F456327

General Info

Members Datasets Scaffolds Average Seq Length
505 249 492 105

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100126842|Ga0068855_1001268424
Length 107
Sequence MMAKLTIVDRAGEEKMVDGENGLSVMEIIRDNGLDELLSLCGGCCSCATCHVYVDESGFEGALPAVSADENDLLDSSDHRTAQSRLSCQIPFSEALDGLTVRIAPED

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2516143018 Ensifer sp. BR816 Isolate Nodule
3 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
4 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
5 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
6 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
7 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
8 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
9 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
10 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
11 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
12 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
13 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
177 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
178 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
184 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
247 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 643692032 Sinorhizobium fredii NGR234 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0.59
Rhizoplane 4.75
Rhizosphere 87.33
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004390 3300000549 Bacteria 1840
2 JGI24736J21556_1003769 3300001904 Bacteria 2612
3 JGI24736J21556_1046320 3300001904 Bacteria 668
4 JGI24741J21665_1002496 3300001915 Bacteria 4761
5 JGI24740J21852_10011906 3300001979 Bacteria 3296
6 JGI24740J21852_10018152 3300001979 Bacteria 2503
7 JGI24739J22299_10002323 3300001989 Bacteria 7328
8 JGI24739J22299_10021861 3300001989 Bacteria 2273
9 JGI24737J22298_10075631 3300001990 Bacteria 1004
10 JGI24737J22298_10076949 3300001990 Bacteria 994
11 JGI24735J21928_10070174 3300002067 Bacteria 1004
12 JGI24735J21928_10190321 3300002067 Bacteria 594
13 JGI24750J21931_1007765 3300002070 Bacteria 1354
14 JGI24738J21930_10006571 3300002075 Bacteria 2720
15 JGI24738J21930_10012302 3300002075 Bacteria 1870
16 JGI24035J26624_1002194 3300002126 Bacteria 1819
17 JGI24034J26672_10005842 3300002239 Bacteria 1770
18 Ga0065707_10714410 3300005295 Bacteria 622
19 Ga0070658_10095941 3300005327 Bacteria 2448
20 Ga0070683_100089380 3300005329 Bacteria 2891
21 Ga0070683_100317402 3300005329 Bacteria 1483
22 Ga0070690_100253524 3300005330 Bacteria 1245
23 Ga0070670_100035594 3300005331 Bacteria 4285
24 Ga0070677_10000029 3300005333 Bacteria 42300
25 Ga0070677_10490872 3300005333 Bacteria 664
26 Ga0068869_100598791 3300005334 Bacteria 931
27 Ga0070666_10007820 3300005335 Bacteria 6602
28 Ga0070666_10022575 3300005335 Bacteria 4087
29 Ga0070666_11221528 3300005335 Unclassified 560
30 Ga0068868_100000021 3300005338 Bacteria 89090
31 Ga0070660_100000044 3300005339 Bacteria 71756
32 Ga0070660_100399985 3300005339 Bacteria 1136
33 Ga0070660_100430306 3300005339 Bacteria 1093
34 Ga0070689_100112384 3300005340 Bacteria 2168
35 Ga0070661_100145057 3300005344 Bacteria 1791
36 Ga0070661_101373964 3300005344 Bacteria 594
37 Ga0070692_10329707 3300005345 Bacteria 942
38 Ga0070668_100030352 3300005347 Bacteria 4109
39 Ga0070668_100187976 3300005347 Bacteria 1690
40 Ga0070668_101160607 3300005347 Bacteria 699
41 Ga0070668_101467268 3300005347 Bacteria 623
42 Ga0070669_100000302 3300005353 Bacteria 38805
43 Ga0070669_100027501 3300005353 Bacteria 4093
44 Ga0070669_101345870 3300005353 Unclassified 619
45 Ga0070675_100013240 3300005354 Bacteria 6483
46 Ga0070671_100000089 3300005355 Bacteria 58283
47 Ga0070671_100027007 3300005355 Bacteria 4723
48 Ga0070671_100048974 3300005355 Bacteria 3516
49 Ga0070671_101213904 3300005355 Bacteria 664
50 Ga0070674_100060786 3300005356 Bacteria 2635
51 Ga0070673_101151429 3300005364 Bacteria 726
52 Ga0070659_100000027 3300005366 Bacteria 143469
53 Ga0070659_100085590 3300005366 Bacteria 2521
54 Ga0070659_100100384 3300005366 Bacteria 2329
55 Ga0070667_100000339 3300005367 Bacteria 52285
56 Ga0070667_100036542 3300005367 Bacteria 4118
57 Ga0070705_100007579 3300005440 Bacteria 5347
58 Ga0070708_100478569 3300005445 Bacteria 1175
59 Ga0070663_100006821 3300005455 Bacteria 6905
60 Ga0070663_100029648 3300005455 Bacteria 3741
61 Ga0070662_100205847 3300005457 Bacteria 1563
62 Ga0070681_11385463 3300005458 Bacteria 627
63 Ga0070685_10582253 3300005466 Bacteria 803
64 Ga0070707_101124955 3300005468 Bacteria 751
65 Ga0070684_100837242 3300005535 Bacteria 861
66 Ga0070684_101165502 3300005535 Bacteria 725
67 Ga0068853_100006228 3300005539 Bacteria 9452
68 Ga0068853_100059754 3300005539 Bacteria 3293
69 Ga0068853_100073184 3300005539 Bacteria 2987
70 Ga0068853_100344853 3300005539 Bacteria 1384
71 Ga0068853_100462245 3300005539 Bacteria 1194
72 Ga0068853_100851550 3300005539 Bacteria 874
73 Ga0070672_101393476 3300005543 Bacteria 627
74 Ga0070686_100000152 3300005544 Bacteria 47696
75 Ga0070686_100061175 3300005544 Bacteria 2432
76 Ga0070686_100722485 3300005544 Bacteria 796
77 Ga0070696_100747400 3300005546 Bacteria 801
78 Ga0070665_100000354 3300005548 Bacteria 68927
79 Ga0070665_100003716 3300005548 Bacteria 16154
80 Ga0070665_100064614 3300005548 Bacteria 3670
81 Ga0070665_100087460 3300005548 Bacteria 3121
82 Ga0068855_100126842 3300005563 Bacteria 2917
83 Ga0068855_100137715 3300005563 Bacteria 2784
84 Ga0070664_100171052 3300005564 Bacteria 1927
85 Ga0068857_100025646 3300005577 Bacteria 5189
86 Ga0068857_100031849 3300005577 Bacteria 4659
87 Ga0068857_100197453 3300005577 Bacteria 1833
88 Ga0068857_102393700 3300005577 Bacteria 518
89 Ga0068854_100177304 3300005578 Bacteria 1662
90 Ga0068854_100982130 3300005578 Bacteria 747
91 Ga0068856_100033646 3300005614 Bacteria 5019
92 Ga0068856_100365384 3300005614 Bacteria 1462
93 Ga0070702_101065470 3300005615 Bacteria 644
94 Ga0068852_100004899 3300005616 Bacteria 9506
95 Ga0068852_100365360 3300005616 Bacteria 1412
96 Ga0068852_100850347 3300005616 Bacteria 928
97 Ga0068852_102020801 3300005616 Bacteria 598
98 Ga0068859_100053025 3300005617 Bacteria 4078
99 Ga0068859_100094489 3300005617 Bacteria 3042
100 Ga0068859_100188434 3300005617 Bacteria 2147
101 Ga0068864_100202885 3300005618 Bacteria 1822
102 Ga0068864_100218506 3300005618 Bacteria 1758
103 Ga0068861_100050668 3300005719 Bacteria 3149
104 Ga0068851_10007576 3300005834 Bacteria 4990
105 Ga0068851_10076894 3300005834 Bacteria 1736
106 Ga0068851_10195547 3300005834 Bacteria 1126
107 Ga0068863_100011981 3300005841 Bacteria 8380
108 Ga0068863_100044513 3300005841 Bacteria 4213
109 Ga0068863_100047147 3300005841 Bacteria 4089
110 Ga0068858_100014602 3300005842 Bacteria 7398
111 Ga0068858_100017841 3300005842 Bacteria 6646
112 Ga0068858_100045005 3300005842 Bacteria 4090
113 Ga0068860_100000442 3300005843 Bacteria 52295
114 Ga0068860_100034512 3300005843 Bacteria 4853
115 Ga0068860_100036461 3300005843 Bacteria 4711
116 Ga0068860_100043647 3300005843 Bacteria 4276
117 Ga0068862_100037784 3300005844 Bacteria 4093
118 Ga0068862_100333724 3300005844 Bacteria 1403
119 Ga0068862_100412879 3300005844 Bacteria 1265
120 Ga0097621_101143717 3300006237 Bacteria 732
121 Ga0097621_102218505 3300006237 Unclassified 525
122 Ga0075370_10717932 3300006353 Bacteria 608
123 Ga0075370_10983115 3300006353 Bacteria 517
124 Ga0068871_101467502 3300006358 Bacteria 644
125 Ga0075434_100214521 3300006871 Bacteria 1945
126 Ga0097620_100053026 3300006931 Bacteria 4078
127 Ga0097620_100094485 3300006931 Bacteria 3042
128 Ga0097620_100188439 3300006931 Bacteria 2147
129 Ga0105240_10266724 3300009093 Bacteria 1973
130 Ga0105240_10399220 3300009093 Bacteria 1549
131 Ga0105240_11643586 3300009093 Bacteria 671
132 Ga0105245_10018640 3300009098 Bacteria 6069
133 Ga0105245_10072857 3300009098 Bacteria 3122
134 Ga0105245_10569570 3300009098 Bacteria 1156
135 Ga0105245_11295574 3300009098 Bacteria 777
136 Ga0105245_12065005 3300009098 Bacteria 623
137 Ga0105247_10019007 3300009101 Bacteria 4127
138 Ga0105247_10443676 3300009101 Bacteria 934
139 Ga0105247_11089900 3300009101 Bacteria 629
140 Ga0105241_10051454 3300009174 Bacteria 3141
141 Ga0105241_10708977 3300009174 Bacteria 919
142 Ga0105242_11093837 3300009176 Bacteria 811
143 Ga0105242_11437964 3300009176 Unclassified 718
144 Ga0105248_10015752 3300009177 Bacteria 8332
145 Ga0105248_10044388 3300009177 Bacteria 4985
146 Ga0105237_10053540 3300009545 Bacteria 4047
147 Ga0105237_12338945 3300009545 Bacteria 544
148 Ga0105238_10062085 3300009551 Bacteria 3738
149 Ga0105238_10126544 3300009551 Bacteria 2533
150 Ga0105238_10159234 3300009551 Bacteria 2233
151 Ga0105238_10263286 3300009551 Bacteria 1704
152 Ga0105238_10945606 3300009551 Bacteria 881
153 Ga0105249_10042662 3300009553 Bacteria 4127
154 Ga0105249_11982383 3300009553 Bacteria 655
155 Ga0105239_10984702 3300010375 Bacteria 969
156 Ga0105239_12141221 3300010375 Bacteria 650
157 Ga0105246_11179323 3300011119 Bacteria 704
158 Ga0157373_10199580 3300013100 Bacteria 1410
159 Ga0157373_10358487 3300013100 Bacteria 1041
160 Ga0157371_10319478 3300013102 Bacteria 1126
161 Ga0157371_10338453 3300013102 Bacteria 1094
162 Ga0157370_10013741 3300013104 Bacteria 8322
163 Ga0157369_10220096 3300013105 Bacteria 1987
164 Ga0157369_10982595 3300013105 Bacteria 864
165 Ga0157378_12128775 3300013297 Bacteria 612
166 Ga0163162_10036722 3300013306 Bacteria 4885
167 Ga0157372_10265968 3300013307 Bacteria 1991
168 Ga0157372_10832664 3300013307 Bacteria 1071
169 Ga0157372_10939869 3300013307 Bacteria 1002
170 Ga0157372_11289991 3300013307 Bacteria 843
171 Ga0157375_11218039 3300013308 Bacteria 883
172 Ga0157375_11363184 3300013308 Bacteria 835
173 Ga0157375_11576471 3300013308 Bacteria 776
174 Ga0157375_12095565 3300013308 Bacteria 673
175 Ga0163163_10345956 3300014325 Bacteria 1542
176 Ga0163163_11827380 3300014325 Bacteria 668
177 Ga0157380_10044825 3300014326 Bacteria 3468
178 Ga0157379_10308188 3300014968 Bacteria 1444
179 Ga0157379_10556012 3300014968 Bacteria 1068
180 Ga0157376_11829537 3300014969 Bacteria 644
181 Ga0163161_10022051 3300017792 Bacteria 4481
182 Ga0213876_10001018 3300021384 Bacteria 18185
183 Ga0213876_10014853 3300021384 Bacteria 4127
184 Ga0213876_10034251 3300021384 Bacteria 2678
185 Ga0207666_1042055 3300025271 Bacteria 716
186 Ga0207673_1034584 3300025290 Bacteria 704
187 Ga0209257_1090848 3300025304 Bacteria 763
188 Ga0207697_10010106 3300025315 Bacteria 4051
189 Ga0207697_10142458 3300025315 Bacteria 1040
190 Ga0207656_10015570 3300025321 Bacteria 2945
191 Ga0207656_10054312 3300025321 Bacteria 1741
192 Ga0207656_10082973 3300025321 Bacteria 1444
193 Ga0207682_10000227 3300025893 Bacteria 25316
194 Ga0207710_10000513 3300025900 Bacteria 24057
195 Ga0207710_10125736 3300025900 Bacteria 1228
196 Ga0207710_10267054 3300025900 Bacteria 859
197 Ga0207688_10283161 3300025901 Bacteria 1010
198 Ga0207680_10011217 3300025903 Bacteria 4519
199 Ga0207680_10183177 3300025903 Bacteria 1417
200 Ga0207680_10189179 3300025903 Bacteria 1396
201 Ga0207647_10182091 3300025904 Bacteria 1220
202 Ga0207647_10246906 3300025904 Bacteria 1024
203 Ga0207645_10257210 3300025907 Bacteria 1156
204 Ga0207705_10064630 3300025909 Bacteria 2644
205 Ga0207654_10099782 3300025911 Bacteria 1787
206 Ga0207695_10252764 3300025913 Bacteria 1661
207 Ga0207695_10557127 3300025913 Bacteria 1028
208 Ga0207671_10456715 3300025914 Bacteria 1018
209 Ga0207657_10001409 3300025919 Bacteria 25657
210 Ga0207657_10055561 3300025919 Bacteria 3419
211 Ga0207657_10109581 3300025919 Bacteria 2282
212 Ga0207657_11394896 3300025919 Bacteria 526
213 Ga0207649_10402064 3300025920 Bacteria 1025
214 Ga0207649_11480257 3300025920 Bacteria 537
215 Ga0207681_10000313 3300025923 Bacteria 35417
216 Ga0207681_10021433 3300025923 Bacteria 4107
217 Ga0207681_11093144 3300025923 Bacteria 670
218 Ga0207694_10033550 3300025924 Bacteria 3932
219 Ga0207694_10129059 3300025924 Bacteria 2025
220 Ga0207694_10733511 3300025924 Bacteria 834
221 Ga0207650_10019895 3300025925 Bacteria 4725
222 Ga0207659_10071778 3300025926 Bacteria 2529
223 Ga0207687_10084974 3300025927 Bacteria 2295
224 Ga0207687_10120521 3300025927 Bacteria 1961
225 Ga0207687_10675424 3300025927 Bacteria 875
226 Ga0207687_10823251 3300025927 Bacteria 792
227 Ga0207687_10933118 3300025927 Bacteria 743
228 Ga0207644_10000005 3300025931 Bacteria 441948
229 Ga0207644_10013740 3300025931 Bacteria 5406
230 Ga0207690_10000067 3300025932 Bacteria 91404
231 Ga0207690_10044282 3300025932 Bacteria 2933
232 Ga0207690_10126355 3300025932 Bacteria 1865
233 Ga0207690_10163017 3300025932 Bacteria 1664
234 Ga0207706_10303950 3300025933 Bacteria 1390
235 Ga0207706_10361124 3300025933 Bacteria 1262
236 Ga0207686_10487418 3300025934 Bacteria 954
237 Ga0207709_11783770 3300025935 Bacteria 512
238 Ga0207670_10091323 3300025936 Bacteria 2153
239 Ga0207670_10610686 3300025936 Bacteria 896
240 Ga0207670_11734240 3300025936 Bacteria 531
241 Ga0207691_10294224 3300025940 Bacteria 1396
242 Ga0207711_10014451 3300025941 Bacteria 6559
243 Ga0207711_10137054 3300025941 Bacteria 2199
244 Ga0207711_10146883 3300025941 Bacteria 2125
245 Ga0207711_10350760 3300025941 Bacteria 1366
246 Ga0207689_10306458 3300025942 Bacteria 1317
247 Ga0207661_11145200 3300025944 Bacteria 716
248 Ga0207679_10270029 3300025945 Bacteria 1454
249 Ga0207667_10055718 3300025949 Bacteria 4155
250 Ga0207667_10133329 3300025949 Bacteria 2559
251 Ga0207667_10662811 3300025949 Bacteria 1048
252 Ga0207651_10540159 3300025960 Bacteria 1012
253 Ga0207651_11289131 3300025960 Bacteria 657
254 Ga0207712_10006375 3300025961 Bacteria 7442
255 Ga0207712_11278568 3300025961 Bacteria 655
256 Ga0207668_10587175 3300025972 Bacteria 969
257 Ga0207668_10730617 3300025972 Bacteria 872
258 Ga0207668_11695002 3300025972 Bacteria 571
259 Ga0207640_10025772 3300025981 Bacteria 3563
260 Ga0207640_10027521 3300025981 Bacteria 3465
261 Ga0207640_10050981 3300025981 Bacteria 2688
262 Ga0207640_11306867 3300025981 Bacteria 648
263 Ga0207640_11462200 3300025981 Bacteria 613
264 Ga0207658_10000492 3300025986 Bacteria 36290
265 Ga0207658_10034006 3300025986 Bacteria 3639
266 Ga0207677_10000036 3300026023 Bacteria 115815
267 Ga0207703_10000584 3300026035 Bacteria 37152
268 Ga0207703_10002816 3300026035 Bacteria 14836
269 Ga0207703_10142493 3300026035 Bacteria 2081
270 Ga0207703_11345807 3300026035 Bacteria 687
271 Ga0207639_10003754 3300026041 Bacteria 10220
272 Ga0207639_10008273 3300026041 Bacteria 7127
273 Ga0207639_10083897 3300026041 Bacteria 2530
274 Ga0207639_10186846 3300026041 Bacteria 1767
275 Ga0207639_10275822 3300026041 Bacteria 1477
276 Ga0207639_10703966 3300026041 Bacteria 937
277 Ga0207678_10002196 3300026067 Bacteria 17622
278 Ga0207678_10009989 3300026067 Bacteria 8327
279 Ga0207708_10593311 3300026075 Bacteria 938
280 Ga0207702_10018798 3300026078 Bacteria 5715
281 Ga0207641_10002999 3300026088 Bacteria 15251
282 Ga0207641_10003551 3300026088 Bacteria 13782
283 Ga0207641_10005625 3300026088 Bacteria 10678
284 Ga0207641_10064753 3300026088 Bacteria 3125
285 Ga0207676_10075645 3300026095 Bacteria 2717
286 Ga0207676_10168989 3300026095 Bacteria 1903
287 Ga0207674_10016473 3300026116 Bacteria 8089
288 Ga0207674_10041158 3300026116 Bacteria 4780
289 Ga0207674_10069626 3300026116 Bacteria 3538
290 Ga0207674_10235998 3300026116 Bacteria 1776
291 Ga0207674_10593308 3300026116 Bacteria 1070
292 Ga0207674_10593735 3300026116 Bacteria 1070
293 Ga0207675_100046576 3300026118 Bacteria 4051
294 Ga0207675_101050901 3300026118 Bacteria 833
295 Ga0207698_10018599 3300026142 Bacteria 4739
296 Ga0207698_10041720 3300026142 Bacteria 3422
297 Ga0207698_10353300 3300026142 Bacteria 1389
298 Ga0207698_10374075 3300026142 Bacteria 1353
299 Ga0207698_10404539 3300026142 Bacteria 1305
300 Ga0207698_11130897 3300026142 Bacteria 796
301 Ga0268266_10000093 3300028379 Bacteria 191879
302 Ga0268266_10001503 3300028379 Bacteria 27580
303 Ga0268266_10510842 3300028379 Bacteria 1148
304 Ga0268266_11802285 3300028379 Unclassified 587
305 Ga0268265_10026740 3300028380 Bacteria 4107
306 Ga0268265_10204400 3300028380 Bacteria 1716
307 Ga0268264_10000491 3300028381 Bacteria 52312
308 Ga0268264_10012118 3300028381 Bacteria 7099
309 Ga0268264_10016923 3300028381 Bacteria 5969
310 Ga0268264_10034856 3300028381 Bacteria 4142
311 Ga0307408_100015416 3300031548 Bacteria 5087
312 Ga0307408_100046898 3300031548 Bacteria 3092
313 Ga0307408_100064636 3300031548 Bacteria 2680
314 Ga0307408_100177669 3300031548 Bacteria 1704
315 Ga0307408_100453161 3300031548 Bacteria 1113
316 Ga0307408_100583147 3300031548 Bacteria 991
317 Ga0307408_100602506 3300031548 Bacteria 976
318 Ga0307405_10029938 3300031731 Bacteria 3187
319 Ga0307405_10035700 3300031731 Bacteria 2971
320 Ga0307405_10069897 3300031731 Bacteria 2253
321 Ga0307405_10101234 3300031731 Bacteria 1932
322 Ga0307405_10164296 3300031731 Bacteria 1576
323 Ga0307405_10299636 3300031731 Bacteria 1219
324 Ga0307405_10321249 3300031731 Bacteria 1182
325 Ga0307405_11052656 3300031731 Bacteria 697
326 Ga0307405_11264046 3300031731 Bacteria 641
327 Ga0307413_10003300 3300031824 Bacteria 6768
328 Ga0307413_10394207 3300031824 Bacteria 1083
329 Ga0307413_10669663 3300031824 Bacteria 858
330 Ga0307413_12008410 3300031824 Bacteria 521
331 Ga0307410_10034774 3300031852 Bacteria 3267
332 Ga0307410_10113741 3300031852 Bacteria 1962
333 Ga0307410_10120313 3300031852 Bacteria 1914
334 Ga0307410_10137034 3300031852 Bacteria 1805
335 Ga0307410_10182851 3300031852 Bacteria 1588
336 Ga0307410_10247387 3300031852 Bacteria 1385
337 Ga0307410_10255922 3300031852 Bacteria 1363
338 Ga0307406_10038711 3300031901 Bacteria 2953
339 Ga0307406_10062871 3300031901 Bacteria 2402
340 Ga0307406_10117288 3300031901 Bacteria 1844
341 Ga0307406_10183560 3300031901 Bacteria 1525
342 Ga0307406_11004374 3300031901 Bacteria 716
343 Ga0307406_11102925 3300031901 Bacteria 685
344 Ga0307406_11420293 3300031901 Bacteria 609
345 Ga0307407_10014620 3300031903 Bacteria 3851
346 Ga0307407_10199340 3300031903 Bacteria 1340
347 Ga0307412_10020470 3300031911 Bacteria 4026
348 Ga0307412_10039562 3300031911 Bacteria 3045
349 Ga0307412_10054043 3300031911 Bacteria 2664
350 Ga0307412_10086124 3300031911 Bacteria 2185
351 Ga0307412_10199762 3300031911 Bacteria 1517
352 Ga0307412_11319358 3300031911 Bacteria 650
353 Ga0307412_12151103 3300031911 Bacteria 519
354 Ga0307409_100060181 3300031995 Bacteria 2960
355 Ga0307409_100131247 3300031995 Bacteria 2141
356 Ga0307409_100252470 3300031995 Bacteria 1613
357 Ga0307416_100060285 3300032002 Bacteria 3089
358 Ga0307416_100065603 3300032002 Bacteria 2984
359 Ga0307416_100076519 3300032002 Bacteria 2805
360 Ga0307416_100076900 3300032002 Bacteria 2800
361 Ga0307416_100145623 3300032002 Bacteria 2162
362 Ga0307416_100199179 3300032002 Bacteria 1898
363 Ga0307416_100222654 3300032002 Bacteria 1811
364 Ga0307416_100486038 3300032002 Bacteria 1296
365 Ga0307416_100568006 3300032002 Bacteria 1210
366 Ga0307416_100658113 3300032002 Bacteria 1133
367 Ga0307416_100749547 3300032002 Bacteria 1069
368 Ga0307416_100914935 3300032002 Bacteria 978
369 Ga0307416_101650109 3300032002 Bacteria 746
370 Ga0307416_101911438 3300032002 Bacteria 697
371 Ga0307416_103022283 3300032002 Bacteria 563
372 Ga0307414_10002554 3300032004 Bacteria 9572
373 Ga0307414_10064532 3300032004 Bacteria 2608
374 Ga0307414_10089065 3300032004 Bacteria 2286
375 Ga0307414_10188779 3300032004 Bacteria 1665
376 Ga0307414_10591013 3300032004 Bacteria 994
377 Ga0307414_10628882 3300032004 Bacteria 966
378 Ga0307414_11412330 3300032004 Bacteria 647
379 Ga0307414_11417218 3300032004 Bacteria 646
380 Ga0307414_12010614 3300032004 Bacteria 540
381 Ga0307411_10005386 3300032005 Bacteria 6280
382 Ga0307411_10134930 3300032005 Bacteria 1810
383 Ga0307411_10137692 3300032005 Bacteria 1795
384 Ga0307411_10207543 3300032005 Bacteria 1510
385 Ga0307411_11380615 3300032005 Bacteria 644
386 Ga0307411_11521707 3300032005 Bacteria 615
387 Ga0307411_11862368 3300032005 Bacteria 559
388 Ga0307411_12009197 3300032005 Bacteria 540
389 Ga0307411_12060754 3300032005 Unclassified 533
390 Ga0307411_12125514 3300032005 Bacteria 526
391 Ga0307411_12163592 3300032005 Bacteria 521
392 Ga0307415_100092229 3300032126 Bacteria 2196
393 Ga0307415_100476367 3300032126 Bacteria 1086
394 Ga0307415_100940192 3300032126 Bacteria 799
395 Ga0307415_101465201 3300032126 Bacteria 652
396 Ga0307510_10001552 3300033180 Bacteria 25413
397 Ga0373932_0017388 3300035112 Bacteria 1845
398 Ga0373931_0149807 3300035691 Bacteria 1359
399 Ga0395905_0851301 3300037471 Bacteria 815
400 Ga0395901_0701185 3300038443 Bacteria 1010
401 Ga0436365_0267983 3300039437 Bacteria 981
402 Ga0436365_0794411 3300039437 Bacteria 78184
403 Ga0436365_1062590 3300039437 Bacteria 8527
404 Ga0436365_1444662 3300039437 Bacteria 6184
405 Ga0436363_0558578 3300039450 Bacteria 1201
406 Ga0436363_0875254 3300039450 Bacteria 635
407 Ga0436362_0573919 3300039453 Bacteria 843
408 Ga0439453_0043972 3300041408 Bacteria 884
409 Ga0451787_258347 3300041441 Bacteria 524
410 Ga0451789_0625612 3300041443 Bacteria 802
411 Ga0451793_0509886 3300041452 Bacteria 1202
412 Ga0451797_0916757 3300041453 Bacteria 1027
413 Ga0451804_0257040 3300041463 Bacteria 604
414 Ga0451807_1810464 3300041486 Bacteria 714
415 Ga0451841_1174666 3300041498 Bacteria 624
416 Ga0451849_0266587 3300041505 Bacteria 864
417 Ga0451853_0050215 3300041512 Bacteria 747
418 Ga0451853_2208097 3300041512 Bacteria 726
419 Ga0450923_022840 3300042125 Bacteria 1229
420 Ga0439434_0160347 3300042435 Bacteria 747
421 Ga0466972_0018060 3300044658 Bacteria 3528
422 Ga0466961_0013225 3300044693 Bacteria 5281
423 Ga0466961_0483542 3300044693 Bacteria 748
424 Ga0466963_0005523 3300044694 Bacteria 7400
425 Ga0466964_0322539 3300044706 Bacteria 785
426 Ga0466971_0053263 3300044719 Bacteria 1823
427 Ga0466957_0003219 3300044842 Bacteria 8930
428 Ga0466959_0500535 3300045049 Unclassified 821
429 Ga0466958_0008794 3300045836 Bacteria 5608
430 Ga0466958_0283927 3300045836 Bacteria 1061
431 Ga0466967_0223477 3300045976 Bacteria 1790
432 Ga0495584_0104478 3300046491 Bacteria 1432
433 Ga0495632_0000001 3300046519 Bacteria 873295
434 Ga0495637_0000108 3300046520 Bacteria 60028
435 Ga0495643_0000020 3300046522 Bacteria 294973
436 Ga0495648_0008519 3300046524 Bacteria 8057
437 Ga0495663_0000002 3300046525 Bacteria 495384
438 Ga0495663_0187526 3300046525 Bacteria 718
439 Ga0495654_0010343 3300046530 Bacteria 5077
440 Ga0495633_0004517 3300046558 Bacteria 8801
441 Ga0495633_0579809 3300046558 Bacteria 505
442 Ga0495668_0176763 3300046616 Bacteria 1170
443 Ga0495668_0396850 3300046616 Bacteria 758
444 Ga0495625_0068493 3300046660 Bacteria 2495
445 Ga0495671_0000016 3300046692 Bacteria 294821
446 Ga0495649_0480012 3300046694 Bacteria 619
447 Ga0495681_0000929 3300047470 Bacteria 22583
448 Ga0495626_0035627 3300048091 Bacteria 2374
449 Ga0496100_1243446 3300048903 Bacteria 587
450 Ga0496101_0038880 3300048904 Bacteria 3380
451 Ga0496103_0092291 3300048906 Bacteria 1911
452 Ga0496104_0404942 3300048907 Bacteria 1276
453 Ga0496105_0039787 3300048908 Bacteria 3876
454 Ga0496106_0001999 3300048909 Bacteria 15340
455 Ga0496107_0001507 3300048910 Bacteria 14463
456 Ga0496108_0185404 3300048911 Bacteria 1802
457 Ga0496109_0143028 3300048912 Bacteria 2237
458 Ga0496109_1450813 3300048912 Bacteria 621
459 Ga0496110_0140483 3300048913 Bacteria 2183
460 Ga0496111_0127045 3300048914 Bacteria 1885
461 Ga0496111_0768130 3300048914 Bacteria 698
462 Ga0496112_0274807 3300048915 Bacteria 1632
463 Ga0496113_0003027 3300048916 Bacteria 9962
464 Ga0496113_0484610 3300048916 Bacteria 993
465 Ga0496115_0153612 3300048918 Bacteria 1901
466 Ga0496119_0396769 3300048922 Bacteria 659
467 Ga0496121_0000017 3300048924 Bacteria 546415
468 Ga0496121_0000114 3300048924 Bacteria 179427
469 Ga0496124_0253224 3300048927 Bacteria 1301
470 Ga0496126_0001667 3300048929 Bacteria 33333
471 Ga0496126_1116976 3300048929 Bacteria 584
472 Ga0501034_0513801 3300049571 Bacteria 1110
473 Ga0501037_0838102 3300049573 Bacteria 605
474 Ga0501041_0306569 3300049577 Bacteria 1001
475 Ga0501043_0642809 3300049579 Bacteria 780
476 Ga0501069_0003915 3300049585 Bacteria 7678
477 Ga0501070_0151326 3300049586 Bacteria 1914
478 Ga0501073_0612516 3300049589 Unclassified 752
479 Ga0501074_0459143 3300049590 Unclassified 903
480 Ga0501080_0123075 3300049742 Bacteria 2403
481 Ga0501080_1443336 3300049742 Bacteria 586
482 nmdc:mga0k408_117727_c1 3300050493 Bacteria 1572
483 nmdc:mga0n895_458403_c1 3300050512 Bacteria 1287
484 Ga0500646_0036084 3300053090 Bacteria 1376
485 Ga0500592_000009 3300053116 Bacteria 87878
486 Ga0500568_0001425 3300053139 Bacteria 15507
487 Ga0500604_0000198 3300053151 Bacteria 17067
488 Ga0500616_0000238 3300053153 Bacteria 86573
489 Ga0500627_0000051 3300053158 Bacteria 56260
490 Ga0500611_029122 3300053727 Bacteria 1127
491 Ga0500587_004826 3300053739 Bacteria 1839
492 Ga0466962_0000640 3300061719 Bacteria 15596

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041498 Ga0451841_1174666 Ga0451841_1174666_15_278 87
2 3300046558 Ga0495633_0579809 Ga0495633_0579809_211_483 90
3 iso_pu_bacteria 2516143018 2516206524 101
4 iso_pu_bacteria 2582581306 2585268355 101
5 iso_pu_bacteria 2582581866 2585397434 101
6 iso_pu_bacteria 2657244999 2657686193 101
7 iso_pu_bacteria 2724679232 2725946918 101
8 iso_pu_bacteria 2767802442 2770196092 101
9 iso_pu_bacteria 2802429268 2804755540 101
10 iso_pu_bacteria 2838661181 2838662590 101
11 iso_pu_bacteria 2848297114 2848297517 101
12 iso_pu_bacteria 2919138771 2919142812 101
13 iso_pu_bacteria 2919709256 2919713233 101
14 iso_pu_bacteria 643692032 643823490 101
15 3300001904 JGI24736J21556_1003769 JGI24736J21556_10037692 103
16 3300001904 JGI24736J21556_1046320 JGI24736J21556_10463201 103
17 3300001915 JGI24741J21665_1002496 JGI24741J21665_10024966 103
18 3300001979 JGI24740J21852_10011906 JGI24740J21852_100119061 103
19 3300001979 JGI24740J21852_10018152 JGI24740J21852_100181522 103
20 3300001989 JGI24739J22299_10002323 JGI24739J22299_100023232 103
21 3300001989 JGI24739J22299_10021861 JGI24739J22299_100218614 103
22 3300001990 JGI24737J22298_10075631 JGI24737J22298_100756311 103
23 3300001990 JGI24737J22298_10076949 JGI24737J22298_100769492 103
24 3300002067 JGI24735J21928_10070174 JGI24735J21928_100701741 103
25 3300002067 JGI24735J21928_10190321 JGI24735J21928_101903211 103
26 3300002075 JGI24738J21930_10006571 JGI24738J21930_100065712 103
27 3300002075 JGI24738J21930_10012302 JGI24738J21930_100123023 103
28 3300005339 Ga0070660_100430306 Ga0070660_1004303062 103
29 3300005344 Ga0070661_100145057 Ga0070661_1001450573 103
30 3300005366 Ga0070659_100085590 Ga0070659_1000855904 103
31 3300005455 Ga0070663_100029648 Ga0070663_1000296483 103
32 3300005457 Ga0070662_100205847 Ga0070662_1002058472 103
33 3300005539 Ga0068853_100344853 Ga0068853_1003448533 103
34 3300005539 Ga0068853_100462245 Ga0068853_1004622452 103
35 3300005539 Ga0068853_100851550 Ga0068853_1008515502 103
36 3300005563 Ga0068855_100137715 Ga0068855_1001377152 103
37 3300005564 Ga0070664_100171052 Ga0070664_1001710524 103
38 3300005577 Ga0068857_100197453 Ga0068857_1001974534 103
39 3300005577 Ga0068857_102393700 Ga0068857_1023937002 103
40 3300005578 Ga0068854_100177304 Ga0068854_1001773044 103
41 3300005614 Ga0068856_100033646 Ga0068856_1000336465 103
42 3300005616 Ga0068852_100365360 Ga0068852_1003653603 103
43 3300005616 Ga0068852_102020801 Ga0068852_1020208011 103
44 3300005834 Ga0068851_10076894 Ga0068851_100768942 103
45 3300005834 Ga0068851_10195547 Ga0068851_101955472 103
46 3300009093 Ga0105240_10266724 Ga0105240_102667243 103
47 3300009093 Ga0105240_10399220 Ga0105240_103992203 103
48 3300009174 Ga0105241_10051454 Ga0105241_100514545 103
49 3300009545 Ga0105237_10053540 Ga0105237_100535402 103
50 3300009551 Ga0105238_10126544 Ga0105238_101265443 103
51 3300009551 Ga0105238_10159234 Ga0105238_101592343 103
52 3300010375 Ga0105239_10984702 Ga0105239_109847022 103
53 3300013100 Ga0157373_10199580 Ga0157373_101995802 103
54 3300013102 Ga0157371_10319478 Ga0157371_103194783 103
55 3300013102 Ga0157371_10338453 Ga0157371_103384533 103
56 3300013104 Ga0157370_10013741 Ga0157370_100137418 103
57 3300013105 Ga0157369_10220096 Ga0157369_102200963 103
58 3300013105 Ga0157369_10982595 Ga0157369_109825952 103
59 3300013307 Ga0157372_10265968 Ga0157372_102659682 103
60 3300013307 Ga0157372_10832664 Ga0157372_108326642 103
61 3300025321 Ga0207656_10015570 Ga0207656_100155704 103
62 3300025321 Ga0207656_10054312 Ga0207656_100543122 103
63 3300025321 Ga0207656_10082973 Ga0207656_100829733 103
64 3300025904 Ga0207647_10182091 Ga0207647_101820912 103
65 3300025904 Ga0207647_10246906 Ga0207647_102469063 103
66 3300025911 Ga0207654_10099782 Ga0207654_100997822 103
67 3300025913 Ga0207695_10252764 Ga0207695_102527642 103
68 3300025913 Ga0207695_10557127 Ga0207695_105571272 103
69 3300025914 Ga0207671_10456715 Ga0207671_104567152 103
70 3300025919 Ga0207657_10055561 Ga0207657_100555612 103
71 3300025919 Ga0207657_11394896 Ga0207657_113948961 103
72 3300025920 Ga0207649_10402064 Ga0207649_104020641 103
73 3300025924 Ga0207694_10033550 Ga0207694_100335505 103
74 3300025924 Ga0207694_10129059 Ga0207694_101290592 103
75 3300025932 Ga0207690_10126355 Ga0207690_101263553 103
76 3300025932 Ga0207690_10163017 Ga0207690_101630172 103
77 3300025933 Ga0207706_10303950 Ga0207706_103039502 103
78 3300025933 Ga0207706_10361124 Ga0207706_103611242 103
79 3300025945 Ga0207679_10270029 Ga0207679_102700293 103
80 3300025949 Ga0207667_10055718 Ga0207667_100557184 103
81 3300025949 Ga0207667_10662811 Ga0207667_106628112 103
82 3300025981 Ga0207640_10025772 Ga0207640_100257724 103
83 3300025981 Ga0207640_10050981 Ga0207640_100509814 103
84 3300026041 Ga0207639_10008273 Ga0207639_100082738 103
85 3300026041 Ga0207639_10083897 Ga0207639_100838972 103
86 3300026067 Ga0207678_10002196 Ga0207678_1000219618 103
87 3300026078 Ga0207702_10018798 Ga0207702_100187984 103
88 3300026116 Ga0207674_10235998 Ga0207674_102359982 103
89 3300026116 Ga0207674_10593308 Ga0207674_105933082 103
90 3300026116 Ga0207674_10593735 Ga0207674_105937353 103
91 3300026142 Ga0207698_10041720 Ga0207698_100417205 103
92 3300026142 Ga0207698_10353300 Ga0207698_103533002 103
93 3300026142 Ga0207698_10374075 Ga0207698_103740752 103
94 3300031548 Ga0307408_100015416 Ga0307408_1000154163 103
95 3300031548 Ga0307408_100064636 Ga0307408_1000646362 103
96 3300031731 Ga0307405_10035700 Ga0307405_100357004 103
97 3300031731 Ga0307405_10101234 Ga0307405_101012344 103
98 3300031731 Ga0307405_10321249 Ga0307405_103212492 103
99 3300031824 Ga0307413_10669663 Ga0307413_106696632 103
100 3300031852 Ga0307410_10113741 Ga0307410_101137412 103
101 3300031852 Ga0307410_10255922 Ga0307410_102559223 103
102 3300031901 Ga0307406_10038711 Ga0307406_100387113 103
103 3300031901 Ga0307406_10062871 Ga0307406_100628714 103
104 3300031903 Ga0307407_10199340 Ga0307407_101993402 103
105 3300031911 Ga0307412_10020470 Ga0307412_100204704 103
106 3300031911 Ga0307412_10054043 Ga0307412_100540434 103
107 3300031911 Ga0307412_10086124 Ga0307412_100861244 103
108 3300031995 Ga0307409_100252470 Ga0307409_1002524703 103
109 3300032002 Ga0307416_100065603 Ga0307416_1000656034 103
110 3300032002 Ga0307416_100076900 Ga0307416_1000769004 103
111 3300032004 Ga0307414_10002554 Ga0307414_100025542 103
112 3300032004 Ga0307414_10188779 Ga0307414_101887793 103
113 3300032004 Ga0307414_10591013 Ga0307414_105910132 103
114 3300032005 Ga0307411_10137692 Ga0307411_101376922 103
115 3300032005 Ga0307411_12060754 Ga0307411_120607542 103
116 3300041408 Ga0439453_0043972 Ga0439453_0043972_15_326 103
117 3300042125 Ga0450923_022840 Ga0450923_022840_430_741 103
118 3300042435 Ga0439434_0160347 Ga0439434_0160347_172_483 103
119 3300005335 Ga0070666_11221528 Ga0070666_112215282 104
120 3300005353 Ga0070669_101345870 Ga0070669_1013458701 104
121 3300006237 Ga0097621_102218505 Ga0097621_1022185052 104
122 3300009176 Ga0105242_11437964 Ga0105242_114379641 104
123 3300025901 Ga0207688_10283161 Ga0207688_102831612 104
124 3300025944 Ga0207661_11145200 Ga0207661_111452002 104
125 3300025981 Ga0207640_11462200 Ga0207640_114622002 104
126 3300028379 Ga0268266_11802285 Ga0268266_118022851 104
127 3300002070 JGI24750J21931_1007765 JGI24750J21931_10077651 105
128 3300002126 JGI24035J26624_1002194 JGI24035J26624_10021942 105
129 3300002239 JGI24034J26672_10005842 JGI24034J26672_100058422 105
130 3300005295 Ga0065707_10714410 Ga0065707_107144101 105
131 3300005327 Ga0070658_10095941 Ga0070658_100959413 105
132 3300005329 Ga0070683_100089380 Ga0070683_1000893806 105
133 3300005329 Ga0070683_100317402 Ga0070683_1003174022 105
134 3300005330 Ga0070690_100253524 Ga0070690_1002535241 105
135 3300005331 Ga0070670_100035594 Ga0070670_1000355943 105
136 3300005333 Ga0070677_10000029 Ga0070677_1000002940 105
137 3300005333 Ga0070677_10490872 Ga0070677_104908721 105
138 3300005334 Ga0068869_100598791 Ga0068869_1005987912 105
139 3300005335 Ga0070666_10007820 Ga0070666_100078202 105
140 3300005335 Ga0070666_10022575 Ga0070666_100225754 105
141 3300005338 Ga0068868_100000021 Ga0068868_10000002138 105
142 3300005339 Ga0070660_100000044 Ga0070660_10000004435 105
143 3300005339 Ga0070660_100399985 Ga0070660_1003999852 105
144 3300005340 Ga0070689_100112384 Ga0070689_1001123842 105
145 3300005344 Ga0070661_101373964 Ga0070661_1013739641 105
146 3300005345 Ga0070692_10329707 Ga0070692_103297072 105
147 3300005347 Ga0070668_100030352 Ga0070668_1000303524 105
148 3300005347 Ga0070668_100187976 Ga0070668_1001879763 105
149 3300005347 Ga0070668_101160607 Ga0070668_1011606071 105
150 3300005347 Ga0070668_101467268 Ga0070668_1014672681 105
151 3300005353 Ga0070669_100000302 Ga0070669_1000003029 105
152 3300005353 Ga0070669_100027501 Ga0070669_1000275014 105
153 3300005354 Ga0070675_100013240 Ga0070675_10001324010 105
154 3300005355 Ga0070671_100000089 Ga0070671_1000000894 105
155 3300005355 Ga0070671_100027007 Ga0070671_1000270075 105
156 3300005355 Ga0070671_100048974 Ga0070671_1000489742 105
157 3300005355 Ga0070671_101213904 Ga0070671_1012139042 105
158 3300005356 Ga0070674_100060786 Ga0070674_1000607865 105
159 3300005364 Ga0070673_101151429 Ga0070673_1011514292 105
160 3300005366 Ga0070659_100000027 Ga0070659_10000002762 105
161 3300005366 Ga0070659_100100384 Ga0070659_1001003842 105
162 3300005367 Ga0070667_100000339 Ga0070667_1000003399 105
163 3300005367 Ga0070667_100036542 Ga0070667_1000365423 105
164 3300005440 Ga0070705_100007579 Ga0070705_1000075795 105
165 3300005445 Ga0070708_100478569 Ga0070708_1004785692 105
166 3300005455 Ga0070663_100006821 Ga0070663_1000068211 105
167 3300005458 Ga0070681_11385463 Ga0070681_113854631 105
168 3300005466 Ga0070685_10582253 Ga0070685_105822531 105
169 3300005468 Ga0070707_101124955 Ga0070707_1011249551 105
170 3300005535 Ga0070684_100837242 Ga0070684_1008372421 105
171 3300005535 Ga0070684_101165502 Ga0070684_1011655021 105
172 3300005539 Ga0068853_100006228 Ga0068853_1000062287 105
173 3300005539 Ga0068853_100059754 Ga0068853_1000597542 105
174 3300005539 Ga0068853_100073184 Ga0068853_1000731843 105
175 3300005543 Ga0070672_101393476 Ga0070672_1013934761 105
176 3300005544 Ga0070686_100000152 Ga0070686_10000015243 105
177 3300005544 Ga0070686_100061175 Ga0070686_1000611752 105
178 3300005544 Ga0070686_100722485 Ga0070686_1007224851 105
179 3300005546 Ga0070696_100747400 Ga0070696_1007474002 105
180 3300005548 Ga0070665_100000354 Ga0070665_10000035461 105
181 3300005548 Ga0070665_100003716 Ga0070665_10000371612 105
182 3300005548 Ga0070665_100064614 Ga0070665_1000646148 105
183 3300005548 Ga0070665_100087460 Ga0070665_1000874603 105
184 3300005577 Ga0068857_100025646 Ga0068857_1000256462 105
185 3300005577 Ga0068857_100031849 Ga0068857_1000318491 105
186 3300005578 Ga0068854_100982130 Ga0068854_1009821301 105
187 3300005615 Ga0070702_101065470 Ga0070702_1010654701 105
188 3300005616 Ga0068852_100850347 Ga0068852_1008503471 105
189 3300005617 Ga0068859_100053025 Ga0068859_1000530252 105
190 3300005617 Ga0068859_100094489 Ga0068859_1000944894 105
191 3300005617 Ga0068859_100188434 Ga0068859_1001884343 105
192 3300005618 Ga0068864_100202885 Ga0068864_1002028852 105
193 3300005618 Ga0068864_100218506 Ga0068864_1002185063 105
194 3300005719 Ga0068861_100050668 Ga0068861_1000506681 105
195 3300005834 Ga0068851_10007576 Ga0068851_100075765 105
196 3300005841 Ga0068863_100011981 Ga0068863_1000119817 105
197 3300005841 Ga0068863_100044513 Ga0068863_1000445135 105
198 3300005841 Ga0068863_100047147 Ga0068863_1000471474 105
199 3300005842 Ga0068858_100014602 Ga0068858_1000146026 105
200 3300005842 Ga0068858_100017841 Ga0068858_1000178417 105
201 3300005842 Ga0068858_100045005 Ga0068858_1000450054 105
202 3300005843 Ga0068860_100000442 Ga0068860_1000004429 105
203 3300005843 Ga0068860_100034512 Ga0068860_1000345123 105
204 3300005843 Ga0068860_100036461 Ga0068860_1000364615 105
205 3300005843 Ga0068860_100043647 Ga0068860_1000436474 105
206 3300005844 Ga0068862_100037784 Ga0068862_1000377844 105
207 3300005844 Ga0068862_100333724 Ga0068862_1003337242 105
208 3300005844 Ga0068862_100412879 Ga0068862_1004128792 105
209 3300006237 Ga0097621_101143717 Ga0097621_1011437171 105
210 3300006353 Ga0075370_10717932 Ga0075370_107179321 105
211 3300006353 Ga0075370_10983115 Ga0075370_109831151 105
212 3300006358 Ga0068871_101467502 Ga0068871_1014675022 105
213 3300006871 Ga0075434_100214521 Ga0075434_1002145212 105
214 3300006931 Ga0097620_100053026 Ga0097620_1000530262 105
215 3300006931 Ga0097620_100094485 Ga0097620_1000944854 105
216 3300006931 Ga0097620_100188439 Ga0097620_1001884393 105
217 3300009093 Ga0105240_11643586 Ga0105240_116435862 105
218 3300009098 Ga0105245_10018640 Ga0105245_1001864012 105
219 3300009098 Ga0105245_10072857 Ga0105245_100728573 105
220 3300009098 Ga0105245_10569570 Ga0105245_105695702 105
221 3300009098 Ga0105245_11295574 Ga0105245_112955742 105
222 3300009098 Ga0105245_12065005 Ga0105245_120650051 105
223 3300009101 Ga0105247_10019007 Ga0105247_100190074 105
224 3300009101 Ga0105247_10443676 Ga0105247_104436762 105
225 3300009101 Ga0105247_11089900 Ga0105247_110899001 105
226 3300009174 Ga0105241_10708977 Ga0105241_107089771 105
227 3300009176 Ga0105242_11093837 Ga0105242_110938372 105
228 3300009177 Ga0105248_10015752 Ga0105248_100157523 105
229 3300009177 Ga0105248_10044388 Ga0105248_100443884 105
230 3300009551 Ga0105238_10062085 Ga0105238_100620856 105
231 3300009551 Ga0105238_10263286 Ga0105238_102632862 105
232 3300009553 Ga0105249_10042662 Ga0105249_100426624 105
233 3300009553 Ga0105249_11982383 Ga0105249_119823832 105
234 3300010375 Ga0105239_12141221 Ga0105239_121412212 105
235 3300011119 Ga0105246_11179323 Ga0105246_111793232 105
236 3300013100 Ga0157373_10358487 Ga0157373_103584872 105
237 3300013297 Ga0157378_12128775 Ga0157378_121287752 105
238 3300013307 Ga0157372_10939869 Ga0157372_109398692 105
239 3300013307 Ga0157372_11289991 Ga0157372_112899912 105
240 3300013308 Ga0157375_11218039 Ga0157375_112180391 105
241 3300013308 Ga0157375_11363184 Ga0157375_113631841 105
242 3300013308 Ga0157375_11576471 Ga0157375_115764711 105
243 3300013308 Ga0157375_12095565 Ga0157375_120955652 105
244 3300014325 Ga0163163_10345956 Ga0163163_103459562 105
245 3300014325 Ga0163163_11827380 Ga0163163_118273801 105
246 3300014326 Ga0157380_10044825 Ga0157380_100448252 105
247 3300014968 Ga0157379_10308188 Ga0157379_103081882 105
248 3300014968 Ga0157379_10556012 Ga0157379_105560122 105
249 3300014969 Ga0157376_11829537 Ga0157376_118295372 105
250 3300017792 Ga0163161_10022051 Ga0163161_100220512 105
251 3300021384 Ga0213876_10001018 Ga0213876_1000101811 105
252 3300021384 Ga0213876_10014853 Ga0213876_100148531 105
253 3300021384 Ga0213876_10034251 Ga0213876_100342514 105
254 3300025271 Ga0207666_1042055 Ga0207666_10420551 105
255 3300025290 Ga0207673_1034584 Ga0207673_10345841 105
256 3300025304 Ga0209257_1090848 Ga0209257_10908482 105
257 3300025315 Ga0207697_10010106 Ga0207697_100101062 105
258 3300025315 Ga0207697_10142458 Ga0207697_101424582 105
259 3300025893 Ga0207682_10000227 Ga0207682_100002276 105
260 3300025900 Ga0207710_10000513 Ga0207710_100005132 105
261 3300025900 Ga0207710_10125736 Ga0207710_101257362 105
262 3300025900 Ga0207710_10267054 Ga0207710_102670541 105
263 3300025903 Ga0207680_10011217 Ga0207680_100112172 105
264 3300025903 Ga0207680_10183177 Ga0207680_101831771 105
265 3300025903 Ga0207680_10189179 Ga0207680_101891791 105
266 3300025907 Ga0207645_10257210 Ga0207645_102572102 105
267 3300025909 Ga0207705_10064630 Ga0207705_100646303 105
268 3300025919 Ga0207657_10001409 Ga0207657_100014093 105
269 3300025919 Ga0207657_10109581 Ga0207657_101095813 105
270 3300025920 Ga0207649_11480257 Ga0207649_114802572 105
271 3300025923 Ga0207681_10000313 Ga0207681_1000031313 105
272 3300025923 Ga0207681_10021433 Ga0207681_100214334 105
273 3300025923 Ga0207681_11093144 Ga0207681_110931442 105
274 3300025925 Ga0207650_10019895 Ga0207650_100198953 105
275 3300025926 Ga0207659_10071778 Ga0207659_100717782 105
276 3300025927 Ga0207687_10084974 Ga0207687_100849742 105
277 3300025927 Ga0207687_10120521 Ga0207687_101205212 105
278 3300025927 Ga0207687_10675424 Ga0207687_106754242 105
279 3300025927 Ga0207687_10823251 Ga0207687_108232511 105
280 3300025927 Ga0207687_10933118 Ga0207687_109331182 105
281 3300025931 Ga0207644_10000005 Ga0207644_10000005155 105
282 3300025931 Ga0207644_10013740 Ga0207644_100137402 105
283 3300025932 Ga0207690_10000067 Ga0207690_1000006710 105
284 3300025932 Ga0207690_10044282 Ga0207690_100442822 105
285 3300025934 Ga0207686_10487418 Ga0207686_104874182 105
286 3300025935 Ga0207709_11783770 Ga0207709_117837701 105
287 3300025936 Ga0207670_10091323 Ga0207670_100913233 105
288 3300025936 Ga0207670_10610686 Ga0207670_106106862 105
289 3300025936 Ga0207670_11734240 Ga0207670_117342401 105
290 3300025940 Ga0207691_10294224 Ga0207691_102942242 105
291 3300025941 Ga0207711_10014451 Ga0207711_100144512 105
292 3300025941 Ga0207711_10137054 Ga0207711_101370542 105
293 3300025941 Ga0207711_10146883 Ga0207711_101468832 105
294 3300025941 Ga0207711_10350760 Ga0207711_103507602 105
295 3300025942 Ga0207689_10306458 Ga0207689_103064582 105
296 3300025960 Ga0207651_10540159 Ga0207651_105401592 105
297 3300025960 Ga0207651_11289131 Ga0207651_112891312 105
298 3300025961 Ga0207712_10006375 Ga0207712_100063753 105
299 3300025972 Ga0207668_10587175 Ga0207668_105871752 105
300 3300025972 Ga0207668_11695002 Ga0207668_116950022 105
301 3300025981 Ga0207640_10027521 Ga0207640_100275212 105
302 3300025981 Ga0207640_11306867 Ga0207640_113068671 105
303 3300025986 Ga0207658_10000492 Ga0207658_1000049234 105
304 3300025986 Ga0207658_10034006 Ga0207658_100340064 105
305 3300026023 Ga0207677_10000036 Ga0207677_1000003626 105
306 3300026035 Ga0207703_10000584 Ga0207703_100005842 105
307 3300026035 Ga0207703_10002816 Ga0207703_100028165 105
308 3300026035 Ga0207703_10142493 Ga0207703_101424932 105
309 3300026035 Ga0207703_11345807 Ga0207703_113458072 105
310 3300026041 Ga0207639_10186846 Ga0207639_101868464 105
311 3300026041 Ga0207639_10275822 Ga0207639_102758222 105
312 3300026041 Ga0207639_10703966 Ga0207639_107039662 105
313 3300026067 Ga0207678_10009989 Ga0207678_100099895 105
314 3300026075 Ga0207708_10593311 Ga0207708_105933112 105
315 3300026088 Ga0207641_10002999 Ga0207641_1000299916 105
316 3300026088 Ga0207641_10003551 Ga0207641_1000355110 105
317 3300026088 Ga0207641_10005625 Ga0207641_100056253 105
318 3300026088 Ga0207641_10064753 Ga0207641_100647532 105
319 3300026095 Ga0207676_10075645 Ga0207676_100756453 105
320 3300026095 Ga0207676_10168989 Ga0207676_101689892 105
321 3300026116 Ga0207674_10016473 Ga0207674_100164734 105
322 3300026116 Ga0207674_10041158 Ga0207674_100411585 105
323 3300026118 Ga0207675_100046576 Ga0207675_1000465764 105
324 3300026118 Ga0207675_101050901 Ga0207675_1010509011 105
325 3300026142 Ga0207698_10404539 Ga0207698_104045392 105
326 3300026142 Ga0207698_11130897 Ga0207698_111308972 105
327 3300028379 Ga0268266_10000093 Ga0268266_1000009355 105
328 3300028379 Ga0268266_10001503 Ga0268266_1000150321 105
329 3300028379 Ga0268266_10510842 Ga0268266_105108421 105
330 3300028380 Ga0268265_10026740 Ga0268265_100267404 105
331 3300028380 Ga0268265_10204400 Ga0268265_102044002 105
332 3300028381 Ga0268264_10000491 Ga0268264_1000049154 105
333 3300028381 Ga0268264_10012118 Ga0268264_100121187 105
334 3300028381 Ga0268264_10016923 Ga0268264_100169233 105
335 3300028381 Ga0268264_10034856 Ga0268264_100348563 105
336 3300031548 Ga0307408_100046898 Ga0307408_1000468984 105
337 3300031548 Ga0307408_100177669 Ga0307408_1001776691 105
338 3300031548 Ga0307408_100453161 Ga0307408_1004531612 105
339 3300031548 Ga0307408_100583147 Ga0307408_1005831472 105
340 3300031548 Ga0307408_100602506 Ga0307408_1006025061 105
341 3300031731 Ga0307405_10029938 Ga0307405_100299383 105
342 3300031731 Ga0307405_10069897 Ga0307405_100698972 105
343 3300031731 Ga0307405_10164296 Ga0307405_101642961 105
344 3300031731 Ga0307405_10299636 Ga0307405_102996361 105
345 3300031731 Ga0307405_11052656 Ga0307405_110526562 105
346 3300031731 Ga0307405_11264046 Ga0307405_112640461 105
347 3300031824 Ga0307413_10003300 Ga0307413_100033006 105
348 3300031824 Ga0307413_10394207 Ga0307413_103942071 105
349 3300031824 Ga0307413_12008410 Ga0307413_120084101 105
350 3300031852 Ga0307410_10034774 Ga0307410_100347744 105
351 3300031852 Ga0307410_10120313 Ga0307410_101203133 105
352 3300031852 Ga0307410_10137034 Ga0307410_101370341 105
353 3300031852 Ga0307410_10182851 Ga0307410_101828513 105
354 3300031852 Ga0307410_10247387 Ga0307410_102473873 105
355 3300031901 Ga0307406_10117288 Ga0307406_101172883 105
356 3300031901 Ga0307406_10183560 Ga0307406_101835602 105
357 3300031901 Ga0307406_11004374 Ga0307406_110043742 105
358 3300031901 Ga0307406_11102925 Ga0307406_111029252 105
359 3300031901 Ga0307406_11420293 Ga0307406_114202932 105
360 3300031903 Ga0307407_10014620 Ga0307407_100146204 105
361 3300031911 Ga0307412_10039562 Ga0307412_100395623 105
362 3300031911 Ga0307412_10199762 Ga0307412_101997622 105
363 3300031911 Ga0307412_11319358 Ga0307412_113193582 105
364 3300031911 Ga0307412_12151103 Ga0307412_121511032 105
365 3300031995 Ga0307409_100060181 Ga0307409_1000601812 105
366 3300031995 Ga0307409_100131247 Ga0307409_1001312473 105
367 3300032002 Ga0307416_100060285 Ga0307416_1000602852 105
368 3300032002 Ga0307416_100076519 Ga0307416_1000765192 105
369 3300032002 Ga0307416_100145623 Ga0307416_1001456233 105
370 3300032002 Ga0307416_100199179 Ga0307416_1001991791 105
371 3300032002 Ga0307416_100222654 Ga0307416_1002226542 105
372 3300032002 Ga0307416_100486038 Ga0307416_1004860382 105
373 3300032002 Ga0307416_100568006 Ga0307416_1005680062 105
374 3300032002 Ga0307416_100658113 Ga0307416_1006581132 105
375 3300032002 Ga0307416_100749547 Ga0307416_1007495472 105
376 3300032002 Ga0307416_100914935 Ga0307416_1009149352 105
377 3300032002 Ga0307416_101650109 Ga0307416_1016501092 105
378 3300032002 Ga0307416_101911438 Ga0307416_1019114381 105
379 3300032002 Ga0307416_103022283 Ga0307416_1030222832 105
380 3300032004 Ga0307414_10089065 Ga0307414_100890653 105
381 3300032004 Ga0307414_10628882 Ga0307414_106288822 105
382 3300032004 Ga0307414_11412330 Ga0307414_114123301 105
383 3300032004 Ga0307414_11417218 Ga0307414_114172181 105
384 3300032004 Ga0307414_12010614 Ga0307414_120106142 105
385 3300032005 Ga0307411_10005386 Ga0307411_100053862 105
386 3300032005 Ga0307411_10134930 Ga0307411_101349303 105
387 3300032005 Ga0307411_10207543 Ga0307411_102075432 105
388 3300032005 Ga0307411_11380615 Ga0307411_113806152 105
389 3300032005 Ga0307411_11521707 Ga0307411_115217071 105
390 3300032005 Ga0307411_11862368 Ga0307411_118623682 105
391 3300032005 Ga0307411_12009197 Ga0307411_120091971 105
392 3300032005 Ga0307411_12125514 Ga0307411_121255142 105
393 3300032005 Ga0307411_12163592 Ga0307411_121635921 105
394 3300032126 Ga0307415_100092229 Ga0307415_1000922292 105
395 3300032126 Ga0307415_100476367 Ga0307415_1004763672 105
396 3300032126 Ga0307415_100940192 Ga0307415_1009401921 105
397 3300032126 Ga0307415_101465201 Ga0307415_1014652012 105
398 3300033180 Ga0307510_10001552 Ga0307510_100015528 105
399 3300035112 Ga0373932_0017388 Ga0373932_0017388_317_634 105
400 3300035691 Ga0373931_0149807 Ga0373931_0149807_960_1277 105
401 3300037471 Ga0395905_0851301 Ga0395905_0851301_103_420 105
402 3300038443 Ga0395901_0701185 Ga0395901_0701185_267_584 105
403 3300039437 Ga0436365_0267983 Ga0436365_0267983_153_470 105
404 3300039437 Ga0436365_0794411 Ga0436365_0794411_65345_65662 105
405 3300039437 Ga0436365_1062590 Ga0436365_1062590_8107_8424 105
406 3300039437 Ga0436365_1444662 Ga0436365_1444662_3679_3996 105
407 3300039450 Ga0436363_0558578 Ga0436363_0558578_92_409 105
408 3300039450 Ga0436363_0875254 Ga0436363_0875254_131_448 105
409 3300039453 Ga0436362_0573919 Ga0436362_0573919_78_395 105
410 3300041441 Ga0451787_258347 Ga0451787_258347_126_443 105
411 3300041443 Ga0451789_0625612 Ga0451789_0625612_305_622 105
412 3300041452 Ga0451793_0509886 Ga0451793_0509886_561_878 105
413 3300041453 Ga0451797_0916757 Ga0451797_0916757_644_961 105
414 3300041463 Ga0451804_0257040 Ga0451804_0257040_195_512 105
415 3300041486 Ga0451807_1810464 Ga0451807_1810464_151_468 105
416 3300041505 Ga0451849_0266587 Ga0451849_0266587_45_362 105
417 3300041512 Ga0451853_0050215 Ga0451853_0050215_20_337 105
418 3300041512 Ga0451853_2208097 Ga0451853_2208097_149_466 105
419 3300044658 Ga0466972_0018060 Ga0466972_0018060_1491_1808 105
420 3300044693 Ga0466961_0013225 Ga0466961_0013225_3177_3494 105
421 3300044693 Ga0466961_0483542 Ga0466961_0483542_198_515 105
422 3300044694 Ga0466963_0005523 Ga0466963_0005523_4106_4423 105
423 3300044706 Ga0466964_0322539 Ga0466964_0322539_292_609 105
424 3300044719 Ga0466971_0053263 Ga0466971_0053263_856_1173 105
425 3300044842 Ga0466957_0003219 Ga0466957_0003219_6103_6420 105
426 3300045049 Ga0466959_0500535 Ga0466959_0500535_258_575 105
427 3300045836 Ga0466958_0008794 Ga0466958_0008794_3170_3487 105
428 3300045836 Ga0466958_0283927 Ga0466958_0283927_728_1045 105
429 3300045976 Ga0466967_0223477 Ga0466967_0223477_54_371 105
430 3300046491 Ga0495584_0104478 Ga0495584_0104478_933_1250 105
431 3300046519 Ga0495632_0000001 Ga0495632_0000001_95112_95429 105
432 3300046520 Ga0495637_0000108 Ga0495637_0000108_14538_14855 105
433 3300046522 Ga0495643_0000020 Ga0495643_0000020_79900_80217 105
434 3300046524 Ga0495648_0008519 Ga0495648_0008519_2591_2908 105
435 3300046525 Ga0495663_0000002 Ga0495663_0000002_93442_93759 105
436 3300046525 Ga0495663_0187526 Ga0495663_0187526_28_345 105
437 3300046530 Ga0495654_0010343 Ga0495654_0010343_3723_4040 105
438 3300046558 Ga0495633_0004517 Ga0495633_0004517_8384_8701 105
439 3300046616 Ga0495668_0176763 Ga0495668_0176763_184_501 105
440 3300046616 Ga0495668_0396850 Ga0495668_0396850_205_522 105
441 3300046660 Ga0495625_0068493 Ga0495625_0068493_2055_2372 105
442 3300046692 Ga0495671_0000016 Ga0495671_0000016_79900_80217 105
443 3300046694 Ga0495649_0480012 Ga0495649_0480012_228_545 105
444 3300047470 Ga0495681_0000929 Ga0495681_0000929_6557_6874 105
445 3300048091 Ga0495626_0035627 Ga0495626_0035627_353_670 105
446 3300048903 Ga0496100_1243446 Ga0496100_1243446_115_432 105
447 3300048904 Ga0496101_0038880 Ga0496101_0038880_2997_3314 105
448 3300048906 Ga0496103_0092291 Ga0496103_0092291_174_491 105
449 3300048907 Ga0496104_0404942 Ga0496104_0404942_910_1227 105
450 3300048908 Ga0496105_0039787 Ga0496105_0039787_971_1288 105
451 3300048909 Ga0496106_0001999 Ga0496106_0001999_7239_7556 105
452 3300048910 Ga0496107_0001507 Ga0496107_0001507_6023_6340 105
453 3300048911 Ga0496108_0185404 Ga0496108_0185404_129_446 105
454 3300048912 Ga0496109_0143028 Ga0496109_0143028_104_421 105
455 3300048912 Ga0496109_1450813 Ga0496109_1450813_85_402 105
456 3300048913 Ga0496110_0140483 Ga0496110_0140483_184_501 105
457 3300048914 Ga0496111_0127045 Ga0496111_0127045_759_1076 105
458 3300048914 Ga0496111_0768130 Ga0496111_0768130_235_552 105
459 3300048915 Ga0496112_0274807 Ga0496112_0274807_413_730 105
460 3300048916 Ga0496113_0003027 Ga0496113_0003027_6945_7262 105
461 3300048916 Ga0496113_0484610 Ga0496113_0484610_649_966 105
462 3300048918 Ga0496115_0153612 Ga0496115_0153612_219_536 105
463 3300048922 Ga0496119_0396769 Ga0496119_0396769_171_488 105
464 3300048924 Ga0496121_0000017 Ga0496121_0000017_151258_151575 105
465 3300048924 Ga0496121_0000114 Ga0496121_0000114_39655_39972 105
466 3300048927 Ga0496124_0253224 Ga0496124_0253224_461_778 105
467 3300048929 Ga0496126_0001667 Ga0496126_0001667_5652_5969 105
468 3300048929 Ga0496126_1116976 Ga0496126_1116976_167_484 105
469 3300049571 Ga0501034_0513801 Ga0501034_0513801_584_901 105
470 3300049573 Ga0501037_0838102 Ga0501037_0838102_176_493 105
471 3300049577 Ga0501041_0306569 Ga0501041_0306569_126_443 105
472 3300049579 Ga0501043_0642809 Ga0501043_0642809_342_659 105
473 3300049585 Ga0501069_0003915 Ga0501069_0003915_7123_7440 105
474 3300049586 Ga0501070_0151326 Ga0501070_0151326_442_759 105
475 3300049589 Ga0501073_0612516 Ga0501073_0612516_73_390 105
476 3300049590 Ga0501074_0459143 Ga0501074_0459143_422_739 105
477 3300049742 Ga0501080_0123075 Ga0501080_0123075_292_609 105
478 3300049742 Ga0501080_1443336 Ga0501080_1443336_220_537 105
479 3300050493 nmdc:mga0k408_117727_c1 nmdc:mga0k408_117727_c1_763_1080 105
480 3300050512 nmdc:mga0n895_458403_c1 nmdc:mga0n895_458403_c1_739_1056 105
481 3300053090 Ga0500646_0036084 Ga0500646_0036084_425_742 105
482 3300053116 Ga0500592_000009 Ga0500592_000009_52974_53291 105
483 3300053139 Ga0500568_0001425 Ga0500568_0001425_11669_11986 105
484 3300053151 Ga0500604_0000198 Ga0500604_0000198_16624_16941 105
485 3300053153 Ga0500616_0000238 Ga0500616_0000238_12881_13198 105
486 3300053158 Ga0500627_0000051 Ga0500627_0000051_50206_50523 105
487 3300053727 Ga0500611_029122 Ga0500611_029122_294_611 105
488 3300053739 Ga0500587_004826 Ga0500587_004826_275_592 105
489 3300061719 Ga0466962_0000640 Ga0466962_0000640_13585_13902 105
490 3300000549 LJQas_1004390 LJQas_10043902 106
491 3300005563 Ga0068855_100126842 Ga0068855_1001268424 106
492 3300005614 Ga0068856_100365384 Ga0068856_1003653841 106
493 3300005616 Ga0068852_100004899 Ga0068852_1000048997 106
494 3300009545 Ga0105237_12338945 Ga0105237_123389451 106
495 3300009551 Ga0105238_10945606 Ga0105238_109456062 106
496 3300013306 Ga0163162_10036722 Ga0163162_100367226 106
497 3300025924 Ga0207694_10733511 Ga0207694_107335111 106
498 3300025949 Ga0207667_10133329 Ga0207667_101333291 106
499 3300025961 Ga0207712_11278568 Ga0207712_112785681 106
500 3300025972 Ga0207668_10730617 Ga0207668_107306172 106
501 3300026041 Ga0207639_10003754 Ga0207639_100037545 106
502 3300026116 Ga0207674_10069626 Ga0207674_100696262 106
503 3300026142 Ga0207698_10018599 Ga0207698_100185992 106
504 3300032004 Ga0307414_10064532 Ga0307414_100645324 106
505 iso_pu_bacteria 2511231027 2511388212 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

8

93

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lxf-assembly1.cif.gz_A crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans 0.9963 4 106
3lxf-assembly1.cif.gz_A crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans 0.9774 4 106
2y5c-assembly2.cif.gz_B structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster 0.9692 2 101
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.9613 4 106
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.955 3 105
ID Description Score Start End Superfamily
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9971 4 106 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9781 4 106 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9767 2 103 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9613 4 106 3.10.20.30
af_M9ND39_2_143_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.96 4 18 3.30.710.10
ID Description Score Start End GO Terms
AF-A0A4Q3CB93-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 1.004 26 106 GO:0009055
GO:0051537
GO:0140647
AF-A0A419TFV9-F1-model_v4 deleted 1 1 106
AF-X5CWH9-F1-model_v4 Chloroacetanilide N-alkylformylase 2, ferredoxin component (Ferredoxin CndB2) 0.9994 3 106 GO:0009055
GO:0046872
GO:0051537
GO:0140647
AF-Q2G8A3-F1-model_v4 Ferredoxin 0.9993 2 106 GO:0009055
GO:0046872
GO:0051537
GO:0140647
AF-A0A0H0XV86-F1-model_v4 Ferredoxin 0.9989 3 106 GO:0009055
GO:0051537
GO:0140647

Feature Viewer

pLDDT pTM Quality
90.34 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map