ga0373954_0031283_379_1386 | 332 |
| 356 | 3300035119 | Ga0373956_0019961 | Ga0373956_0019961_1254_2261 | 332 |
| 357 | 3300035120 | Ga0373957_0003466 | Ga0373957_0003466_1343_2350 | 332 |
| 358 | 3300035172 | Ga0373955_0003437 | Ga0373955_0003437_460_1467 | 332 |
| 359 | 3300035398 | Ga0316574_0034199 | Ga0316574_0034199_1995_3002 | 332 |
| 360 | 3300035410 | Ga0373924_0008014 | Ga0373924_0008014_916_1923 | 332 |
| 361 | 3300035724 | Ga0373933_0135642 | Ga0373933_0135642_179_1186 | 332 |
| 362 | 3300036401 | Ga0373937_0070392 | Ga0373937_0070392_1022_2029 | 332 |
| 363 | 3300036647 | Ga0316582_0015688 | Ga0316582_0015688_3198_4205 | 332 |
| 364 | 3300037068 | Ga0373925_0028363 | Ga0373925_0028363_1593_2600 | 332 |
| 365 | 3300046476 | Ga0495662_0119880 | Ga0495662_0119880_270_1277 | 332 |
| 366 | 3300046477 | Ga0495664_0081349 | Ga0495664_0081349_919_1926 | 332 |
| 367 | 3300046543 | Ga0495645_0089689 | Ga0495645_0089689_110_1117 | 332 |
| 368 | 3300046679 | Ga0495623_0042829 | Ga0495623_0042829_139_1146 | 332 |
| 369 | 3300048906 | Ga0496103_0100451 | Ga0496103_0100451_53_1060 | 332 |
| 370 | 3300048907 | Ga0496104_0004559 | Ga0496104_0004559_8799_9806 | 332 |
| 371 | 3300048909 | Ga0496106_0184025 | Ga0496106_0184025_190_1197 | 332 |
| 372 | 3300048909 | Ga0496106_0246983 | Ga0496106_0246983_318_1325 | 332 |
| 373 | 3300048910 | Ga0496107_0096247 | Ga0496107_0096247_1143_2150 | 332 |
| 374 | 3300048912 | Ga0496109_0008584 | Ga0496109_0008584_3839_4846 | 332 |
| 375 | 3300048913 | Ga0496110_0125556 | Ga0496110_0125556_1266_2273 | 332 |
| 376 | 3300048914 | Ga0496111_0290658 | Ga0496111_0290658_158_1165 | 332 |
| 377 | 3300048915 | Ga0496112_0003465 | Ga0496112_0003465_6111_7118 | 332 |
| 378 | 3300048915 | Ga0496112_0048405 | Ga0496112_0048405_125_1132 | 332 |
| 379 | 3300048917 | Ga0496114_0004669 | Ga0496114_0004669_131_1138 | 332 |
| 380 | 3300048918 | Ga0496115_0211148 | Ga0496115_0211148_571_1578 | 332 |
| 381 | 3300050512 | nmdc:mga0n895_98804_c1 | nmdc:mga0n895_98804_c1_1669_2676 | 332 |
| 382 | 3300005330 | Ga0070690_100018410 | Ga0070690_1000184104 | 333 |
| 383 | 3300005331 | Ga0070670_100038842 | Ga0070670_1000388423 | 333 |
| 384 | 3300005338 | Ga0068868_100127477 | Ga0068868_1001274772 | 333 |
| 385 | 3300005354 | Ga0070675_100205020 | Ga0070675_1002050202 | 333 |
| 386 | 3300005364 | Ga0070673_100045036 | Ga0070673_1000450363 | 333 |
| 387 | 3300005434 | Ga0070709_10007739 | Ga0070709_100077393 | 333 |
| 388 | 3300005437 | Ga0070710_10166380 | Ga0070710_101663801 | 333 |
| 389 | 3300005518 | Ga0070699_100020992 | Ga0070699_1000209923 | 333 |
| 390 | 3300005539 | Ga0068853_100012083 | Ga0068853_1000120834 | 333 |
| 391 | 3300005543 | Ga0070672_100053344 | Ga0070672_1000533443 | 333 |
| 392 | 3300005548 | Ga0070665_100152867 | Ga0070665_1001528671 | 333 |
| 393 | 3300005617 | Ga0068859_100021624 | Ga0068859_1000216246 | 333 |
| 394 | 3300005618 | Ga0068864_100400311 | Ga0068864_1004003111 | 333 |
| 395 | 3300005718 | Ga0068866_10021490 | Ga0068866_100214901 | 333 |
| 396 | 3300005841 | Ga0068863_100225043 | Ga0068863_1002250432 | 333 |
| 397 | 3300005842 | Ga0068858_100120062 | Ga0068858_1001200622 | 333 |
| 398 | 3300005843 | Ga0068860_100083826 | Ga0068860_1000838262 | 333 |
| 399 | 3300005844 | Ga0068862_100048679 | Ga0068862_1000486793 | 333 |
| 400 | 3300005844 | Ga0068862_100151654 | Ga0068862_1001516542 | 333 |
| 401 | 3300006237 | Ga0097621_100402628 | Ga0097621_1004026281 | 333 |
| 402 | 3300006358 | Ga0068871_100005265 | Ga0068871_1000052656 | 333 |
| 403 | 3300006844 | Ga0075428_100066124 | Ga0075428_1000661244 | 333 |
| 404 | 3300006931 | Ga0097620_100021624 | Ga0097620_1000216243 | 333 |
| 405 | 3300009093 | Ga0105240_10049857 | Ga0105240_100498573 | 333 |
| 406 | 3300009545 | Ga0105237_10057965 | Ga0105237_100579653 | 333 |
| 407 | 3300013105 | Ga0157369_10021113 | Ga0157369_1002111310 | 333 |
| 408 | 3300013297 | Ga0157378_10009053 | Ga0157378_100090534 | 333 |
| 409 | 3300013306 | Ga0163162_10056092 | Ga0163162_100560922 | 333 |
| 410 | 3300013307 | Ga0157372_10061152 | Ga0157372_100611522 | 333 |
| 411 | 3300025898 | Ga0207692_10070559 | Ga0207692_100705592 | 333 |
| 412 | 3300025899 | Ga0207642_10010089 | Ga0207642_100100893 | 333 |
| 413 | 3300025906 | Ga0207699_10177840 | Ga0207699_101778401 | 333 |
| 414 | 3300025907 | Ga0207645_10088484 | Ga0207645_100884841 | 333 |
| 415 | 3300025913 | Ga0207695_10023565 | Ga0207695_100235655 | 333 |
| 416 | 3300025914 | Ga0207671_10088409 | Ga0207671_100884092 | 333 |
| 417 | 3300025916 | Ga0207663_10049863 | Ga0207663_100498633 | 333 |
| 418 | 3300025920 | Ga0207649_10110393 | Ga0207649_101103932 | 333 |
| 419 | 3300025925 | Ga0207650_10039382 | Ga0207650_100393823 | 333 |
| 420 | 3300025926 | Ga0207659_10287396 | Ga0207659_102873962 | 333 |
| 421 | 3300025929 | Ga0207664_10005531 | Ga0207664_100055318 | 333 |
| 422 | 3300025938 | Ga0207704_10018150 | Ga0207704_100181503 | 333 |
| 423 | 3300025940 | Ga0207691_10012494 | Ga0207691_100124948 | 333 |
| 424 | 3300025942 | Ga0207689_10010154 | Ga0207689_100101541 | 333 |
| 425 | 3300025942 | Ga0207689_10126462 | Ga0207689_101264621 | 333 |
| 426 | 3300025945 | Ga0207679_10276974 | Ga0207679_102769742 | 333 |
| 427 | 3300025960 | Ga0207651_10230400 | Ga0207651_102304001 | 333 |
| 428 | 3300025986 | Ga0207658_10307672 | Ga0207658_103076721 | 333 |
| 429 | 3300026035 | Ga0207703_10022991 | Ga0207703_100229914 | 333 |
| 430 | 3300026041 | Ga0207639_10019751 | Ga0207639_100197513 | 333 |
| 431 | 3300026088 | Ga0207641_10305411 | Ga0207641_103054111 | 333 |
| 432 | 3300028380 | Ga0268265_10054312 | Ga0268265_100543122 | 333 |
| 433 | 3300028380 | Ga0268265_10059918 | Ga0268265_100599182 | 333 |
| 434 | 3300031665 | Ga0316575_10056301 | Ga0316575_100563012 | 333 |
| 435 | 3300031691 | Ga0316579_10096420 | Ga0316579_100964201 | 333 |
| 436 | 3300031727 | Ga0316576_10056263 | Ga0316576_100562634 | 333 |
| 437 | 3300031995 | Ga0307409_100145499 | Ga0307409_1001454993 | 333 |
| 438 | 3300033529 | Ga0316587_1014579 | Ga0316587_10145792 | 333 |
| 439 | 3300035398 | Ga0316574_0015011 | Ga0316574_0015011_2718_3728 | 333 |
| 440 | 3300046524 | Ga0495648_0005997 | Ga0495648_0005997_1554_2567 | 333 |
| 441 | 3300048915 | Ga0496112_0200712 | Ga0496112_0200712_851_1864 | 333 |
| 442 | 3300049591 | Ga0501075_0217282 | Ga0501075_0217282_187_1206 | 333 |
| 443 | 3300025735 | Ga0207713_1030216 | Ga0207713_10302161 | 334 |
| 444 | 3300025913 | Ga0207695_10000554 | Ga0207695_1000055459 | 334 |
| 445 | 3300030500 | Ga0268256_1011030 | Ga0268256_10110302 | 334 |
| 446 | 3300049570 | Ga0501033_0143909 | Ga0501033_0143909_184_1203 | 334 |
| 447 | 3300049574 | Ga0501038_0167837 | Ga0501038_0167837_319_1338 | 334 |
| 448 | 3300049575 | Ga0501039_0057449 | Ga0501039_0057449_1676_2695 | 334 |
| 449 | 3300049576 | Ga0501040_0127160 | Ga0501040_0127160_139_1158 | 334 |
| 450 | 3300049577 | Ga0501041_0006345 | Ga0501041_0006345_5282_6301 | 334 |
| 451 | 3300049578 | Ga0501042_0003945 | Ga0501042_0003945_7850_8869 | 334 |
| 452 | 3300049579 | Ga0501043_0016348 | Ga0501043_0016348_1865_2884 | 334 |
| 453 | 3300049580 | Ga0501046_0007052 | Ga0501046_0007052_967_1986 | 334 |
| 454 | 3300049582 | Ga0501048_0017341 | Ga0501048_0017341_19_1038 | 334 |
| 455 | 3300049584 | Ga0501068_0047317 | Ga0501068_0047317_794_1813 | 334 |
| 456 | 3300049587 | Ga0501071_0013135 | Ga0501071_0013135_4458_5477 | 334 |
| 457 | 3300049590 | Ga0501074_0051446 | Ga0501074_0051446_93_1112 | 334 |
| 458 | 3300049591 | Ga0501075_0046658 | Ga0501075_0046658_1469_2488 | 334 |
| 459 | 3300049591 | Ga0501075_0114578 | Ga0501075_0114578_26_1045 | 334 |
| 460 | 3300049592 | Ga0501076_0023013 | Ga0501076_0023013_3376_4395 | 334 |
| 461 | 3300049592 | Ga0501076_0230416 | Ga0501076_0230416_108_1127 | 334 |
| 462 | 3300049741 | Ga0501079_0033160 | Ga0501079_0033160_2623_3642 | 334 |
| 463 | 3300049744 | Ga0501083_0080349 | Ga0501083_0080349_641_1660 | 334 |
| 464 | 3300049822 | Ga0501035_0028378 | Ga0501035_0028378_300_1319 | 334 |
| 465 | 3300049824 | Ga0501045_0008257 | Ga0501045_0008257_5913_6932 | 334 |
| 466 | 3300061734 | Ga0530510_0002503 | Ga0530510_0002503_3266_4285 | 334 |
| 467 | 3300010375 | Ga0105239_10001780 | Ga0105239_100017809 | 335 |
| 468 | 3300013296 | Ga0157374_10000127 | Ga0157374_1000012736 | 335 |
| 469 | 3300021361 | Ga0213872_10061799 | Ga0213872_100617991 | 335 |
| 470 | 3300026142 | Ga0207698_10159856 | Ga0207698_101598562 | 335 |
| 471 | 3300031665 | Ga0316575_10019443 | Ga0316575_100194432 | 335 |
| 472 | 3300031665 | Ga0316575_10060985 | Ga0316575_100609851 | 335 |
| 473 | 3300031691 | Ga0316579_10002057 | Ga0316579_100020578 | 335 |
| 474 | 3300031727 | Ga0316576_10031081 | Ga0316576_100310813 | 335 |
| 475 | 3300031728 | Ga0316578_10027773 | Ga0316578_100277732 | 335 |
| 476 | 3300032133 | Ga0316583_10009697 | Ga0316583_100096971 | 335 |
| 477 | 3300032137 | Ga0316585_10000053 | Ga0316585_1000005318 | 335 |
| 478 | 3300032139 | Ga0316580_10032249 | Ga0316580_100322491 | 335 |
| 479 | 3300039447 | Ga0436361_0962722 | Ga0436361_0962722_3057_4073 | 335 |
| 480 | 3300042876 | Ga0451577_0002812 | Ga0451577_0002812_6097_7113 | 335 |
| 481 | 3300049576 | Ga0501040_0000005 | Ga0501040_0000005_30478_31497 | 335 |
| 482 | 3300049578 | Ga0501042_0000156 | Ga0501042_0000156_17699_18718 | 335 |
| 483 | 3300053139 | Ga0500568_0003919 | Ga0500568_0003919_1853_2878 | 336 |
| 484 | 3300049579 | Ga0501043_0063642 | Ga0501043_0063642_243_1262 | 339 |
| 485 | 3300053096 | Ga0500641_0000270 | Ga0500641_0000270_10169_11191 | 339 |
| 486 | 3300053119 | Ga0500595_006524 | Ga0500595_006524_41_1060 | 339 |
| 487 | 3300053134 | Ga0500658_0034866 | Ga0500658_0034866_729_1748 | 339 |
| 488 | 3300003215 | JGI25153J46596_10000492 | JGI25153J46596_100004926 | 340 |
| 489 | 3300003215 | JGI25153J46596_10000624 | JGI25153J46596_1000062411 | 340 |
| 490 | 3300005844 | Ga0068862_100003861 | Ga0068862_1000038611 | 340 |
| 491 | 3300025297 | Ga0209758_1000169 | Ga0209758_100016987 | 340 |
| 492 | 3300025303 | Ga0209051_1018392 | Ga0209051_10183923 | 340 |
| 493 | 3300025304 | Ga0209257_1002268 | Ga0209257_100226811 | 340 |
| 494 | 3300028380 | Ga0268265_10002190 | Ga0268265_1000219010 | 340 |
| 495 | 3300049581 | Ga0501047_0071906 | Ga0501047_0071906_1381_2418 | 340 |
| 496 | 3300049584 | Ga0501068_0046090 | Ga0501068_0046090_1549_2586 | 340 |
| 497 | 3300049589 | Ga0501073_0032437 | Ga0501073_0032437_747_1784 | 340 |
| 498 | 3300049742 | Ga0501080_0120951 | Ga0501080_0120951_1231_2268 | 340 |
| 499 | 3300049744 | Ga0501083_0028135 | Ga0501083_0028135_843_1880 | 340 |
| 500 | 3300049823 | Ga0501044_0200627 | Ga0501044_0200627_749_1774 | 340 |
| 501 | 3300053086 | Ga0500578_0011893 | Ga0500578_0011893_2505_3536 | 340 |
| 502 | 3300053093 | Ga0500651_0004026 | Ga0500651_0004026_6053_7075 | 340 |
| 503 | 3300053130 | Ga0500642_0001055 | Ga0500642_0001055_4877_5917 | 340 |
| 504 | 3300053142 | Ga0500577_0007617 | Ga0500577_0007617_1594_2616 | 340 |
| 505 | 3300053153 | Ga0500616_0001361 | Ga0500616_0001361_16386_17420 | 340 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c1h-assembly1.cif.gz_A | the x-ray structure of chlorobium vibrioforme 5-aminolaevulinic acid dehydratase complexed with a diacid inhibitor | 0.9788 | 17 | 337 |
| 1w54-assembly1.cif.gz_A | stepwise introduction of a zinc binding site into porphobilinogen synthase from pseudomonas aeruginosa (mutation d139c) | 0.9766 | 17 | 338 |
| 1w5m-assembly1.cif.gz_B | stepwise introduction of zinc binding site into porphobilinogen synthase of pseudomonas aeruginosa (mutations a129c and d139c) | 0.9765 | 13 | 338 |
| 1w5m-assembly1.cif.gz_A | stepwise introduction of zinc binding site into porphobilinogen synthase of pseudomonas aeruginosa (mutations a129c and d139c) | 0.9761 | 13 | 338 |
| 1gzg-assembly1.cif.gz_A | complex of a mg2-dependent porphobilinogen synthase from pseudomonas aeruginosa (mutant d139n) with 5-fluorolevulinic acid | 0.9759 | 13 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c19A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.97 | 9 | 338 | 3.20.20.70 |
| af_P9WMP5_2_329_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9688 | 11 | 337 | 3.20.20.70 |
| 1i8jA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9647 | 17 | 340 | 3.20.20.70 |
| af_Q60178_5_334_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9612 | 12 | 336 | 3.20.20.70 |
| af_P9WMP5_2_329_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9601 | 11 | 337 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849TES1-F1-model_v4 | Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) | 0.9961 | 246 | 338 |
GO:0004655
GO:0005829 GO:0006782 GO:0008270 |
| AF-A0A340XQS9-F1-model_v4 | deleted | 0.9926 | 61 | 287 |
|
| AF-A0A6L4AB02-F1-model_v4 | Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) | 0.9908 | 235 | 338 |
GO:0004655
GO:0005829 GO:0006782 GO:0008270 |
| AF-A0A1W1D7K8-F1-model_v4 | porphobilinogen synthase (EC 4.2.1.24) (Porphobilinogen synthase) | 0.9902 | 237 | 337 |
GO:0004655
GO:0005829 GO:0006782 GO:0008270 |
| AF-A0A3C2C4A2-F1-model_v4 | Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) | 0.9899 | 235 | 339 |
GO:0004655
GO:0005829 GO:0006782 GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar