F456327
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 505 | 249 | 492 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100126842|Ga0068855_1001268424 |
| Length | 107 |
| Sequence | MMAKLTIVDRAGEEKMVDGENGLSVMEIIRDNGLDELLSLCGGCCSCATCHVYVDESGFEGALPAVSADENDLLDSSDHRTAQSRLSCQIPFSEALDGLTVRIAPED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 2 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 3 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 4 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 5 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 6 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 7 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 8 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 9 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 10 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 11 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 12 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 13 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 14 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 15 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 169 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 175 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 176 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 177 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 184 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 185 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 186 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 187 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 192 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 226 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 227 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 239 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 241 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 242 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 243 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 244 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 245 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 246 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 247 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 248 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 249 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.43 |
| Metatranscriptomes | 0 |
| Isolates | 2.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.38 |
| Nodule | 0.59 |
| Rhizoplane | 4.75 |
| Rhizosphere | 87.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004390 | 3300000549 | Bacteria | 1840 |
| 2 | JGI24736J21556_1003769 | 3300001904 | Bacteria | 2612 |
| 3 | JGI24736J21556_1046320 | 3300001904 | Bacteria | 668 |
| 4 | JGI24741J21665_1002496 | 3300001915 | Bacteria | 4761 |
| 5 | JGI24740J21852_10011906 | 3300001979 | Bacteria | 3296 |
| 6 | JGI24740J21852_10018152 | 3300001979 | Bacteria | 2503 |
| 7 | JGI24739J22299_10002323 | 3300001989 | Bacteria | 7328 |
| 8 | JGI24739J22299_10021861 | 3300001989 | Bacteria | 2273 |
| 9 | JGI24737J22298_10075631 | 3300001990 | Bacteria | 1004 |
| 10 | JGI24737J22298_10076949 | 3300001990 | Bacteria | 994 |
| 11 | JGI24735J21928_10070174 | 3300002067 | Bacteria | 1004 |
| 12 | JGI24735J21928_10190321 | 3300002067 | Bacteria | 594 |
| 13 | JGI24750J21931_1007765 | 3300002070 | Bacteria | 1354 |
| 14 | JGI24738J21930_10006571 | 3300002075 | Bacteria | 2720 |
| 15 | JGI24738J21930_10012302 | 3300002075 | Bacteria | 1870 |
| 16 | JGI24035J26624_1002194 | 3300002126 | Bacteria | 1819 |
| 17 | JGI24034J26672_10005842 | 3300002239 | Bacteria | 1770 |
| 18 | Ga0065707_10714410 | 3300005295 | Bacteria | 622 |
| 19 | Ga0070658_10095941 | 3300005327 | Bacteria | 2448 |
| 20 | Ga0070683_100089380 | 3300005329 | Bacteria | 2891 |
| 21 | Ga0070683_100317402 | 3300005329 | Bacteria | 1483 |
| 22 | Ga0070690_100253524 | 3300005330 | Bacteria | 1245 |
| 23 | Ga0070670_100035594 | 3300005331 | Bacteria | 4285 |
| 24 | Ga0070677_10000029 | 3300005333 | Bacteria | 42300 |
| 25 | Ga0070677_10490872 | 3300005333 | Bacteria | 664 |
| 26 | Ga0068869_100598791 | 3300005334 | Bacteria | 931 |
| 27 | Ga0070666_10007820 | 3300005335 | Bacteria | 6602 |
| 28 | Ga0070666_10022575 | 3300005335 | Bacteria | 4087 |
| 29 | Ga0070666_11221528 | 3300005335 | Unclassified | 560 |
| 30 | Ga0068868_100000021 | 3300005338 | Bacteria | 89090 |
| 31 | Ga0070660_100000044 | 3300005339 | Bacteria | 71756 |
| 32 | Ga0070660_100399985 | 3300005339 | Bacteria | 1136 |
| 33 | Ga0070660_100430306 | 3300005339 | Bacteria | 1093 |
| 34 | Ga0070689_100112384 | 3300005340 | Bacteria | 2168 |
| 35 | Ga0070661_100145057 | 3300005344 | Bacteria | 1791 |
| 36 | Ga0070661_101373964 | 3300005344 | Bacteria | 594 |
| 37 | Ga0070692_10329707 | 3300005345 | Bacteria | 942 |
| 38 | Ga0070668_100030352 | 3300005347 | Bacteria | 4109 |
| 39 | Ga0070668_100187976 | 3300005347 | Bacteria | 1690 |
| 40 | Ga0070668_101160607 | 3300005347 | Bacteria | 699 |
| 41 | Ga0070668_101467268 | 3300005347 | Bacteria | 623 |
| 42 | Ga0070669_100000302 | 3300005353 | Bacteria | 38805 |
| 43 | Ga0070669_100027501 | 3300005353 | Bacteria | 4093 |
| 44 | Ga0070669_101345870 | 3300005353 | Unclassified | 619 |
| 45 | Ga0070675_100013240 | 3300005354 | Bacteria | 6483 |
| 46 | Ga0070671_100000089 | 3300005355 | Bacteria | 58283 |
| 47 | Ga0070671_100027007 | 3300005355 | Bacteria | 4723 |
| 48 | Ga0070671_100048974 | 3300005355 | Bacteria | 3516 |
| 49 | Ga0070671_101213904 | 3300005355 | Bacteria | 664 |
| 50 | Ga0070674_100060786 | 3300005356 | Bacteria | 2635 |
| 51 | Ga0070673_101151429 | 3300005364 | Bacteria | 726 |
| 52 | Ga0070659_100000027 | 3300005366 | Bacteria | 143469 |
| 53 | Ga0070659_100085590 | 3300005366 | Bacteria | 2521 |
| 54 | Ga0070659_100100384 | 3300005366 | Bacteria | 2329 |
| 55 | Ga0070667_100000339 | 3300005367 | Bacteria | 52285 |
| 56 | Ga0070667_100036542 | 3300005367 | Bacteria | 4118 |
| 57 | Ga0070705_100007579 | 3300005440 | Bacteria | 5347 |
| 58 | Ga0070708_100478569 | 3300005445 | Bacteria | 1175 |
| 59 | Ga0070663_100006821 | 3300005455 | Bacteria | 6905 |
| 60 | Ga0070663_100029648 | 3300005455 | Bacteria | 3741 |
| 61 | Ga0070662_100205847 | 3300005457 | Bacteria | 1563 |
| 62 | Ga0070681_11385463 | 3300005458 | Bacteria | 627 |
| 63 | Ga0070685_10582253 | 3300005466 | Bacteria | 803 |
| 64 | Ga0070707_101124955 | 3300005468 | Bacteria | 751 |
| 65 | Ga0070684_100837242 | 3300005535 | Bacteria | 861 |
| 66 | Ga0070684_101165502 | 3300005535 | Bacteria | 725 |
| 67 | Ga0068853_100006228 | 3300005539 | Bacteria | 9452 |
| 68 | Ga0068853_100059754 | 3300005539 | Bacteria | 3293 |
| 69 | Ga0068853_100073184 | 3300005539 | Bacteria | 2987 |
| 70 | Ga0068853_100344853 | 3300005539 | Bacteria | 1384 |
| 71 | Ga0068853_100462245 | 3300005539 | Bacteria | 1194 |
| 72 | Ga0068853_100851550 | 3300005539 | Bacteria | 874 |
| 73 | Ga0070672_101393476 | 3300005543 | Bacteria | 627 |
| 74 | Ga0070686_100000152 | 3300005544 | Bacteria | 47696 |
| 75 | Ga0070686_100061175 | 3300005544 | Bacteria | 2432 |
| 76 | Ga0070686_100722485 | 3300005544 | Bacteria | 796 |
| 77 | Ga0070696_100747400 | 3300005546 | Bacteria | 801 |
| 78 | Ga0070665_100000354 | 3300005548 | Bacteria | 68927 |
| 79 | Ga0070665_100003716 | 3300005548 | Bacteria | 16154 |
| 80 | Ga0070665_100064614 | 3300005548 | Bacteria | 3670 |
| 81 | Ga0070665_100087460 | 3300005548 | Bacteria | 3121 |
| 82 | Ga0068855_100126842 | 3300005563 | Bacteria | 2917 |
| 83 | Ga0068855_100137715 | 3300005563 | Bacteria | 2784 |
| 84 | Ga0070664_100171052 | 3300005564 | Bacteria | 1927 |
| 85 | Ga0068857_100025646 | 3300005577 | Bacteria | 5189 |
| 86 | Ga0068857_100031849 | 3300005577 | Bacteria | 4659 |
| 87 | Ga0068857_100197453 | 3300005577 | Bacteria | 1833 |
| 88 | Ga0068857_102393700 | 3300005577 | Bacteria | 518 |
| 89 | Ga0068854_100177304 | 3300005578 | Bacteria | 1662 |
| 90 | Ga0068854_100982130 | 3300005578 | Bacteria | 747 |
| 91 | Ga0068856_100033646 | 3300005614 | Bacteria | 5019 |
| 92 | Ga0068856_100365384 | 3300005614 | Bacteria | 1462 |
| 93 | Ga0070702_101065470 | 3300005615 | Bacteria | 644 |
| 94 | Ga0068852_100004899 | 3300005616 | Bacteria | 9506 |
| 95 | Ga0068852_100365360 | 3300005616 | Bacteria | 1412 |
| 96 | Ga0068852_100850347 | 3300005616 | Bacteria | 928 |
| 97 | Ga0068852_102020801 | 3300005616 | Bacteria | 598 |
| 98 | Ga0068859_100053025 | 3300005617 | Bacteria | 4078 |
| 99 | Ga0068859_100094489 | 3300005617 | Bacteria | 3042 |
| 100 | Ga0068859_100188434 | 3300005617 | Bacteria | 2147 |
| 101 | Ga0068864_100202885 | 3300005618 | Bacteria | 1822 |
| 102 | Ga0068864_100218506 | 3300005618 | Bacteria | 1758 |
| 103 | Ga0068861_100050668 | 3300005719 | Bacteria | 3149 |
| 104 | Ga0068851_10007576 | 3300005834 | Bacteria | 4990 |
| 105 | Ga0068851_10076894 | 3300005834 | Bacteria | 1736 |
| 106 | Ga0068851_10195547 | 3300005834 | Bacteria | 1126 |
| 107 | Ga0068863_100011981 | 3300005841 | Bacteria | 8380 |
| 108 | Ga0068863_100044513 | 3300005841 | Bacteria | 4213 |
| 109 | Ga0068863_100047147 | 3300005841 | Bacteria | 4089 |
| 110 | Ga0068858_100014602 | 3300005842 | Bacteria | 7398 |
| 111 | Ga0068858_100017841 | 3300005842 | Bacteria | 6646 |
| 112 | Ga0068858_100045005 | 3300005842 | Bacteria | 4090 |
| 113 | Ga0068860_100000442 | 3300005843 | Bacteria | 52295 |
| 114 | Ga0068860_100034512 | 3300005843 | Bacteria | 4853 |
| 115 | Ga0068860_100036461 | 3300005843 | Bacteria | 4711 |
| 116 | Ga0068860_100043647 | 3300005843 | Bacteria | 4276 |
| 117 | Ga0068862_100037784 | 3300005844 | Bacteria | 4093 |
| 118 | Ga0068862_100333724 | 3300005844 | Bacteria | 1403 |
| 119 | Ga0068862_100412879 | 3300005844 | Bacteria | 1265 |
| 120 | Ga0097621_101143717 | 3300006237 | Bacteria | 732 |
| 121 | Ga0097621_102218505 | 3300006237 | Unclassified | 525 |
| 122 | Ga0075370_10717932 | 3300006353 | Bacteria | 608 |
| 123 | Ga0075370_10983115 | 3300006353 | Bacteria | 517 |
| 124 | Ga0068871_101467502 | 3300006358 | Bacteria | 644 |
| 125 | Ga0075434_100214521 | 3300006871 | Bacteria | 1945 |
| 126 | Ga0097620_100053026 | 3300006931 | Bacteria | 4078 |
| 127 | Ga0097620_100094485 | 3300006931 | Bacteria | 3042 |
| 128 | Ga0097620_100188439 | 3300006931 | Bacteria | 2147 |
| 129 | Ga0105240_10266724 | 3300009093 | Bacteria | 1973 |
| 130 | Ga0105240_10399220 | 3300009093 | Bacteria | 1549 |
| 131 | Ga0105240_11643586 | 3300009093 | Bacteria | 671 |
| 132 | Ga0105245_10018640 | 3300009098 | Bacteria | 6069 |
| 133 | Ga0105245_10072857 | 3300009098 | Bacteria | 3122 |
| 134 | Ga0105245_10569570 | 3300009098 | Bacteria | 1156 |
| 135 | Ga0105245_11295574 | 3300009098 | Bacteria | 777 |
| 136 | Ga0105245_12065005 | 3300009098 | Bacteria | 623 |
| 137 | Ga0105247_10019007 | 3300009101 | Bacteria | 4127 |
| 138 | Ga0105247_10443676 | 3300009101 | Bacteria | 934 |
| 139 | Ga0105247_11089900 | 3300009101 | Bacteria | 629 |
| 140 | Ga0105241_10051454 | 3300009174 | Bacteria | 3141 |
| 141 | Ga0105241_10708977 | 3300009174 | Bacteria | 919 |
| 142 | Ga0105242_11093837 | 3300009176 | Bacteria | 811 |
| 143 | Ga0105242_11437964 | 3300009176 | Unclassified | 718 |
| 144 | Ga0105248_10015752 | 3300009177 | Bacteria | 8332 |
| 145 | Ga0105248_10044388 | 3300009177 | Bacteria | 4985 |
| 146 | Ga0105237_10053540 | 3300009545 | Bacteria | 4047 |
| 147 | Ga0105237_12338945 | 3300009545 | Bacteria | 544 |
| 148 | Ga0105238_10062085 | 3300009551 | Bacteria | 3738 |
| 149 | Ga0105238_10126544 | 3300009551 | Bacteria | 2533 |
| 150 | Ga0105238_10159234 | 3300009551 | Bacteria | 2233 |
| 151 | Ga0105238_10263286 | 3300009551 | Bacteria | 1704 |
| 152 | Ga0105238_10945606 | 3300009551 | Bacteria | 881 |
| 153 | Ga0105249_10042662 | 3300009553 | Bacteria | 4127 |
| 154 | Ga0105249_11982383 | 3300009553 | Bacteria | 655 |
| 155 | Ga0105239_10984702 | 3300010375 | Bacteria | 969 |
| 156 | Ga0105239_12141221 | 3300010375 | Bacteria | 650 |
| 157 | Ga0105246_11179323 | 3300011119 | Bacteria | 704 |
| 158 | Ga0157373_10199580 | 3300013100 | Bacteria | 1410 |
| 159 | Ga0157373_10358487 | 3300013100 | Bacteria | 1041 |
| 160 | Ga0157371_10319478 | 3300013102 | Bacteria | 1126 |
| 161 | Ga0157371_10338453 | 3300013102 | Bacteria | 1094 |
| 162 | Ga0157370_10013741 | 3300013104 | Bacteria | 8322 |
| 163 | Ga0157369_10220096 | 3300013105 | Bacteria | 1987 |
| 164 | Ga0157369_10982595 | 3300013105 | Bacteria | 864 |
| 165 | Ga0157378_12128775 | 3300013297 | Bacteria | 612 |
| 166 | Ga0163162_10036722 | 3300013306 | Bacteria | 4885 |
| 167 | Ga0157372_10265968 | 3300013307 | Bacteria | 1991 |
| 168 | Ga0157372_10832664 | 3300013307 | Bacteria | 1071 |
| 169 | Ga0157372_10939869 | 3300013307 | Bacteria | 1002 |
| 170 | Ga0157372_11289991 | 3300013307 | Bacteria | 843 |
| 171 | Ga0157375_11218039 | 3300013308 | Bacteria | 883 |
| 172 | Ga0157375_11363184 | 3300013308 | Bacteria | 835 |
| 173 | Ga0157375_11576471 | 3300013308 | Bacteria | 776 |
| 174 | Ga0157375_12095565 | 3300013308 | Bacteria | 673 |
| 175 | Ga0163163_10345956 | 3300014325 | Bacteria | 1542 |
| 176 | Ga0163163_11827380 | 3300014325 | Bacteria | 668 |
| 177 | Ga0157380_10044825 | 3300014326 | Bacteria | 3468 |
| 178 | Ga0157379_10308188 | 3300014968 | Bacteria | 1444 |
| 179 | Ga0157379_10556012 | 3300014968 | Bacteria | 1068 |
| 180 | Ga0157376_11829537 | 3300014969 | Bacteria | 644 |
| 181 | Ga0163161_10022051 | 3300017792 | Bacteria | 4481 |
| 182 | Ga0213876_10001018 | 3300021384 | Bacteria | 18185 |
| 183 | Ga0213876_10014853 | 3300021384 | Bacteria | 4127 |
| 184 | Ga0213876_10034251 | 3300021384 | Bacteria | 2678 |
| 185 | Ga0207666_1042055 | 3300025271 | Bacteria | 716 |
| 186 | Ga0207673_1034584 | 3300025290 | Bacteria | 704 |
| 187 | Ga0209257_1090848 | 3300025304 | Bacteria | 763 |
| 188 | Ga0207697_10010106 | 3300025315 | Bacteria | 4051 |
| 189 | Ga0207697_10142458 | 3300025315 | Bacteria | 1040 |
| 190 | Ga0207656_10015570 | 3300025321 | Bacteria | 2945 |
| 191 | Ga0207656_10054312 | 3300025321 | Bacteria | 1741 |
| 192 | Ga0207656_10082973 | 3300025321 | Bacteria | 1444 |
| 193 | Ga0207682_10000227 | 3300025893 | Bacteria | 25316 |
| 194 | Ga0207710_10000513 | 3300025900 | Bacteria | 24057 |
| 195 | Ga0207710_10125736 | 3300025900 | Bacteria | 1228 |
| 196 | Ga0207710_10267054 | 3300025900 | Bacteria | 859 |
| 197 | Ga0207688_10283161 | 3300025901 | Bacteria | 1010 |
| 198 | Ga0207680_10011217 | 3300025903 | Bacteria | 4519 |
| 199 | Ga0207680_10183177 | 3300025903 | Bacteria | 1417 |
| 200 | Ga0207680_10189179 | 3300025903 | Bacteria | 1396 |
| 201 | Ga0207647_10182091 | 3300025904 | Bacteria | 1220 |
| 202 | Ga0207647_10246906 | 3300025904 | Bacteria | 1024 |
| 203 | Ga0207645_10257210 | 3300025907 | Bacteria | 1156 |
| 204 | Ga0207705_10064630 | 3300025909 | Bacteria | 2644 |
| 205 | Ga0207654_10099782 | 3300025911 | Bacteria | 1787 |
| 206 | Ga0207695_10252764 | 3300025913 | Bacteria | 1661 |
| 207 | Ga0207695_10557127 | 3300025913 | Bacteria | 1028 |
| 208 | Ga0207671_10456715 | 3300025914 | Bacteria | 1018 |
| 209 | Ga0207657_10001409 | 3300025919 | Bacteria | 25657 |
| 210 | Ga0207657_10055561 | 3300025919 | Bacteria | 3419 |
| 211 | Ga0207657_10109581 | 3300025919 | Bacteria | 2282 |
| 212 | Ga0207657_11394896 | 3300025919 | Bacteria | 526 |
| 213 | Ga0207649_10402064 | 3300025920 | Bacteria | 1025 |
| 214 | Ga0207649_11480257 | 3300025920 | Bacteria | 537 |
| 215 | Ga0207681_10000313 | 3300025923 | Bacteria | 35417 |
| 216 | Ga0207681_10021433 | 3300025923 | Bacteria | 4107 |
| 217 | Ga0207681_11093144 | 3300025923 | Bacteria | 670 |
| 218 | Ga0207694_10033550 | 3300025924 | Bacteria | 3932 |
| 219 | Ga0207694_10129059 | 3300025924 | Bacteria | 2025 |
| 220 | Ga0207694_10733511 | 3300025924 | Bacteria | 834 |
| 221 | Ga0207650_10019895 | 3300025925 | Bacteria | 4725 |
| 222 | Ga0207659_10071778 | 3300025926 | Bacteria | 2529 |
| 223 | Ga0207687_10084974 | 3300025927 | Bacteria | 2295 |
| 224 | Ga0207687_10120521 | 3300025927 | Bacteria | 1961 |
| 225 | Ga0207687_10675424 | 3300025927 | Bacteria | 875 |
| 226 | Ga0207687_10823251 | 3300025927 | Bacteria | 792 |
| 227 | Ga0207687_10933118 | 3300025927 | Bacteria | 743 |
| 228 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 229 | Ga0207644_10013740 | 3300025931 | Bacteria | 5406 |
| 230 | Ga0207690_10000067 | 3300025932 | Bacteria | 91404 |
| 231 | Ga0207690_10044282 | 3300025932 | Bacteria | 2933 |
| 232 | Ga0207690_10126355 | 3300025932 | Bacteria | 1865 |
| 233 | Ga0207690_10163017 | 3300025932 | Bacteria | 1664 |
| 234 | Ga0207706_10303950 | 3300025933 | Bacteria | 1390 |
| 235 | Ga0207706_10361124 | 3300025933 | Bacteria | 1262 |
| 236 | Ga0207686_10487418 | 3300025934 | Bacteria | 954 |
| 237 | Ga0207709_11783770 | 3300025935 | Bacteria | 512 |
| 238 | Ga0207670_10091323 | 3300025936 | Bacteria | 2153 |
| 239 | Ga0207670_10610686 | 3300025936 | Bacteria | 896 |
| 240 | Ga0207670_11734240 | 3300025936 | Bacteria | 531 |
| 241 | Ga0207691_10294224 | 3300025940 | Bacteria | 1396 |
| 242 | Ga0207711_10014451 | 3300025941 | Bacteria | 6559 |
| 243 | Ga0207711_10137054 | 3300025941 | Bacteria | 2199 |
| 244 | Ga0207711_10146883 | 3300025941 | Bacteria | 2125 |
| 245 | Ga0207711_10350760 | 3300025941 | Bacteria | 1366 |
| 246 | Ga0207689_10306458 | 3300025942 | Bacteria | 1317 |
| 247 | Ga0207661_11145200 | 3300025944 | Bacteria | 716 |
| 248 | Ga0207679_10270029 | 3300025945 | Bacteria | 1454 |
| 249 | Ga0207667_10055718 | 3300025949 | Bacteria | 4155 |
| 250 | Ga0207667_10133329 | 3300025949 | Bacteria | 2559 |
| 251 | Ga0207667_10662811 | 3300025949 | Bacteria | 1048 |
| 252 | Ga0207651_10540159 | 3300025960 | Bacteria | 1012 |
| 253 | Ga0207651_11289131 | 3300025960 | Bacteria | 657 |
| 254 | Ga0207712_10006375 | 3300025961 | Bacteria | 7442 |
| 255 | Ga0207712_11278568 | 3300025961 | Bacteria | 655 |
| 256 | Ga0207668_10587175 | 3300025972 | Bacteria | 969 |
| 257 | Ga0207668_10730617 | 3300025972 | Bacteria | 872 |
| 258 | Ga0207668_11695002 | 3300025972 | Bacteria | 571 |
| 259 | Ga0207640_10025772 | 3300025981 | Bacteria | 3563 |
| 260 | Ga0207640_10027521 | 3300025981 | Bacteria | 3465 |
| 261 | Ga0207640_10050981 | 3300025981 | Bacteria | 2688 |
| 262 | Ga0207640_11306867 | 3300025981 | Bacteria | 648 |
| 263 | Ga0207640_11462200 | 3300025981 | Bacteria | 613 |
| 264 | Ga0207658_10000492 | 3300025986 | Bacteria | 36290 |
| 265 | Ga0207658_10034006 | 3300025986 | Bacteria | 3639 |
| 266 | Ga0207677_10000036 | 3300026023 | Bacteria | 115815 |
| 267 | Ga0207703_10000584 | 3300026035 | Bacteria | 37152 |
| 268 | Ga0207703_10002816 | 3300026035 | Bacteria | 14836 |
| 269 | Ga0207703_10142493 | 3300026035 | Bacteria | 2081 |
| 270 | Ga0207703_11345807 | 3300026035 | Bacteria | 687 |
| 271 | Ga0207639_10003754 | 3300026041 | Bacteria | 10220 |
| 272 | Ga0207639_10008273 | 3300026041 | Bacteria | 7127 |
| 273 | Ga0207639_10083897 | 3300026041 | Bacteria | 2530 |
| 274 | Ga0207639_10186846 | 3300026041 | Bacteria | 1767 |
| 275 | Ga0207639_10275822 | 3300026041 | Bacteria | 1477 |
| 276 | Ga0207639_10703966 | 3300026041 | Bacteria | 937 |
| 277 | Ga0207678_10002196 | 3300026067 | Bacteria | 17622 |
| 278 | Ga0207678_10009989 | 3300026067 | Bacteria | 8327 |
| 279 | Ga0207708_10593311 | 3300026075 | Bacteria | 938 |
| 280 | Ga0207702_10018798 | 3300026078 | Bacteria | 5715 |
| 281 | Ga0207641_10002999 | 3300026088 | Bacteria | 15251 |
| 282 | Ga0207641_10003551 | 3300026088 | Bacteria | 13782 |
| 283 | Ga0207641_10005625 | 3300026088 | Bacteria | 10678 |
| 284 | Ga0207641_10064753 | 3300026088 | Bacteria | 3125 |
| 285 | Ga0207676_10075645 | 3300026095 | Bacteria | 2717 |
| 286 | Ga0207676_10168989 | 3300026095 | Bacteria | 1903 |
| 287 | Ga0207674_10016473 | 3300026116 | Bacteria | 8089 |
| 288 | Ga0207674_10041158 | 3300026116 | Bacteria | 4780 |
| 289 | Ga0207674_10069626 | 3300026116 | Bacteria | 3538 |
| 290 | Ga0207674_10235998 | 3300026116 | Bacteria | 1776 |
| 291 | Ga0207674_10593308 | 3300026116 | Bacteria | 1070 |
| 292 | Ga0207674_10593735 | 3300026116 | Bacteria | 1070 |
| 293 | Ga0207675_100046576 | 3300026118 | Bacteria | 4051 |
| 294 | Ga0207675_101050901 | 3300026118 | Bacteria | 833 |
| 295 | Ga0207698_10018599 | 3300026142 | Bacteria | 4739 |
| 296 | Ga0207698_10041720 | 3300026142 | Bacteria | 3422 |
| 297 | Ga0207698_10353300 | 3300026142 | Bacteria | 1389 |
| 298 | Ga0207698_10374075 | 3300026142 | Bacteria | 1353 |
| 299 | Ga0207698_10404539 | 3300026142 | Bacteria | 1305 |
| 300 | Ga0207698_11130897 | 3300026142 | Bacteria | 796 |
| 301 | Ga0268266_10000093 | 3300028379 | Bacteria | 191879 |
| 302 | Ga0268266_10001503 | 3300028379 | Bacteria | 27580 |
| 303 | Ga0268266_10510842 | 3300028379 | Bacteria | 1148 |
| 304 | Ga0268266_11802285 | 3300028379 | Unclassified | 587 |
| 305 | Ga0268265_10026740 | 3300028380 | Bacteria | 4107 |
| 306 | Ga0268265_10204400 | 3300028380 | Bacteria | 1716 |
| 307 | Ga0268264_10000491 | 3300028381 | Bacteria | 52312 |
| 308 | Ga0268264_10012118 | 3300028381 | Bacteria | 7099 |
| 309 | Ga0268264_10016923 | 3300028381 | Bacteria | 5969 |
| 310 | Ga0268264_10034856 | 3300028381 | Bacteria | 4142 |
| 311 | Ga0307408_100015416 | 3300031548 | Bacteria | 5087 |
| 312 | Ga0307408_100046898 | 3300031548 | Bacteria | 3092 |
| 313 | Ga0307408_100064636 | 3300031548 | Bacteria | 2680 |
| 314 | Ga0307408_100177669 | 3300031548 | Bacteria | 1704 |
| 315 | Ga0307408_100453161 | 3300031548 | Bacteria | 1113 |
| 316 | Ga0307408_100583147 | 3300031548 | Bacteria | 991 |
| 317 | Ga0307408_100602506 | 3300031548 | Bacteria | 976 |
| 318 | Ga0307405_10029938 | 3300031731 | Bacteria | 3187 |
| 319 | Ga0307405_10035700 | 3300031731 | Bacteria | 2971 |
| 320 | Ga0307405_10069897 | 3300031731 | Bacteria | 2253 |
| 321 | Ga0307405_10101234 | 3300031731 | Bacteria | 1932 |
| 322 | Ga0307405_10164296 | 3300031731 | Bacteria | 1576 |
| 323 | Ga0307405_10299636 | 3300031731 | Bacteria | 1219 |
| 324 | Ga0307405_10321249 | 3300031731 | Bacteria | 1182 |
| 325 | Ga0307405_11052656 | 3300031731 | Bacteria | 697 |
| 326 | Ga0307405_11264046 | 3300031731 | Bacteria | 641 |
| 327 | Ga0307413_10003300 | 3300031824 | Bacteria | 6768 |
| 328 | Ga0307413_10394207 | 3300031824 | Bacteria | 1083 |
| 329 | Ga0307413_10669663 | 3300031824 | Bacteria | 858 |
| 330 | Ga0307413_12008410 | 3300031824 | Bacteria | 521 |
| 331 | Ga0307410_10034774 | 3300031852 | Bacteria | 3267 |
| 332 | Ga0307410_10113741 | 3300031852 | Bacteria | 1962 |
| 333 | Ga0307410_10120313 | 3300031852 | Bacteria | 1914 |
| 334 | Ga0307410_10137034 | 3300031852 | Bacteria | 1805 |
| 335 | Ga0307410_10182851 | 3300031852 | Bacteria | 1588 |
| 336 | Ga0307410_10247387 | 3300031852 | Bacteria | 1385 |
| 337 | Ga0307410_10255922 | 3300031852 | Bacteria | 1363 |
| 338 | Ga0307406_10038711 | 3300031901 | Bacteria | 2953 |
| 339 | Ga0307406_10062871 | 3300031901 | Bacteria | 2402 |
| 340 | Ga0307406_10117288 | 3300031901 | Bacteria | 1844 |
| 341 | Ga0307406_10183560 | 3300031901 | Bacteria | 1525 |
| 342 | Ga0307406_11004374 | 3300031901 | Bacteria | 716 |
| 343 | Ga0307406_11102925 | 3300031901 | Bacteria | 685 |
| 344 | Ga0307406_11420293 | 3300031901 | Bacteria | 609 |
| 345 | Ga0307407_10014620 | 3300031903 | Bacteria | 3851 |
| 346 | Ga0307407_10199340 | 3300031903 | Bacteria | 1340 |
| 347 | Ga0307412_10020470 | 3300031911 | Bacteria | 4026 |
| 348 | Ga0307412_10039562 | 3300031911 | Bacteria | 3045 |
| 349 | Ga0307412_10054043 | 3300031911 | Bacteria | 2664 |
| 350 | Ga0307412_10086124 | 3300031911 | Bacteria | 2185 |
| 351 | Ga0307412_10199762 | 3300031911 | Bacteria | 1517 |
| 352 | Ga0307412_11319358 | 3300031911 | Bacteria | 650 |
| 353 | Ga0307412_12151103 | 3300031911 | Bacteria | 519 |
| 354 | Ga0307409_100060181 | 3300031995 | Bacteria | 2960 |
| 355 | Ga0307409_100131247 | 3300031995 | Bacteria | 2141 |
| 356 | Ga0307409_100252470 | 3300031995 | Bacteria | 1613 |
| 357 | Ga0307416_100060285 | 3300032002 | Bacteria | 3089 |
| 358 | Ga0307416_100065603 | 3300032002 | Bacteria | 2984 |
| 359 | Ga0307416_100076519 | 3300032002 | Bacteria | 2805 |
| 360 | Ga0307416_100076900 | 3300032002 | Bacteria | 2800 |
| 361 | Ga0307416_100145623 | 3300032002 | Bacteria | 2162 |
| 362 | Ga0307416_100199179 | 3300032002 | Bacteria | 1898 |
| 363 | Ga0307416_100222654 | 3300032002 | Bacteria | 1811 |
| 364 | Ga0307416_100486038 | 3300032002 | Bacteria | 1296 |
| 365 | Ga0307416_100568006 | 3300032002 | Bacteria | 1210 |
| 366 | Ga0307416_100658113 | 3300032002 | Bacteria | 1133 |
| 367 | Ga0307416_100749547 | 3300032002 | Bacteria | 1069 |
| 368 | Ga0307416_100914935 | 3300032002 | Bacteria | 978 |
| 369 | Ga0307416_101650109 | 3300032002 | Bacteria | 746 |
| 370 | Ga0307416_101911438 | 3300032002 | Bacteria | 697 |
| 371 | Ga0307416_103022283 | 3300032002 | Bacteria | 563 |
| 372 | Ga0307414_10002554 | 3300032004 | Bacteria | 9572 |
| 373 | Ga0307414_10064532 | 3300032004 | Bacteria | 2608 |
| 374 | Ga0307414_10089065 | 3300032004 | Bacteria | 2286 |
| 375 | Ga0307414_10188779 | 3300032004 | Bacteria | 1665 |
| 376 | Ga0307414_10591013 | 3300032004 | Bacteria | 994 |
| 377 | Ga0307414_10628882 | 3300032004 | Bacteria | 966 |
| 378 | Ga0307414_11412330 | 3300032004 | Bacteria | 647 |
| 379 | Ga0307414_11417218 | 3300032004 | Bacteria | 646 |
| 380 | Ga0307414_12010614 | 3300032004 | Bacteria | 540 |
| 381 | Ga0307411_10005386 | 3300032005 | Bacteria | 6280 |
| 382 | Ga0307411_10134930 | 3300032005 | Bacteria | 1810 |
| 383 | Ga0307411_10137692 | 3300032005 | Bacteria | 1795 |
| 384 | Ga0307411_10207543 | 3300032005 | Bacteria | 1510 |
| 385 | Ga0307411_11380615 | 3300032005 | Bacteria | 644 |
| 386 | Ga0307411_11521707 | 3300032005 | Bacteria | 615 |
| 387 | Ga0307411_11862368 | 3300032005 | Bacteria | 559 |
| 388 | Ga0307411_12009197 | 3300032005 | Bacteria | 540 |
| 389 | Ga0307411_12060754 | 3300032005 | Unclassified | 533 |
| 390 | Ga0307411_12125514 | 3300032005 | Bacteria | 526 |
| 391 | Ga0307411_12163592 | 3300032005 | Bacteria | 521 |
| 392 | Ga0307415_100092229 | 3300032126 | Bacteria | 2196 |
| 393 | Ga0307415_100476367 | 3300032126 | Bacteria | 1086 |
| 394 | Ga0307415_100940192 | 3300032126 | Bacteria | 799 |
| 395 | Ga0307415_101465201 | 3300032126 | Bacteria | 652 |
| 396 | Ga0307510_10001552 | 3300033180 | Bacteria | 25413 |
| 397 | Ga0373932_0017388 | 3300035112 | Bacteria | 1845 |
| 398 | Ga0373931_0149807 | 3300035691 | Bacteria | 1359 |
| 399 | Ga0395905_0851301 | 3300037471 | Bacteria | 815 |
| 400 | Ga0395901_0701185 | 3300038443 | Bacteria | 1010 |
| 401 | Ga0436365_0267983 | 3300039437 | Bacteria | 981 |
| 402 | Ga0436365_0794411 | 3300039437 | Bacteria | 78184 |
| 403 | Ga0436365_1062590 | 3300039437 | Bacteria | 8527 |
| 404 | Ga0436365_1444662 | 3300039437 | Bacteria | 6184 |
| 405 | Ga0436363_0558578 | 3300039450 | Bacteria | 1201 |
| 406 | Ga0436363_0875254 | 3300039450 | Bacteria | 635 |
| 407 | Ga0436362_0573919 | 3300039453 | Bacteria | 843 |
| 408 | Ga0439453_0043972 | 3300041408 | Bacteria | 884 |
| 409 | Ga0451787_258347 | 3300041441 | Bacteria | 524 |
| 410 | Ga0451789_0625612 | 3300041443 | Bacteria | 802 |
| 411 | Ga0451793_0509886 | 3300041452 | Bacteria | 1202 |
| 412 | Ga0451797_0916757 | 3300041453 | Bacteria | 1027 |
| 413 | Ga0451804_0257040 | 3300041463 | Bacteria | 604 |
| 414 | Ga0451807_1810464 | 3300041486 | Bacteria | 714 |
| 415 | Ga0451841_1174666 | 3300041498 | Bacteria | 624 |
| 416 | Ga0451849_0266587 | 3300041505 | Bacteria | 864 |
| 417 | Ga0451853_0050215 | 3300041512 | Bacteria | 747 |
| 418 | Ga0451853_2208097 | 3300041512 | Bacteria | 726 |
| 419 | Ga0450923_022840 | 3300042125 | Bacteria | 1229 |
| 420 | Ga0439434_0160347 | 3300042435 | Bacteria | 747 |
| 421 | Ga0466972_0018060 | 3300044658 | Bacteria | 3528 |
| 422 | Ga0466961_0013225 | 3300044693 | Bacteria | 5281 |
| 423 | Ga0466961_0483542 | 3300044693 | Bacteria | 748 |
| 424 | Ga0466963_0005523 | 3300044694 | Bacteria | 7400 |
| 425 | Ga0466964_0322539 | 3300044706 | Bacteria | 785 |
| 426 | Ga0466971_0053263 | 3300044719 | Bacteria | 1823 |
| 427 | Ga0466957_0003219 | 3300044842 | Bacteria | 8930 |
| 428 | Ga0466959_0500535 | 3300045049 | Unclassified | 821 |
| 429 | Ga0466958_0008794 | 3300045836 | Bacteria | 5608 |
| 430 | Ga0466958_0283927 | 3300045836 | Bacteria | 1061 |
| 431 | Ga0466967_0223477 | 3300045976 | Bacteria | 1790 |
| 432 | Ga0495584_0104478 | 3300046491 | Bacteria | 1432 |
| 433 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 434 | Ga0495637_0000108 | 3300046520 | Bacteria | 60028 |
| 435 | Ga0495643_0000020 | 3300046522 | Bacteria | 294973 |
| 436 | Ga0495648_0008519 | 3300046524 | Bacteria | 8057 |
| 437 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 438 | Ga0495663_0187526 | 3300046525 | Bacteria | 718 |
| 439 | Ga0495654_0010343 | 3300046530 | Bacteria | 5077 |
| 440 | Ga0495633_0004517 | 3300046558 | Bacteria | 8801 |
| 441 | Ga0495633_0579809 | 3300046558 | Bacteria | 505 |
| 442 | Ga0495668_0176763 | 3300046616 | Bacteria | 1170 |
| 443 | Ga0495668_0396850 | 3300046616 | Bacteria | 758 |
| 444 | Ga0495625_0068493 | 3300046660 | Bacteria | 2495 |
| 445 | Ga0495671_0000016 | 3300046692 | Bacteria | 294821 |
| 446 | Ga0495649_0480012 | 3300046694 | Bacteria | 619 |
| 447 | Ga0495681_0000929 | 3300047470 | Bacteria | 22583 |
| 448 | Ga0495626_0035627 | 3300048091 | Bacteria | 2374 |
| 449 | Ga0496100_1243446 | 3300048903 | Bacteria | 587 |
| 450 | Ga0496101_0038880 | 3300048904 | Bacteria | 3380 |
| 451 | Ga0496103_0092291 | 3300048906 | Bacteria | 1911 |
| 452 | Ga0496104_0404942 | 3300048907 | Bacteria | 1276 |
| 453 | Ga0496105_0039787 | 3300048908 | Bacteria | 3876 |
| 454 | Ga0496106_0001999 | 3300048909 | Bacteria | 15340 |
| 455 | Ga0496107_0001507 | 3300048910 | Bacteria | 14463 |
| 456 | Ga0496108_0185404 | 3300048911 | Bacteria | 1802 |
| 457 | Ga0496109_0143028 | 3300048912 | Bacteria | 2237 |
| 458 | Ga0496109_1450813 | 3300048912 | Bacteria | 621 |
| 459 | Ga0496110_0140483 | 3300048913 | Bacteria | 2183 |
| 460 | Ga0496111_0127045 | 3300048914 | Bacteria | 1885 |
| 461 | Ga0496111_0768130 | 3300048914 | Bacteria | 698 |
| 462 | Ga0496112_0274807 | 3300048915 | Bacteria | 1632 |
| 463 | Ga0496113_0003027 | 3300048916 | Bacteria | 9962 |
| 464 | Ga0496113_0484610 | 3300048916 | Bacteria | 993 |
| 465 | Ga0496115_0153612 | 3300048918 | Bacteria | 1901 |
| 466 | Ga0496119_0396769 | 3300048922 | Bacteria | 659 |
| 467 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 468 | Ga0496121_0000114 | 3300048924 | Bacteria | 179427 |
| 469 | Ga0496124_0253224 | 3300048927 | Bacteria | 1301 |
| 470 | Ga0496126_0001667 | 3300048929 | Bacteria | 33333 |
| 471 | Ga0496126_1116976 | 3300048929 | Bacteria | 584 |
| 472 | Ga0501034_0513801 | 3300049571 | Bacteria | 1110 |
| 473 | Ga0501037_0838102 | 3300049573 | Bacteria | 605 |
| 474 | Ga0501041_0306569 | 3300049577 | Bacteria | 1001 |
| 475 | Ga0501043_0642809 | 3300049579 | Bacteria | 780 |
| 476 | Ga0501069_0003915 | 3300049585 | Bacteria | 7678 |
| 477 | Ga0501070_0151326 | 3300049586 | Bacteria | 1914 |
| 478 | Ga0501073_0612516 | 3300049589 | Unclassified | 752 |
| 479 | Ga0501074_0459143 | 3300049590 | Unclassified | 903 |
| 480 | Ga0501080_0123075 | 3300049742 | Bacteria | 2403 |
| 481 | Ga0501080_1443336 | 3300049742 | Bacteria | 586 |
| 482 | nmdc:mga0k408_117727_c1 | 3300050493 | Bacteria | 1572 |
| 483 | nmdc:mga0n895_458403_c1 | 3300050512 | Bacteria | 1287 |
| 484 | Ga0500646_0036084 | 3300053090 | Bacteria | 1376 |
| 485 | Ga0500592_000009 | 3300053116 | Bacteria | 87878 |
| 486 | Ga0500568_0001425 | 3300053139 | Bacteria | 15507 |
| 487 | Ga0500604_0000198 | 3300053151 | Bacteria | 17067 |
| 488 | Ga0500616_0000238 | 3300053153 | Bacteria | 86573 |
| 489 | Ga0500627_0000051 | 3300053158 | Bacteria | 56260 |
| 490 | Ga0500611_029122 | 3300053727 | Bacteria | 1127 |
| 491 | Ga0500587_004826 | 3300053739 | Bacteria | 1839 |
| 492 | Ga0466962_0000640 | 3300061719 | Bacteria | 15596 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041498 | Ga0451841_1174666 | Ga0451841_1174666_15_278 | 87 |
| 2 | 3300046558 | Ga0495633_0579809 | Ga0495633_0579809_211_483 | 90 |
| 3 | iso_pu_bacteria | 2516143018 | 2516206524 | 101 |
| 4 | iso_pu_bacteria | 2582581306 | 2585268355 | 101 |
| 5 | iso_pu_bacteria | 2582581866 | 2585397434 | 101 |
| 6 | iso_pu_bacteria | 2657244999 | 2657686193 | 101 |
| 7 | iso_pu_bacteria | 2724679232 | 2725946918 | 101 |
| 8 | iso_pu_bacteria | 2767802442 | 2770196092 | 101 |
| 9 | iso_pu_bacteria | 2802429268 | 2804755540 | 101 |
| 10 | iso_pu_bacteria | 2838661181 | 2838662590 | 101 |
| 11 | iso_pu_bacteria | 2848297114 | 2848297517 | 101 |
| 12 | iso_pu_bacteria | 2919138771 | 2919142812 | 101 |
| 13 | iso_pu_bacteria | 2919709256 | 2919713233 | 101 |
| 14 | iso_pu_bacteria | 643692032 | 643823490 | 101 |
| 15 | 3300001904 | JGI24736J21556_1003769 | JGI24736J21556_10037692 | 103 |
| 16 | 3300001904 | JGI24736J21556_1046320 | JGI24736J21556_10463201 | 103 |
| 17 | 3300001915 | JGI24741J21665_1002496 | JGI24741J21665_10024966 | 103 |
| 18 | 3300001979 | JGI24740J21852_10011906 | JGI24740J21852_100119061 | 103 |
| 19 | 3300001979 | JGI24740J21852_10018152 | JGI24740J21852_100181522 | 103 |
| 20 | 3300001989 | JGI24739J22299_10002323 | JGI24739J22299_100023232 | 103 |
| 21 | 3300001989 | JGI24739J22299_10021861 | JGI24739J22299_100218614 | 103 |
| 22 | 3300001990 | JGI24737J22298_10075631 | JGI24737J22298_100756311 | 103 |
| 23 | 3300001990 | JGI24737J22298_10076949 | JGI24737J22298_100769492 | 103 |
| 24 | 3300002067 | JGI24735J21928_10070174 | JGI24735J21928_100701741 | 103 |
| 25 | 3300002067 | JGI24735J21928_10190321 | JGI24735J21928_101903211 | 103 |
| 26 | 3300002075 | JGI24738J21930_10006571 | JGI24738J21930_100065712 | 103 |
| 27 | 3300002075 | JGI24738J21930_10012302 | JGI24738J21930_100123023 | 103 |
| 28 | 3300005339 | Ga0070660_100430306 | Ga0070660_1004303062 | 103 |
| 29 | 3300005344 | Ga0070661_100145057 | Ga0070661_1001450573 | 103 |
| 30 | 3300005366 | Ga0070659_100085590 | Ga0070659_1000855904 | 103 |
| 31 | 3300005455 | Ga0070663_100029648 | Ga0070663_1000296483 | 103 |
| 32 | 3300005457 | Ga0070662_100205847 | Ga0070662_1002058472 | 103 |
| 33 | 3300005539 | Ga0068853_100344853 | Ga0068853_1003448533 | 103 |
| 34 | 3300005539 | Ga0068853_100462245 | Ga0068853_1004622452 | 103 |
| 35 | 3300005539 | Ga0068853_100851550 | Ga0068853_1008515502 | 103 |
| 36 | 3300005563 | Ga0068855_100137715 | Ga0068855_1001377152 | 103 |
| 37 | 3300005564 | Ga0070664_100171052 | Ga0070664_1001710524 | 103 |
| 38 | 3300005577 | Ga0068857_100197453 | Ga0068857_1001974534 | 103 |
| 39 | 3300005577 | Ga0068857_102393700 | Ga0068857_1023937002 | 103 |
| 40 | 3300005578 | Ga0068854_100177304 | Ga0068854_1001773044 | 103 |
| 41 | 3300005614 | Ga0068856_100033646 | Ga0068856_1000336465 | 103 |
| 42 | 3300005616 | Ga0068852_100365360 | Ga0068852_1003653603 | 103 |
| 43 | 3300005616 | Ga0068852_102020801 | Ga0068852_1020208011 | 103 |
| 44 | 3300005834 | Ga0068851_10076894 | Ga0068851_100768942 | 103 |
| 45 | 3300005834 | Ga0068851_10195547 | Ga0068851_101955472 | 103 |
| 46 | 3300009093 | Ga0105240_10266724 | Ga0105240_102667243 | 103 |
| 47 | 3300009093 | Ga0105240_10399220 | Ga0105240_103992203 | 103 |
| 48 | 3300009174 | Ga0105241_10051454 | Ga0105241_100514545 | 103 |
| 49 | 3300009545 | Ga0105237_10053540 | Ga0105237_100535402 | 103 |
| 50 | 3300009551 | Ga0105238_10126544 | Ga0105238_101265443 | 103 |
| 51 | 3300009551 | Ga0105238_10159234 | Ga0105238_101592343 | 103 |
| 52 | 3300010375 | Ga0105239_10984702 | Ga0105239_109847022 | 103 |
| 53 | 3300013100 | Ga0157373_10199580 | Ga0157373_101995802 | 103 |
| 54 | 3300013102 | Ga0157371_10319478 | Ga0157371_103194783 | 103 |
| 55 | 3300013102 | Ga0157371_10338453 | Ga0157371_103384533 | 103 |
| 56 | 3300013104 | Ga0157370_10013741 | Ga0157370_100137418 | 103 |
| 57 | 3300013105 | Ga0157369_10220096 | Ga0157369_102200963 | 103 |
| 58 | 3300013105 | Ga0157369_10982595 | Ga0157369_109825952 | 103 |
| 59 | 3300013307 | Ga0157372_10265968 | Ga0157372_102659682 | 103 |
| 60 | 3300013307 | Ga0157372_10832664 | Ga0157372_108326642 | 103 |
| 61 | 3300025321 | Ga0207656_10015570 | Ga0207656_100155704 | 103 |
| 62 | 3300025321 | Ga0207656_10054312 | Ga0207656_100543122 | 103 |
| 63 | 3300025321 | Ga0207656_10082973 | Ga0207656_100829733 | 103 |
| 64 | 3300025904 | Ga0207647_10182091 | Ga0207647_101820912 | 103 |
| 65 | 3300025904 | Ga0207647_10246906 | Ga0207647_102469063 | 103 |
| 66 | 3300025911 | Ga0207654_10099782 | Ga0207654_100997822 | 103 |
| 67 | 3300025913 | Ga0207695_10252764 | Ga0207695_102527642 | 103 |
| 68 | 3300025913 | Ga0207695_10557127 | Ga0207695_105571272 | 103 |
| 69 | 3300025914 | Ga0207671_10456715 | Ga0207671_104567152 | 103 |
| 70 | 3300025919 | Ga0207657_10055561 | Ga0207657_100555612 | 103 |
| 71 | 3300025919 | Ga0207657_11394896 | Ga0207657_113948961 | 103 |
| 72 | 3300025920 | Ga0207649_10402064 | Ga0207649_104020641 | 103 |
| 73 | 3300025924 | Ga0207694_10033550 | Ga0207694_100335505 | 103 |
| 74 | 3300025924 | Ga0207694_10129059 | Ga0207694_101290592 | 103 |
| 75 | 3300025932 | Ga0207690_10126355 | Ga0207690_101263553 | 103 |
| 76 | 3300025932 | Ga0207690_10163017 | Ga0207690_101630172 | 103 |
| 77 | 3300025933 | Ga0207706_10303950 | Ga0207706_103039502 | 103 |
| 78 | 3300025933 | Ga0207706_10361124 | Ga0207706_103611242 | 103 |
| 79 | 3300025945 | Ga0207679_10270029 | Ga0207679_102700293 | 103 |
| 80 | 3300025949 | Ga0207667_10055718 | Ga0207667_100557184 | 103 |
| 81 | 3300025949 | Ga0207667_10662811 | Ga0207667_106628112 | 103 |
| 82 | 3300025981 | Ga0207640_10025772 | Ga0207640_100257724 | 103 |
| 83 | 3300025981 | Ga0207640_10050981 | Ga0207640_100509814 | 103 |
| 84 | 3300026041 | Ga0207639_10008273 | Ga0207639_100082738 | 103 |
| 85 | 3300026041 | Ga0207639_10083897 | Ga0207639_100838972 | 103 |
| 86 | 3300026067 | Ga0207678_10002196 | Ga0207678_1000219618 | 103 |
| 87 | 3300026078 | Ga0207702_10018798 | Ga0207702_100187984 | 103 |
| 88 | 3300026116 | Ga0207674_10235998 | Ga0207674_102359982 | 103 |
| 89 | 3300026116 | Ga0207674_10593308 | Ga0207674_105933082 | 103 |
| 90 | 3300026116 | Ga0207674_10593735 | Ga0207674_105937353 | 103 |
| 91 | 3300026142 | Ga0207698_10041720 | Ga0207698_100417205 | 103 |
| 92 | 3300026142 | Ga0207698_10353300 | Ga0207698_103533002 | 103 |
| 93 | 3300026142 | Ga0207698_10374075 | Ga0207698_103740752 | 103 |
| 94 | 3300031548 | Ga0307408_100015416 | Ga0307408_1000154163 | 103 |
| 95 | 3300031548 | Ga0307408_100064636 | Ga0307408_1000646362 | 103 |
| 96 | 3300031731 | Ga0307405_10035700 | Ga0307405_100357004 | 103 |
| 97 | 3300031731 | Ga0307405_10101234 | Ga0307405_101012344 | 103 |
| 98 | 3300031731 | Ga0307405_10321249 | Ga0307405_103212492 | 103 |
| 99 | 3300031824 | Ga0307413_10669663 | Ga0307413_106696632 | 103 |
| 100 | 3300031852 | Ga0307410_10113741 | Ga0307410_101137412 | 103 |
| 101 | 3300031852 | Ga0307410_10255922 | Ga0307410_102559223 | 103 |
| 102 | 3300031901 | Ga0307406_10038711 | Ga0307406_100387113 | 103 |
| 103 | 3300031901 | Ga0307406_10062871 | Ga0307406_100628714 | 103 |
| 104 | 3300031903 | Ga0307407_10199340 | Ga0307407_101993402 | 103 |
| 105 | 3300031911 | Ga0307412_10020470 | Ga0307412_100204704 | 103 |
| 106 | 3300031911 | Ga0307412_10054043 | Ga0307412_100540434 | 103 |
| 107 | 3300031911 | Ga0307412_10086124 | Ga0307412_100861244 | 103 |
| 108 | 3300031995 | Ga0307409_100252470 | Ga0307409_1002524703 | 103 |
| 109 | 3300032002 | Ga0307416_100065603 | Ga0307416_1000656034 | 103 |
| 110 | 3300032002 | Ga0307416_100076900 | Ga0307416_1000769004 | 103 |
| 111 | 3300032004 | Ga0307414_10002554 | Ga0307414_100025542 | 103 |
| 112 | 3300032004 | Ga0307414_10188779 | Ga0307414_101887793 | 103 |
| 113 | 3300032004 | Ga0307414_10591013 | Ga0307414_105910132 | 103 |
| 114 | 3300032005 | Ga0307411_10137692 | Ga0307411_101376922 | 103 |
| 115 | 3300032005 | Ga0307411_12060754 | Ga0307411_120607542 | 103 |
| 116 | 3300041408 | Ga0439453_0043972 | Ga0439453_0043972_15_326 | 103 |
| 117 | 3300042125 | Ga0450923_022840 | Ga0450923_022840_430_741 | 103 |
| 118 | 3300042435 | Ga0439434_0160347 | Ga0439434_0160347_172_483 | 103 |
| 119 | 3300005335 | Ga0070666_11221528 | Ga0070666_112215282 | 104 |
| 120 | 3300005353 | Ga0070669_101345870 | Ga0070669_1013458701 | 104 |
| 121 | 3300006237 | Ga0097621_102218505 | Ga0097621_1022185052 | 104 |
| 122 | 3300009176 | Ga0105242_11437964 | Ga0105242_114379641 | 104 |
| 123 | 3300025901 | Ga0207688_10283161 | Ga0207688_102831612 | 104 |
| 124 | 3300025944 | Ga0207661_11145200 | Ga0207661_111452002 | 104 |
| 125 | 3300025981 | Ga0207640_11462200 | Ga0207640_114622002 | 104 |
| 126 | 3300028379 | Ga0268266_11802285 | Ga0268266_118022851 | 104 |
| 127 | 3300002070 | JGI24750J21931_1007765 | JGI24750J21931_10077651 | 105 |
| 128 | 3300002126 | JGI24035J26624_1002194 | JGI24035J26624_10021942 | 105 |
| 129 | 3300002239 | JGI24034J26672_10005842 | JGI24034J26672_100058422 | 105 |
| 130 | 3300005295 | Ga0065707_10714410 | Ga0065707_107144101 | 105 |
| 131 | 3300005327 | Ga0070658_10095941 | Ga0070658_100959413 | 105 |
| 132 | 3300005329 | Ga0070683_100089380 | Ga0070683_1000893806 | 105 |
| 133 | 3300005329 | Ga0070683_100317402 | Ga0070683_1003174022 | 105 |
| 134 | 3300005330 | Ga0070690_100253524 | Ga0070690_1002535241 | 105 |
| 135 | 3300005331 | Ga0070670_100035594 | Ga0070670_1000355943 | 105 |
| 136 | 3300005333 | Ga0070677_10000029 | Ga0070677_1000002940 | 105 |
| 137 | 3300005333 | Ga0070677_10490872 | Ga0070677_104908721 | 105 |
| 138 | 3300005334 | Ga0068869_100598791 | Ga0068869_1005987912 | 105 |
| 139 | 3300005335 | Ga0070666_10007820 | Ga0070666_100078202 | 105 |
| 140 | 3300005335 | Ga0070666_10022575 | Ga0070666_100225754 | 105 |
| 141 | 3300005338 | Ga0068868_100000021 | Ga0068868_10000002138 | 105 |
| 142 | 3300005339 | Ga0070660_100000044 | Ga0070660_10000004435 | 105 |
| 143 | 3300005339 | Ga0070660_100399985 | Ga0070660_1003999852 | 105 |
| 144 | 3300005340 | Ga0070689_100112384 | Ga0070689_1001123842 | 105 |
| 145 | 3300005344 | Ga0070661_101373964 | Ga0070661_1013739641 | 105 |
| 146 | 3300005345 | Ga0070692_10329707 | Ga0070692_103297072 | 105 |
| 147 | 3300005347 | Ga0070668_100030352 | Ga0070668_1000303524 | 105 |
| 148 | 3300005347 | Ga0070668_100187976 | Ga0070668_1001879763 | 105 |
| 149 | 3300005347 | Ga0070668_101160607 | Ga0070668_1011606071 | 105 |
| 150 | 3300005347 | Ga0070668_101467268 | Ga0070668_1014672681 | 105 |
| 151 | 3300005353 | Ga0070669_100000302 | Ga0070669_1000003029 | 105 |
| 152 | 3300005353 | Ga0070669_100027501 | Ga0070669_1000275014 | 105 |
| 153 | 3300005354 | Ga0070675_100013240 | Ga0070675_10001324010 | 105 |
| 154 | 3300005355 | Ga0070671_100000089 | Ga0070671_1000000894 | 105 |
| 155 | 3300005355 | Ga0070671_100027007 | Ga0070671_1000270075 | 105 |
| 156 | 3300005355 | Ga0070671_100048974 | Ga0070671_1000489742 | 105 |
| 157 | 3300005355 | Ga0070671_101213904 | Ga0070671_1012139042 | 105 |
| 158 | 3300005356 | Ga0070674_100060786 | Ga0070674_1000607865 | 105 |
| 159 | 3300005364 | Ga0070673_101151429 | Ga0070673_1011514292 | 105 |
| 160 | 3300005366 | Ga0070659_100000027 | Ga0070659_10000002762 | 105 |
| 161 | 3300005366 | Ga0070659_100100384 | Ga0070659_1001003842 | 105 |
| 162 | 3300005367 | Ga0070667_100000339 | Ga0070667_1000003399 | 105 |
| 163 | 3300005367 | Ga0070667_100036542 | Ga0070667_1000365423 | 105 |
| 164 | 3300005440 | Ga0070705_100007579 | Ga0070705_1000075795 | 105 |
| 165 | 3300005445 | Ga0070708_100478569 | Ga0070708_1004785692 | 105 |
| 166 | 3300005455 | Ga0070663_100006821 | Ga0070663_1000068211 | 105 |
| 167 | 3300005458 | Ga0070681_11385463 | Ga0070681_113854631 | 105 |
| 168 | 3300005466 | Ga0070685_10582253 | Ga0070685_105822531 | 105 |
| 169 | 3300005468 | Ga0070707_101124955 | Ga0070707_1011249551 | 105 |
| 170 | 3300005535 | Ga0070684_100837242 | Ga0070684_1008372421 | 105 |
| 171 | 3300005535 | Ga0070684_101165502 | Ga0070684_1011655021 | 105 |
| 172 | 3300005539 | Ga0068853_100006228 | Ga0068853_1000062287 | 105 |
| 173 | 3300005539 | Ga0068853_100059754 | Ga0068853_1000597542 | 105 |
| 174 | 3300005539 | Ga0068853_100073184 | Ga0068853_1000731843 | 105 |
| 175 | 3300005543 | Ga0070672_101393476 | Ga0070672_1013934761 | 105 |
| 176 | 3300005544 | Ga0070686_100000152 | Ga0070686_10000015243 | 105 |
| 177 | 3300005544 | Ga0070686_100061175 | Ga0070686_1000611752 | 105 |
| 178 | 3300005544 | Ga0070686_100722485 | Ga0070686_1007224851 | 105 |
| 179 | 3300005546 | Ga0070696_100747400 | Ga0070696_1007474002 | 105 |
| 180 | 3300005548 | Ga0070665_100000354 | Ga0070665_10000035461 | 105 |
| 181 | 3300005548 | Ga0070665_100003716 | Ga0070665_10000371612 | 105 |
| 182 | 3300005548 | Ga0070665_100064614 | Ga0070665_1000646148 | 105 |
| 183 | 3300005548 | Ga0070665_100087460 | Ga0070665_1000874603 | 105 |
| 184 | 3300005577 | Ga0068857_100025646 | Ga0068857_1000256462 | 105 |
| 185 | 3300005577 | Ga0068857_100031849 | Ga0068857_1000318491 | 105 |
| 186 | 3300005578 | Ga0068854_100982130 | Ga0068854_1009821301 | 105 |
| 187 | 3300005615 | Ga0070702_101065470 | Ga0070702_1010654701 | 105 |
| 188 | 3300005616 | Ga0068852_100850347 | Ga0068852_1008503471 | 105 |
| 189 | 3300005617 | Ga0068859_100053025 | Ga0068859_1000530252 | 105 |
| 190 | 3300005617 | Ga0068859_100094489 | Ga0068859_1000944894 | 105 |
| 191 | 3300005617 | Ga0068859_100188434 | Ga0068859_1001884343 | 105 |
| 192 | 3300005618 | Ga0068864_100202885 | Ga0068864_1002028852 | 105 |
| 193 | 3300005618 | Ga0068864_100218506 | Ga0068864_1002185063 | 105 |
| 194 | 3300005719 | Ga0068861_100050668 | Ga0068861_1000506681 | 105 |
| 195 | 3300005834 | Ga0068851_10007576 | Ga0068851_100075765 | 105 |
| 196 | 3300005841 | Ga0068863_100011981 | Ga0068863_1000119817 | 105 |
| 197 | 3300005841 | Ga0068863_100044513 | Ga0068863_1000445135 | 105 |
| 198 | 3300005841 | Ga0068863_100047147 | Ga0068863_1000471474 | 105 |
| 199 | 3300005842 | Ga0068858_100014602 | Ga0068858_1000146026 | 105 |
| 200 | 3300005842 | Ga0068858_100017841 | Ga0068858_1000178417 | 105 |
| 201 | 3300005842 | Ga0068858_100045005 | Ga0068858_1000450054 | 105 |
| 202 | 3300005843 | Ga0068860_100000442 | Ga0068860_1000004429 | 105 |
| 203 | 3300005843 | Ga0068860_100034512 | Ga0068860_1000345123 | 105 |
| 204 | 3300005843 | Ga0068860_100036461 | Ga0068860_1000364615 | 105 |
| 205 | 3300005843 | Ga0068860_100043647 | Ga0068860_1000436474 | 105 |
| 206 | 3300005844 | Ga0068862_100037784 | Ga0068862_1000377844 | 105 |
| 207 | 3300005844 | Ga0068862_100333724 | Ga0068862_1003337242 | 105 |
| 208 | 3300005844 | Ga0068862_100412879 | Ga0068862_1004128792 | 105 |
| 209 | 3300006237 | Ga0097621_101143717 | Ga0097621_1011437171 | 105 |
| 210 | 3300006353 | Ga0075370_10717932 | Ga0075370_107179321 | 105 |
| 211 | 3300006353 | Ga0075370_10983115 | Ga0075370_109831151 | 105 |
| 212 | 3300006358 | Ga0068871_101467502 | Ga0068871_1014675022 | 105 |
| 213 | 3300006871 | Ga0075434_100214521 | Ga0075434_1002145212 | 105 |
| 214 | 3300006931 | Ga0097620_100053026 | Ga0097620_1000530262 | 105 |
| 215 | 3300006931 | Ga0097620_100094485 | Ga0097620_1000944854 | 105 |
| 216 | 3300006931 | Ga0097620_100188439 | Ga0097620_1001884393 | 105 |
| 217 | 3300009093 | Ga0105240_11643586 | Ga0105240_116435862 | 105 |
| 218 | 3300009098 | Ga0105245_10018640 | Ga0105245_1001864012 | 105 |
| 219 | 3300009098 | Ga0105245_10072857 | Ga0105245_100728573 | 105 |
| 220 | 3300009098 | Ga0105245_10569570 | Ga0105245_105695702 | 105 |
| 221 | 3300009098 | Ga0105245_11295574 | Ga0105245_112955742 | 105 |
| 222 | 3300009098 | Ga0105245_12065005 | Ga0105245_120650051 | 105 |
| 223 | 3300009101 | Ga0105247_10019007 | Ga0105247_100190074 | 105 |
| 224 | 3300009101 | Ga0105247_10443676 | Ga0105247_104436762 | 105 |
| 225 | 3300009101 | Ga0105247_11089900 | Ga0105247_110899001 | 105 |
| 226 | 3300009174 | Ga0105241_10708977 | Ga0105241_107089771 | 105 |
| 227 | 3300009176 | Ga0105242_11093837 | Ga0105242_110938372 | 105 |
| 228 | 3300009177 | Ga0105248_10015752 | Ga0105248_100157523 | 105 |
| 229 | 3300009177 | Ga0105248_10044388 | Ga0105248_100443884 | 105 |
| 230 | 3300009551 | Ga0105238_10062085 | Ga0105238_100620856 | 105 |
| 231 | 3300009551 | Ga0105238_10263286 | Ga0105238_102632862 | 105 |
| 232 | 3300009553 | Ga0105249_10042662 | Ga0105249_100426624 | 105 |
| 233 | 3300009553 | Ga0105249_11982383 | Ga0105249_119823832 | 105 |
| 234 | 3300010375 | Ga0105239_12141221 | Ga0105239_121412212 | 105 |
| 235 | 3300011119 | Ga0105246_11179323 | Ga0105246_111793232 | 105 |
| 236 | 3300013100 | Ga0157373_10358487 | Ga0157373_103584872 | 105 |
| 237 | 3300013297 | Ga0157378_12128775 | Ga0157378_121287752 | 105 |
| 238 | 3300013307 | Ga0157372_10939869 | Ga0157372_109398692 | 105 |
| 239 | 3300013307 | Ga0157372_11289991 | Ga0157372_112899912 | 105 |
| 240 | 3300013308 | Ga0157375_11218039 | Ga0157375_112180391 | 105 |
| 241 | 3300013308 | Ga0157375_11363184 | Ga0157375_113631841 | 105 |
| 242 | 3300013308 | Ga0157375_11576471 | Ga0157375_115764711 | 105 |
| 243 | 3300013308 | Ga0157375_12095565 | Ga0157375_120955652 | 105 |
| 244 | 3300014325 | Ga0163163_10345956 | Ga0163163_103459562 | 105 |
| 245 | 3300014325 | Ga0163163_11827380 | Ga0163163_118273801 | 105 |
| 246 | 3300014326 | Ga0157380_10044825 | Ga0157380_100448252 | 105 |
| 247 | 3300014968 | Ga0157379_10308188 | Ga0157379_103081882 | 105 |
| 248 | 3300014968 | Ga0157379_10556012 | Ga0157379_105560122 | 105 |
| 249 | 3300014969 | Ga0157376_11829537 | Ga0157376_118295372 | 105 |
| 250 | 3300017792 | Ga0163161_10022051 | Ga0163161_100220512 | 105 |
| 251 | 3300021384 | Ga0213876_10001018 | Ga0213876_1000101811 | 105 |
| 252 | 3300021384 | Ga0213876_10014853 | Ga0213876_100148531 | 105 |
| 253 | 3300021384 | Ga0213876_10034251 | Ga0213876_100342514 | 105 |
| 254 | 3300025271 | Ga0207666_1042055 | Ga0207666_10420551 | 105 |
| 255 | 3300025290 | Ga0207673_1034584 | Ga0207673_10345841 | 105 |
| 256 | 3300025304 | Ga0209257_1090848 | Ga0209257_10908482 | 105 |
| 257 | 3300025315 | Ga0207697_10010106 | Ga0207697_100101062 | 105 |
| 258 | 3300025315 | Ga0207697_10142458 | Ga0207697_101424582 | 105 |
| 259 | 3300025893 | Ga0207682_10000227 | Ga0207682_100002276 | 105 |
| 260 | 3300025900 | Ga0207710_10000513 | Ga0207710_100005132 | 105 |
| 261 | 3300025900 | Ga0207710_10125736 | Ga0207710_101257362 | 105 |
| 262 | 3300025900 | Ga0207710_10267054 | Ga0207710_102670541 | 105 |
| 263 | 3300025903 | Ga0207680_10011217 | Ga0207680_100112172 | 105 |
| 264 | 3300025903 | Ga0207680_10183177 | Ga0207680_101831771 | 105 |
| 265 | 3300025903 | Ga0207680_10189179 | Ga0207680_101891791 | 105 |
| 266 | 3300025907 | Ga0207645_10257210 | Ga0207645_102572102 | 105 |
| 267 | 3300025909 | Ga0207705_10064630 | Ga0207705_100646303 | 105 |
| 268 | 3300025919 | Ga0207657_10001409 | Ga0207657_100014093 | 105 |
| 269 | 3300025919 | Ga0207657_10109581 | Ga0207657_101095813 | 105 |
| 270 | 3300025920 | Ga0207649_11480257 | Ga0207649_114802572 | 105 |
| 271 | 3300025923 | Ga0207681_10000313 | Ga0207681_1000031313 | 105 |
| 272 | 3300025923 | Ga0207681_10021433 | Ga0207681_100214334 | 105 |
| 273 | 3300025923 | Ga0207681_11093144 | Ga0207681_110931442 | 105 |
| 274 | 3300025925 | Ga0207650_10019895 | Ga0207650_100198953 | 105 |
| 275 | 3300025926 | Ga0207659_10071778 | Ga0207659_100717782 | 105 |
| 276 | 3300025927 | Ga0207687_10084974 | Ga0207687_100849742 | 105 |
| 277 | 3300025927 | Ga0207687_10120521 | Ga0207687_101205212 | 105 |
| 278 | 3300025927 | Ga0207687_10675424 | Ga0207687_106754242 | 105 |
| 279 | 3300025927 | Ga0207687_10823251 | Ga0207687_108232511 | 105 |
| 280 | 3300025927 | Ga0207687_10933118 | Ga0207687_109331182 | 105 |
| 281 | 3300025931 | Ga0207644_10000005 | Ga0207644_10000005155 | 105 |
| 282 | 3300025931 | Ga0207644_10013740 | Ga0207644_100137402 | 105 |
| 283 | 3300025932 | Ga0207690_10000067 | Ga0207690_1000006710 | 105 |
| 284 | 3300025932 | Ga0207690_10044282 | Ga0207690_100442822 | 105 |
| 285 | 3300025934 | Ga0207686_10487418 | Ga0207686_104874182 | 105 |
| 286 | 3300025935 | Ga0207709_11783770 | Ga0207709_117837701 | 105 |
| 287 | 3300025936 | Ga0207670_10091323 | Ga0207670_100913233 | 105 |
| 288 | 3300025936 | Ga0207670_10610686 | Ga0207670_106106862 | 105 |
| 289 | 3300025936 | Ga0207670_11734240 | Ga0207670_117342401 | 105 |
| 290 | 3300025940 | Ga0207691_10294224 | Ga0207691_102942242 | 105 |
| 291 | 3300025941 | Ga0207711_10014451 | Ga0207711_100144512 | 105 |
| 292 | 3300025941 | Ga0207711_10137054 | Ga0207711_101370542 | 105 |
| 293 | 3300025941 | Ga0207711_10146883 | Ga0207711_101468832 | 105 |
| 294 | 3300025941 | Ga0207711_10350760 | Ga0207711_103507602 | 105 |
| 295 | 3300025942 | Ga0207689_10306458 | Ga0207689_103064582 | 105 |
| 296 | 3300025960 | Ga0207651_10540159 | Ga0207651_105401592 | 105 |
| 297 | 3300025960 | Ga0207651_11289131 | Ga0207651_112891312 | 105 |
| 298 | 3300025961 | Ga0207712_10006375 | Ga0207712_100063753 | 105 |
| 299 | 3300025972 | Ga0207668_10587175 | Ga0207668_105871752 | 105 |
| 300 | 3300025972 | Ga0207668_11695002 | Ga0207668_116950022 | 105 |
| 301 | 3300025981 | Ga0207640_10027521 | Ga0207640_100275212 | 105 |
| 302 | 3300025981 | Ga0207640_11306867 | Ga0207640_113068671 | 105 |
| 303 | 3300025986 | Ga0207658_10000492 | Ga0207658_1000049234 | 105 |
| 304 | 3300025986 | Ga0207658_10034006 | Ga0207658_100340064 | 105 |
| 305 | 3300026023 | Ga0207677_10000036 | Ga0207677_1000003626 | 105 |
| 306 | 3300026035 | Ga0207703_10000584 | Ga0207703_100005842 | 105 |
| 307 | 3300026035 | Ga0207703_10002816 | Ga0207703_100028165 | 105 |
| 308 | 3300026035 | Ga0207703_10142493 | Ga0207703_101424932 | 105 |
| 309 | 3300026035 | Ga0207703_11345807 | Ga0207703_113458072 | 105 |
| 310 | 3300026041 | Ga0207639_10186846 | Ga0207639_101868464 | 105 |
| 311 | 3300026041 | Ga0207639_10275822 | Ga0207639_102758222 | 105 |
| 312 | 3300026041 | Ga0207639_10703966 | Ga0207639_107039662 | 105 |
| 313 | 3300026067 | Ga0207678_10009989 | Ga0207678_100099895 | 105 |
| 314 | 3300026075 | Ga0207708_10593311 | Ga0207708_105933112 | 105 |
| 315 | 3300026088 | Ga0207641_10002999 | Ga0207641_1000299916 | 105 |
| 316 | 3300026088 | Ga0207641_10003551 | Ga0207641_1000355110 | 105 |
| 317 | 3300026088 | Ga0207641_10005625 | Ga0207641_100056253 | 105 |
| 318 | 3300026088 | Ga0207641_10064753 | Ga0207641_100647532 | 105 |
| 319 | 3300026095 | Ga0207676_10075645 | Ga0207676_100756453 | 105 |
| 320 | 3300026095 | Ga0207676_10168989 | Ga0207676_101689892 | 105 |
| 321 | 3300026116 | Ga0207674_10016473 | Ga0207674_100164734 | 105 |
| 322 | 3300026116 | Ga0207674_10041158 | Ga0207674_100411585 | 105 |
| 323 | 3300026118 | Ga0207675_100046576 | Ga0207675_1000465764 | 105 |
| 324 | 3300026118 | Ga0207675_101050901 | Ga0207675_1010509011 | 105 |
| 325 | 3300026142 | Ga0207698_10404539 | Ga0207698_104045392 | 105 |
| 326 | 3300026142 | Ga0207698_11130897 | Ga0207698_111308972 | 105 |
| 327 | 3300028379 | Ga0268266_10000093 | Ga0268266_1000009355 | 105 |
| 328 | 3300028379 | Ga0268266_10001503 | Ga0268266_1000150321 | 105 |
| 329 | 3300028379 | Ga0268266_10510842 | Ga0268266_105108421 | 105 |
| 330 | 3300028380 | Ga0268265_10026740 | Ga0268265_100267404 | 105 |
| 331 | 3300028380 | Ga0268265_10204400 | Ga0268265_102044002 | 105 |
| 332 | 3300028381 | Ga0268264_10000491 | Ga0268264_1000049154 | 105 |
| 333 | 3300028381 | Ga0268264_10012118 | Ga0268264_100121187 | 105 |
| 334 | 3300028381 | Ga0268264_10016923 | Ga0268264_100169233 | 105 |
| 335 | 3300028381 | Ga0268264_10034856 | Ga0268264_100348563 | 105 |
| 336 | 3300031548 | Ga0307408_100046898 | Ga0307408_1000468984 | 105 |
| 337 | 3300031548 | Ga0307408_100177669 | Ga0307408_1001776691 | 105 |
| 338 | 3300031548 | Ga0307408_100453161 | Ga0307408_1004531612 | 105 |
| 339 | 3300031548 | Ga0307408_100583147 | Ga0307408_1005831472 | 105 |
| 340 | 3300031548 | Ga0307408_100602506 | Ga0307408_1006025061 | 105 |
| 341 | 3300031731 | Ga0307405_10029938 | Ga0307405_100299383 | 105 |
| 342 | 3300031731 | Ga0307405_10069897 | Ga0307405_100698972 | 105 |
| 343 | 3300031731 | Ga0307405_10164296 | Ga0307405_101642961 | 105 |
| 344 | 3300031731 | Ga0307405_10299636 | Ga0307405_102996361 | 105 |
| 345 | 3300031731 | Ga0307405_11052656 | Ga0307405_110526562 | 105 |
| 346 | 3300031731 | Ga0307405_11264046 | Ga0307405_112640461 | 105 |
| 347 | 3300031824 | Ga0307413_10003300 | Ga0307413_100033006 | 105 |
| 348 | 3300031824 | Ga0307413_10394207 | Ga0307413_103942071 | 105 |
| 349 | 3300031824 | Ga0307413_12008410 | Ga0307413_120084101 | 105 |
| 350 | 3300031852 | Ga0307410_10034774 | Ga0307410_100347744 | 105 |
| 351 | 3300031852 | Ga0307410_10120313 | Ga0307410_101203133 | 105 |
| 352 | 3300031852 | Ga0307410_10137034 | Ga0307410_101370341 | 105 |
| 353 | 3300031852 | Ga0307410_10182851 | Ga0307410_101828513 | 105 |
| 354 | 3300031852 | Ga0307410_10247387 | Ga0307410_102473873 | 105 |
| 355 | 3300031901 | Ga0307406_10117288 | Ga0307406_101172883 | 105 |
| 356 | 3300031901 | Ga0307406_10183560 | Ga0307406_101835602 | 105 |
| 357 | 3300031901 | Ga0307406_11004374 | Ga0307406_110043742 | 105 |
| 358 | 3300031901 | Ga0307406_11102925 | Ga0307406_111029252 | 105 |
| 359 | 3300031901 | Ga0307406_11420293 | Ga0307406_114202932 | 105 |
| 360 | 3300031903 | Ga0307407_10014620 | Ga0307407_100146204 | 105 |
| 361 | 3300031911 | Ga0307412_10039562 | Ga0307412_100395623 | 105 |
| 362 | 3300031911 | Ga0307412_10199762 | Ga0307412_101997622 | 105 |
| 363 | 3300031911 | Ga0307412_11319358 | Ga0307412_113193582 | 105 |
| 364 | 3300031911 | Ga0307412_12151103 | Ga0307412_121511032 | 105 |
| 365 | 3300031995 | Ga0307409_100060181 | Ga0307409_1000601812 | 105 |
| 366 | 3300031995 | Ga0307409_100131247 | Ga0307409_1001312473 | 105 |
| 367 | 3300032002 | Ga0307416_100060285 | Ga0307416_1000602852 | 105 |
| 368 | 3300032002 | Ga0307416_100076519 | Ga0307416_1000765192 | 105 |
| 369 | 3300032002 | Ga0307416_100145623 | Ga0307416_1001456233 | 105 |
| 370 | 3300032002 | Ga0307416_100199179 | Ga0307416_1001991791 | 105 |
| 371 | 3300032002 | Ga0307416_100222654 | Ga0307416_1002226542 | 105 |
| 372 | 3300032002 | Ga0307416_100486038 | Ga0307416_1004860382 | 105 |
| 373 | 3300032002 | Ga0307416_100568006 | Ga0307416_1005680062 | 105 |
| 374 | 3300032002 | Ga0307416_100658113 | Ga0307416_1006581132 | 105 |
| 375 | 3300032002 | Ga0307416_100749547 | Ga0307416_1007495472 | 105 |
| 376 | 3300032002 | Ga0307416_100914935 | Ga0307416_1009149352 | 105 |
| 377 | 3300032002 | Ga0307416_101650109 | Ga0307416_1016501092 | 105 |
| 378 | 3300032002 | Ga0307416_101911438 | Ga0307416_1019114381 | 105 |
| 379 | 3300032002 | Ga0307416_103022283 | Ga0307416_1030222832 | 105 |
| 380 | 3300032004 | Ga0307414_10089065 | Ga0307414_100890653 | 105 |
| 381 | 3300032004 | Ga0307414_10628882 | Ga0307414_106288822 | 105 |
| 382 | 3300032004 | Ga0307414_11412330 | Ga0307414_114123301 | 105 |
| 383 | 3300032004 | Ga0307414_11417218 | Ga0307414_114172181 | 105 |
| 384 | 3300032004 | Ga0307414_12010614 | Ga0307414_120106142 | 105 |
| 385 | 3300032005 | Ga0307411_10005386 | Ga0307411_100053862 | 105 |
| 386 | 3300032005 | Ga0307411_10134930 | Ga0307411_101349303 | 105 |
| 387 | 3300032005 | Ga0307411_10207543 | Ga0307411_102075432 | 105 |
| 388 | 3300032005 | Ga0307411_11380615 | Ga0307411_113806152 | 105 |
| 389 | 3300032005 | Ga0307411_11521707 | Ga0307411_115217071 | 105 |
| 390 | 3300032005 | Ga0307411_11862368 | Ga0307411_118623682 | 105 |
| 391 | 3300032005 | Ga0307411_12009197 | Ga0307411_120091971 | 105 |
| 392 | 3300032005 | Ga0307411_12125514 | Ga0307411_121255142 | 105 |
| 393 | 3300032005 | Ga0307411_12163592 | Ga0307411_121635921 | 105 |
| 394 | 3300032126 | Ga0307415_100092229 | Ga0307415_1000922292 | 105 |
| 395 | 3300032126 | Ga0307415_100476367 | Ga0307415_1004763672 | 105 |
| 396 | 3300032126 | Ga0307415_100940192 | Ga0307415_1009401921 | 105 |
| 397 | 3300032126 | Ga0307415_101465201 | Ga0307415_1014652012 | 105 |
| 398 | 3300033180 | Ga0307510_10001552 | Ga0307510_100015528 | 105 |
| 399 | 3300035112 | Ga0373932_0017388 | Ga0373932_0017388_317_634 | 105 |
| 400 | 3300035691 | Ga0373931_0149807 | Ga0373931_0149807_960_1277 | 105 |
| 401 | 3300037471 | Ga0395905_0851301 | Ga0395905_0851301_103_420 | 105 |
| 402 | 3300038443 | Ga0395901_0701185 | Ga0395901_0701185_267_584 | 105 |
| 403 | 3300039437 | Ga0436365_0267983 | Ga0436365_0267983_153_470 | 105 |
| 404 | 3300039437 | Ga0436365_0794411 | Ga0436365_0794411_65345_65662 | 105 |
| 405 | 3300039437 | Ga0436365_1062590 | Ga0436365_1062590_8107_8424 | 105 |
| 406 | 3300039437 | Ga0436365_1444662 | Ga0436365_1444662_3679_3996 | 105 |
| 407 | 3300039450 | Ga0436363_0558578 | Ga0436363_0558578_92_409 | 105 |
| 408 | 3300039450 | Ga0436363_0875254 | Ga0436363_0875254_131_448 | 105 |
| 409 | 3300039453 | Ga0436362_0573919 | Ga0436362_0573919_78_395 | 105 |
| 410 | 3300041441 | Ga0451787_258347 | Ga0451787_258347_126_443 | 105 |
| 411 | 3300041443 | Ga0451789_0625612 | Ga0451789_0625612_305_622 | 105 |
| 412 | 3300041452 | Ga0451793_0509886 | Ga0451793_0509886_561_878 | 105 |
| 413 | 3300041453 | Ga0451797_0916757 | Ga0451797_0916757_644_961 | 105 |
| 414 | 3300041463 | Ga0451804_0257040 | Ga0451804_0257040_195_512 | 105 |
| 415 | 3300041486 | Ga0451807_1810464 | Ga0451807_1810464_151_468 | 105 |
| 416 | 3300041505 | Ga0451849_0266587 | Ga0451849_0266587_45_362 | 105 |
| 417 | 3300041512 | Ga0451853_0050215 | Ga0451853_0050215_20_337 | 105 |
| 418 | 3300041512 | Ga0451853_2208097 | Ga0451853_2208097_149_466 | 105 |
| 419 | 3300044658 | Ga0466972_0018060 | Ga0466972_0018060_1491_1808 | 105 |
| 420 | 3300044693 | Ga0466961_0013225 | Ga0466961_0013225_3177_3494 | 105 |
| 421 | 3300044693 | Ga0466961_0483542 | Ga0466961_0483542_198_515 | 105 |
| 422 | 3300044694 | Ga0466963_0005523 | Ga0466963_0005523_4106_4423 | 105 |
| 423 | 3300044706 | Ga0466964_0322539 | Ga0466964_0322539_292_609 | 105 |
| 424 | 3300044719 | Ga0466971_0053263 | Ga0466971_0053263_856_1173 | 105 |
| 425 | 3300044842 | Ga0466957_0003219 | Ga0466957_0003219_6103_6420 | 105 |
| 426 | 3300045049 | Ga0466959_0500535 | Ga0466959_0500535_258_575 | 105 |
| 427 | 3300045836 | Ga0466958_0008794 | Ga0466958_0008794_3170_3487 | 105 |
| 428 | 3300045836 | Ga0466958_0283927 | Ga0466958_0283927_728_1045 | 105 |
| 429 | 3300045976 | Ga0466967_0223477 | Ga0466967_0223477_54_371 | 105 |
| 430 | 3300046491 | Ga0495584_0104478 | Ga0495584_0104478_933_1250 | 105 |
| 431 | 3300046519 | Ga0495632_0000001 | Ga0495632_0000001_95112_95429 | 105 |
| 432 | 3300046520 | Ga0495637_0000108 | Ga0495637_0000108_14538_14855 | 105 |
| 433 | 3300046522 | Ga0495643_0000020 | Ga0495643_0000020_79900_80217 | 105 |
| 434 | 3300046524 | Ga0495648_0008519 | Ga0495648_0008519_2591_2908 | 105 |
| 435 | 3300046525 | Ga0495663_0000002 | Ga0495663_0000002_93442_93759 | 105 |
| 436 | 3300046525 | Ga0495663_0187526 | Ga0495663_0187526_28_345 | 105 |
| 437 | 3300046530 | Ga0495654_0010343 | Ga0495654_0010343_3723_4040 | 105 |
| 438 | 3300046558 | Ga0495633_0004517 | Ga0495633_0004517_8384_8701 | 105 |
| 439 | 3300046616 | Ga0495668_0176763 | Ga0495668_0176763_184_501 | 105 |
| 440 | 3300046616 | Ga0495668_0396850 | Ga0495668_0396850_205_522 | 105 |
| 441 | 3300046660 | Ga0495625_0068493 | Ga0495625_0068493_2055_2372 | 105 |
| 442 | 3300046692 | Ga0495671_0000016 | Ga0495671_0000016_79900_80217 | 105 |
| 443 | 3300046694 | Ga0495649_0480012 | Ga0495649_0480012_228_545 | 105 |
| 444 | 3300047470 | Ga0495681_0000929 | Ga0495681_0000929_6557_6874 | 105 |
| 445 | 3300048091 | Ga0495626_0035627 | Ga0495626_0035627_353_670 | 105 |
| 446 | 3300048903 | Ga0496100_1243446 | Ga0496100_1243446_115_432 | 105 |
| 447 | 3300048904 | Ga0496101_0038880 | Ga0496101_0038880_2997_3314 | 105 |
| 448 | 3300048906 | Ga0496103_0092291 | Ga0496103_0092291_174_491 | 105 |
| 449 | 3300048907 | Ga0496104_0404942 | Ga0496104_0404942_910_1227 | 105 |
| 450 | 3300048908 | Ga0496105_0039787 | Ga0496105_0039787_971_1288 | 105 |
| 451 | 3300048909 | Ga0496106_0001999 | Ga0496106_0001999_7239_7556 | 105 |
| 452 | 3300048910 | Ga0496107_0001507 | Ga0496107_0001507_6023_6340 | 105 |
| 453 | 3300048911 | Ga0496108_0185404 | Ga0496108_0185404_129_446 | 105 |
| 454 | 3300048912 | Ga0496109_0143028 | Ga0496109_0143028_104_421 | 105 |
| 455 | 3300048912 | Ga0496109_1450813 | Ga0496109_1450813_85_402 | 105 |
| 456 | 3300048913 | Ga0496110_0140483 | Ga0496110_0140483_184_501 | 105 |
| 457 | 3300048914 | Ga0496111_0127045 | Ga0496111_0127045_759_1076 | 105 |
| 458 | 3300048914 | Ga0496111_0768130 | Ga0496111_0768130_235_552 | 105 |
| 459 | 3300048915 | Ga0496112_0274807 | Ga0496112_0274807_413_730 | 105 |
| 460 | 3300048916 | Ga0496113_0003027 | Ga0496113_0003027_6945_7262 | 105 |
| 461 | 3300048916 | Ga0496113_0484610 | Ga0496113_0484610_649_966 | 105 |
| 462 | 3300048918 | Ga0496115_0153612 | Ga0496115_0153612_219_536 | 105 |
| 463 | 3300048922 | Ga0496119_0396769 | Ga0496119_0396769_171_488 | 105 |
| 464 | 3300048924 | Ga0496121_0000017 | Ga0496121_0000017_151258_151575 | 105 |
| 465 | 3300048924 | Ga0496121_0000114 | Ga0496121_0000114_39655_39972 | 105 |
| 466 | 3300048927 | Ga0496124_0253224 | Ga0496124_0253224_461_778 | 105 |
| 467 | 3300048929 | Ga0496126_0001667 | Ga0496126_0001667_5652_5969 | 105 |
| 468 | 3300048929 | Ga0496126_1116976 | Ga0496126_1116976_167_484 | 105 |
| 469 | 3300049571 | Ga0501034_0513801 | Ga0501034_0513801_584_901 | 105 |
| 470 | 3300049573 | Ga0501037_0838102 | Ga0501037_0838102_176_493 | 105 |
| 471 | 3300049577 | Ga0501041_0306569 | Ga0501041_0306569_126_443 | 105 |
| 472 | 3300049579 | Ga0501043_0642809 | Ga0501043_0642809_342_659 | 105 |
| 473 | 3300049585 | Ga0501069_0003915 | Ga0501069_0003915_7123_7440 | 105 |
| 474 | 3300049586 | Ga0501070_0151326 | Ga0501070_0151326_442_759 | 105 |
| 475 | 3300049589 | Ga0501073_0612516 | Ga0501073_0612516_73_390 | 105 |
| 476 | 3300049590 | Ga0501074_0459143 | Ga0501074_0459143_422_739 | 105 |
| 477 | 3300049742 | Ga0501080_0123075 | Ga0501080_0123075_292_609 | 105 |
| 478 | 3300049742 | Ga0501080_1443336 | Ga0501080_1443336_220_537 | 105 |
| 479 | 3300050493 | nmdc:mga0k408_117727_c1 | nmdc:mga0k408_117727_c1_763_1080 | 105 |
| 480 | 3300050512 | nmdc:mga0n895_458403_c1 | nmdc:mga0n895_458403_c1_739_1056 | 105 |
| 481 | 3300053090 | Ga0500646_0036084 | Ga0500646_0036084_425_742 | 105 |
| 482 | 3300053116 | Ga0500592_000009 | Ga0500592_000009_52974_53291 | 105 |
| 483 | 3300053139 | Ga0500568_0001425 | Ga0500568_0001425_11669_11986 | 105 |
| 484 | 3300053151 | Ga0500604_0000198 | Ga0500604_0000198_16624_16941 | 105 |
| 485 | 3300053153 | Ga0500616_0000238 | Ga0500616_0000238_12881_13198 | 105 |
| 486 | 3300053158 | Ga0500627_0000051 | Ga0500627_0000051_50206_50523 | 105 |
| 487 | 3300053727 | Ga0500611_029122 | Ga0500611_029122_294_611 | 105 |
| 488 | 3300053739 | Ga0500587_004826 | Ga0500587_004826_275_592 | 105 |
| 489 | 3300061719 | Ga0466962_0000640 | Ga0466962_0000640_13585_13902 | 105 |
| 490 | 3300000549 | LJQas_1004390 | LJQas_10043902 | 106 |
| 491 | 3300005563 | Ga0068855_100126842 | Ga0068855_1001268424 | 106 |
| 492 | 3300005614 | Ga0068856_100365384 | Ga0068856_1003653841 | 106 |
| 493 | 3300005616 | Ga0068852_100004899 | Ga0068852_1000048997 | 106 |
| 494 | 3300009545 | Ga0105237_12338945 | Ga0105237_123389451 | 106 |
| 495 | 3300009551 | Ga0105238_10945606 | Ga0105238_109456062 | 106 |
| 496 | 3300013306 | Ga0163162_10036722 | Ga0163162_100367226 | 106 |
| 497 | 3300025924 | Ga0207694_10733511 | Ga0207694_107335111 | 106 |
| 498 | 3300025949 | Ga0207667_10133329 | Ga0207667_101333291 | 106 |
| 499 | 3300025961 | Ga0207712_11278568 | Ga0207712_112785681 | 106 |
| 500 | 3300025972 | Ga0207668_10730617 | Ga0207668_107306172 | 106 |
| 501 | 3300026041 | Ga0207639_10003754 | Ga0207639_100037545 | 106 |
| 502 | 3300026116 | Ga0207674_10069626 | Ga0207674_100696262 | 106 |
| 503 | 3300026142 | Ga0207698_10018599 | Ga0207698_100185992 | 106 |
| 504 | 3300032004 | Ga0307414_10064532 | Ga0307414_100645324 | 106 |
| 505 | iso_pu_bacteria | 2511231027 | 2511388212 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lxf-assembly1.cif.gz_A | crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans | 0.9963 | 4 | 106 |
| 3lxf-assembly1.cif.gz_A | crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans | 0.9774 | 4 | 106 |
| 2y5c-assembly2.cif.gz_B | structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster | 0.9692 | 2 | 101 |
| 4ltu-assembly2.cif.gz_B | crystal structure of ferredoxin from rhodopseudomonas palustris haa2 | 0.9613 | 4 | 106 |
| 6nbl-assembly2.cif.gz_D | cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide | 0.955 | 3 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lxfB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9971 | 4 | 106 | 3.10.20.30 |
| 3lxfB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9781 | 4 | 106 | 3.10.20.30 |
| af_Q9CPW2_55_168_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9767 | 2 | 103 | 3.10.20.30 |
| 4ltuB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9613 | 4 | 106 | 3.10.20.30 |
| af_M9ND39_2_143_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.96 | 4 | 18 | 3.30.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3CB93-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 1.004 | 26 | 106 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A419TFV9-F1-model_v4 | deleted | 1 | 1 | 106 |
|
| AF-X5CWH9-F1-model_v4 | Chloroacetanilide N-alkylformylase 2, ferredoxin component (Ferredoxin CndB2) | 0.9994 | 3 | 106 |
GO:0009055
GO:0046872 GO:0051537 GO:0140647 |
| AF-Q2G8A3-F1-model_v4 | Ferredoxin | 0.9993 | 2 | 106 |
GO:0009055
GO:0046872 GO:0051537 GO:0140647 |
| AF-A0A0H0XV86-F1-model_v4 | Ferredoxin | 0.9989 | 3 | 106 |
GO:0009055
GO:0051537 GO:0140647 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar