F456330

General Info

Members Datasets Scaffolds Average Seq Length
505 182 505 383

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100013602|Ga0068854_1000136022
Length 361
Sequence MTGLFLAPIGALLLVACLIAMLSRRVGLPYSVGLVVAGFLIALLPSGPDLPLSRDLIFNFLLPPLVFEAALQLDWPRFRAELAGMHYAVGWSWIGATLFGVLIAATDPVSVIASFRELGCLPRVSMVVESESLLNDGIAAVGFAVLSAVAVGASPGVADVIPAFLWSLGGGIVVGLAVSVAILMIVGRTEDPLVEITLTTIAAYGSFLLAEHFGASGIISALAAGLLVGSFGNRFLSKAGRDRVRWAWDFFAFLANSIVFILIGMSVAHQPLHLLGAAALTSISIYPLSALFIASRWRLKASFQHTLFWGGLRGERNAIILTAFVVVAFSILVQGLTMPWLIKRLKLGSKVPEPVVAAPQS

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 6.93
Rhizosphere 92.28
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001738 3300001976 Bacteria 2922
2 JGI24740J21852_10000582 3300001979 Bacteria 15705
3 JGI24740J21852_10014511 3300001979 Bacteria 2902
4 JGI24740J21852_10019985 3300001979 Bacteria 2348
5 JGI24739J22299_10001907 3300001989 Bacteria 7973
6 JGI24739J22299_10024365 3300001989 Bacteria 2134
7 JGI24737J22298_10000319 3300001990 Bacteria 16081
8 JGI24737J22298_10001774 3300001990 Bacteria 7726
9 JGI24737J22298_10001975 3300001990 Bacteria 7328
10 Ga0070658_10000305 3300005327 Bacteria 42490
11 Ga0070658_10018829 3300005327 Bacteria 5532
12 Ga0070658_10023104 3300005327 Bacteria 4992
13 Ga0070658_10032404 3300005327 Bacteria 4201
14 Ga0070658_10052619 3300005327 Bacteria 3303
15 Ga0070658_10056057 3300005327 Bacteria 3202
16 Ga0070658_10132538 3300005327 Bacteria 2077
17 Ga0070676_10000684 3300005328 Bacteria 16604
18 Ga0070676_10152611 3300005328 Bacteria 1480
19 Ga0070683_100000872 3300005329 Bacteria 22349
20 Ga0070683_100066522 3300005329 Bacteria 3357
21 Ga0070690_100011418 3300005330 Bacteria 5194
22 Ga0070690_100024321 3300005330 Bacteria 3724
23 Ga0070690_100071359 3300005330 Unclassified 2257
24 Ga0070670_100001610 3300005331 Bacteria 18251
25 Ga0070670_100003445 3300005331 Bacteria 13128
26 Ga0070670_100005046 3300005331 Bacteria 11107
27 Ga0070670_100016847 3300005331 Bacteria 6273
28 Ga0070670_100043712 3300005331 Unclassified 3851
29 Ga0068869_100004802 3300005334 Bacteria 8437
30 Ga0068869_100041786 3300005334 Bacteria 3284
31 Ga0070666_10000404 3300005335 Bacteria 27169
32 Ga0070666_10001510 3300005335 Bacteria 14127
33 Ga0070666_10013364 3300005335 Bacteria 5205
34 Ga0070666_10038587 3300005335 Bacteria 3179
35 Ga0070666_10041013 3300005335 Bacteria 3092
36 Ga0070680_100081289 3300005336 Bacteria 2673
37 Ga0070682_100143785 3300005337 Bacteria 1629
38 Ga0068868_100000839 3300005338 Bacteria 20812
39 Ga0068868_100001635 3300005338 Bacteria 15291
40 Ga0070660_100000129 3300005339 Bacteria 47402
41 Ga0070660_100003892 3300005339 Bacteria 10314
42 Ga0070660_100036290 3300005339 Bacteria 3733
43 Ga0070660_100046747 3300005339 Bacteria 3318
44 Ga0070661_100000033 3300005344 Bacteria 111757
45 Ga0070661_100028754 3300005344 Bacteria 4011
46 Ga0070661_100032857 3300005344 Bacteria 3757
47 Ga0070661_100061054 3300005344 Bacteria 2766
48 Ga0070661_100075479 3300005344 Bacteria 2484
49 Ga0070661_100270091 3300005344 Bacteria 1317
50 Ga0070668_100000565 3300005347 Bacteria 24751
51 Ga0070669_100001226 3300005353 Bacteria 18625
52 Ga0070669_100026252 3300005353 Bacteria 4190
53 Ga0070669_100063807 3300005353 Bacteria 2711
54 Ga0070671_100001360 3300005355 Bacteria 18332
55 Ga0070671_100015971 3300005355 Bacteria 6066
56 Ga0070671_100046280 3300005355 Bacteria 3618
57 Ga0070671_100054490 3300005355 Bacteria 3325
58 Ga0070671_100085052 3300005355 Bacteria 2645
59 Ga0070671_100090230 3300005355 Bacteria 2566
60 Ga0070671_100119516 3300005355 Bacteria 2217
61 Ga0070674_100011978 3300005356 Bacteria 5308
62 Ga0070673_100004324 3300005364 Bacteria 8972
63 Ga0070673_100005921 3300005364 Bacteria 7898
64 Ga0070673_100005942 3300005364 Bacteria 7889
65 Ga0070673_100028715 3300005364 Bacteria 4140
66 Ga0070673_100047538 3300005364 Bacteria 3339
67 Ga0070673_100160741 3300005364 Bacteria 1910
68 Ga0070659_100000142 3300005366 Bacteria 55216
69 Ga0070659_100006393 3300005366 Bacteria 8508
70 Ga0070659_100021476 3300005366 Bacteria 4917
71 Ga0070659_100129015 3300005366 Bacteria 2052
72 Ga0070659_100190233 3300005366 Bacteria 1687
73 Ga0070659_100200826 3300005366 Bacteria 1641
74 Ga0070667_100000368 3300005367 Bacteria 49069
75 Ga0070667_100001727 3300005367 Bacteria 19525
76 Ga0070667_100004054 3300005367 Bacteria 12387
77 Ga0070667_100005257 3300005367 Bacteria 10826
78 Ga0070667_100009487 3300005367 Bacteria 8072
79 Ga0070667_100035265 3300005367 Bacteria 4190
80 Ga0070667_100044670 3300005367 Unclassified 3722
81 Ga0070714_100002762 3300005435 Bacteria 12941
82 Ga0070714_100071189 3300005435 Bacteria 3006
83 Ga0070714_100144277 3300005435 Bacteria 2140
84 Ga0070713_100025541 3300005436 Bacteria 4619
85 Ga0070663_100000230 3300005455 Bacteria 28169
86 Ga0070663_100027408 3300005455 Bacteria 3869
87 Ga0070678_100003094 3300005456 Bacteria 9223
88 Ga0070678_100054899 3300005456 Bacteria 2906
89 Ga0070662_100000021 3300005457 Bacteria 93909
90 Ga0070662_100002861 3300005457 Bacteria 10699
91 Ga0070662_100011868 3300005457 Bacteria 5760
92 Ga0070662_100017335 3300005457 Bacteria 4855
93 Ga0070662_100119406 3300005457 Bacteria 2019
94 Ga0070681_10018603 3300005458 Bacteria 6947
95 Ga0070681_10038136 3300005458 Bacteria 4818
96 Ga0070681_10110345 3300005458 Bacteria 2691
97 Ga0068867_100002768 3300005459 Bacteria 12350
98 Ga0068867_100013532 3300005459 Bacteria 5778
99 Ga0068867_100078383 3300005459 Bacteria 2485
100 Ga0070685_10056115 3300005466 Bacteria 2289
101 Ga0070679_100006646 3300005530 Bacteria 10783
102 Ga0070679_100057816 3300005530 Bacteria 3865
103 Ga0070684_100149146 3300005535 Bacteria 2118
104 Ga0068853_100000220 3300005539 Bacteria 40376
105 Ga0068853_100001611 3300005539 Bacteria 16464
106 Ga0068853_100064691 3300005539 Bacteria 3172
107 Ga0070672_100012302 3300005543 Bacteria 6001
108 Ga0070672_100030061 3300005543 Bacteria 4077
109 Ga0070693_100002649 3300005547 Bacteria 8241
110 Ga0070693_100086503 3300005547 Bacteria 1881
111 Ga0070665_100010939 3300005548 Bacteria 9177
112 Ga0070665_100019380 3300005548 Bacteria 6826
113 Ga0068855_100001017 3300005563 Bacteria 34928
114 Ga0070664_100000153 3300005564 Bacteria 47344
115 Ga0070664_100018694 3300005564 Bacteria 5699
116 Ga0070664_100097327 3300005564 Bacteria 2555
117 Ga0070664_100122648 3300005564 Bacteria 2277
118 Ga0070664_100292567 3300005564 Bacteria 1470
119 Ga0068857_100011019 3300005577 Bacteria 7870
120 Ga0068857_100012805 3300005577 Bacteria 7310
121 Ga0068857_100013009 3300005577 Bacteria 7250
122 Ga0068857_100021218 3300005577 Bacteria 5715
123 Ga0068857_100044848 3300005577 Bacteria 3922
124 Ga0068857_100316961 3300005577 Unclassified 1439
125 Ga0068854_100013602 3300005578 Bacteria 5347
126 Ga0068856_100000177 3300005614 Bacteria 66207
127 Ga0068856_100036643 3300005614 Bacteria 4809
128 Ga0068856_100074754 3300005614 Bacteria 3355
129 Ga0068856_100108894 3300005614 Bacteria 2766
130 Ga0068856_100131001 3300005614 Bacteria 2512
131 Ga0068856_100147780 3300005614 Bacteria 2358
132 Ga0068852_100003922 3300005616 Bacteria 10452
133 Ga0068852_100025623 3300005616 Bacteria 4781
134 Ga0068852_100055234 3300005616 Bacteria 3426
135 Ga0068852_100057035 3300005616 Bacteria 3378
136 Ga0068852_100069985 3300005616 Bacteria 3077
137 Ga0068859_100000221 3300005617 Bacteria 56589
138 Ga0068859_100057978 3300005617 Bacteria 3900
139 Ga0068859_100248165 3300005617 Bacteria 1870
140 Ga0068864_100000324 3300005618 Bacteria 42149
141 Ga0068864_100010316 3300005618 Bacteria 7715
142 Ga0068864_100025473 3300005618 Bacteria 4982
143 Ga0068864_100027653 3300005618 Bacteria 4792
144 Ga0068864_100038110 3300005618 Bacteria 4103
145 Ga0068861_100087103 3300005719 Bacteria 2457
146 Ga0068851_10036338 3300005834 Bacteria 2466
147 Ga0068863_100001640 3300005841 Bacteria 22143
148 Ga0068863_100003096 3300005841 Bacteria 16430
149 Ga0068863_100017910 3300005841 Bacteria 6779
150 Ga0068863_100035782 3300005841 Bacteria 4728
151 Ga0068863_100051651 3300005841 Bacteria 3895
152 Ga0068863_100062948 3300005841 Bacteria 3508
153 Ga0068858_100002510 3300005842 Bacteria 18504
154 Ga0068858_100003711 3300005842 Bacteria 15132
155 Ga0068858_100009449 3300005842 Bacteria 9300
156 Ga0068858_100021946 3300005842 Bacteria 5962
157 Ga0068860_100001066 3300005843 Bacteria 30262
158 Ga0068862_100030963 3300005844 Unclassified 4512
159 Ga0068862_100036017 3300005844 Bacteria 4192
160 Ga0068862_100179296 3300005844 Bacteria 1900
161 Ga0081539_10089681 3300005985 Bacteria 1592
162 Ga0070717_10005021 3300006028 Bacteria 9636
163 Ga0075362_10048978 3300006177 Bacteria 1886
164 Ga0097621_100009565 3300006237 Bacteria 7045
165 Ga0075428_100188850 3300006844 Bacteria 2229
166 Ga0075433_10022730 3300006852 Bacteria 5268
167 Ga0068865_100015120 3300006881 Bacteria 4917
168 Ga0068865_100034904 3300006881 Bacteria 3378
169 Ga0097620_100000221 3300006931 Bacteria 56589
170 Ga0097620_100057979 3300006931 Bacteria 3900
171 Ga0097620_100248169 3300006931 Bacteria 1870
172 Ga0105250_10015358 3300009092 Bacteria 3135
173 Ga0105240_10279614 3300009093 Bacteria 1918
174 Ga0105245_10033044 3300009098 Bacteria 4582
175 Ga0105247_10082001 3300009101 Bacteria 2035
176 Ga0105243_10159078 3300009148 Bacteria 1946
177 Ga0105241_10017032 3300009174 Bacteria 5334
178 Ga0105241_10104523 3300009174 Bacteria 2256
179 Ga0105241_10152828 3300009174 Bacteria 1890
180 Ga0105242_10011130 3300009176 Bacteria 6913
181 Ga0105248_10000502 3300009177 Bacteria 44596
182 Ga0105248_10001683 3300009177 Bacteria 24621
183 Ga0105248_10006145 3300009177 Bacteria 13168
184 Ga0105248_10020411 3300009177 Bacteria 7340
185 Ga0105248_10036489 3300009177 Bacteria 5498
186 Ga0105237_10128906 3300009545 Bacteria 2524
187 Ga0105238_10052968 3300009551 Bacteria 4078
188 Ga0105238_10076664 3300009551 Bacteria 3335
189 Ga0105238_10125780 3300009551 Unclassified 2542
190 Ga0105238_10266715 3300009551 Bacteria 1692
191 Ga0105249_10135556 3300009553 Unclassified 2355
192 Ga0105239_10009152 3300010375 Bacteria 11203
193 Ga0105246_10127701 3300011119 Bacteria 1894
194 Ga0157373_10002473 3300013100 Bacteria 14069
195 Ga0157373_10008231 3300013100 Bacteria 7751
196 Ga0157373_10052559 3300013100 Bacteria 2899
197 Ga0157373_10115016 3300013100 Bacteria 1891
198 Ga0157371_10000934 3300013102 Bacteria 32706
199 Ga0157371_10067647 3300013102 Bacteria 2528
200 Ga0157371_10107294 3300013102 Bacteria 1982
201 Ga0157370_10039613 3300013104 Bacteria 4554
202 Ga0157370_10042914 3300013104 Bacteria 4355
203 Ga0157369_10029519 3300013105 Bacteria 6059
204 Ga0157369_10038800 3300013105 Bacteria 5207
205 Ga0157369_10078077 3300013105 Bacteria 3548
206 Ga0157369_10147715 3300013105 Bacteria 2485
207 Ga0157374_10027445 3300013296 Bacteria 5136
208 Ga0157378_10073605 3300013297 Bacteria 3072
209 Ga0163162_10001373 3300013306 Bacteria 22633
210 Ga0163162_10047912 3300013306 Bacteria 4282
211 Ga0163162_10061110 3300013306 Bacteria 3805
212 Ga0157372_10026260 3300013307 Bacteria 6336
213 Ga0157372_10038905 3300013307 Bacteria 5249
214 Ga0157372_10107855 3300013307 Bacteria 3187
215 Ga0157375_10005377 3300013308 Bacteria 11125
216 Ga0163163_10000164 3300014325 Bacteria 69244
217 Ga0163163_10002761 3300014325 Bacteria 14816
218 Ga0163163_10003982 3300014325 Bacteria 12607
219 Ga0163163_10016280 3300014325 Bacteria 6904
220 Ga0163163_10129456 3300014325 Bacteria 2564
221 Ga0182008_10052691 3300014497 Bacteria 2016
222 Ga0157377_10109695 3300014745 Bacteria 1657
223 Ga0157379_10013589 3300014968 Bacteria 7135
224 Ga0157379_10114782 3300014968 Bacteria 2421
225 Ga0163161_10149390 3300017792 Bacteria 1775
226 Ga0213876_10094534 3300021384 Bacteria 1583
227 Ga0207673_1000043 3300025290 Bacteria 9962
228 Ga0207656_10011828 3300025321 Bacteria 3303
229 Ga0207656_10033325 3300025321 Bacteria 2145
230 Ga0207696_1008783 3300025711 Bacteria 3826
231 Ga0207680_10000516 3300025903 Bacteria 18433
232 Ga0207680_10005461 3300025903 Bacteria 6073
233 Ga0207680_10039005 3300025903 Bacteria 2752
234 Ga0207680_10085315 3300025903 Bacteria 1994
235 Ga0207647_10012789 3300025904 Bacteria 5831
236 Ga0207647_10025843 3300025904 Bacteria 3850
237 Ga0207647_10070480 3300025904 Bacteria 2111
238 Ga0207647_10077532 3300025904 Bacteria 1997
239 Ga0207645_10001931 3300025907 Bacteria 16729
240 Ga0207705_10000174 3300025909 Bacteria 68260
241 Ga0207705_10002048 3300025909 Bacteria 15684
242 Ga0207705_10007111 3300025909 Bacteria 8253
243 Ga0207705_10016807 3300025909 Bacteria 5239
244 Ga0207705_10021410 3300025909 Bacteria 4614
245 Ga0207705_10028081 3300025909 Bacteria 4011
246 Ga0207705_10082203 3300025909 Bacteria 2349
247 Ga0207654_10009921 3300025911 Bacteria 4841
248 Ga0207707_10124422 3300025912 Bacteria 2255
249 Ga0207707_10173248 3300025912 Bacteria 1885
250 Ga0207695_10038379 3300025913 Bacteria 5158
251 Ga0207693_10175127 3300025915 Bacteria 1688
252 Ga0207660_10137528 3300025917 Bacteria 1865
253 Ga0207657_10000173 3300025919 Bacteria 66220
254 Ga0207657_10001564 3300025919 Bacteria 24557
255 Ga0207657_10002987 3300025919 Bacteria 18126
256 Ga0207657_10047598 3300025919 Bacteria 3747
257 Ga0207657_10053152 3300025919 Bacteria 3510
258 Ga0207657_10057826 3300025919 Bacteria 3340
259 Ga0207657_10073650 3300025919 Bacteria 2886
260 Ga0207649_10000014 3300025920 Bacteria 255001
261 Ga0207649_10049237 3300025920 Bacteria 2601
262 Ga0207649_10058928 3300025920 Bacteria 2407
263 Ga0207649_10081479 3300025920 Bacteria 2096
264 Ga0207649_10118253 3300025920 Bacteria 1783
265 Ga0207681_10017961 3300025923 Bacteria 4448
266 Ga0207694_10063629 3300025924 Bacteria 2874
267 Ga0207650_10017158 3300025925 Bacteria 5067
268 Ga0207650_10027562 3300025925 Bacteria 4068
269 Ga0207650_10155119 3300025925 Bacteria 1810
270 Ga0207700_10012555 3300025928 Bacteria 5470
271 Ga0207700_10099467 3300025928 Bacteria 2316
272 Ga0207664_10077566 3300025929 Bacteria 2692
273 Ga0207644_10000344 3300025931 Bacteria 30156
274 Ga0207644_10004512 3300025931 Bacteria 9044
275 Ga0207644_10011248 3300025931 Bacteria 5916
276 Ga0207644_10013676 3300025931 Bacteria 5416
277 Ga0207644_10015322 3300025931 Bacteria 5142
278 Ga0207644_10021480 3300025931 Bacteria 4398
279 Ga0207690_10000150 3300025932 Bacteria 55157
280 Ga0207690_10012942 3300025932 Bacteria 4999
281 Ga0207690_10083246 3300025932 Bacteria 2240
282 Ga0207706_10000358 3300025933 Bacteria 49357
283 Ga0207706_10000479 3300025933 Bacteria 42802
284 Ga0207706_10002282 3300025933 Bacteria 18704
285 Ga0207706_10161080 3300025933 Bacteria 1972
286 Ga0207706_10242337 3300025933 Bacteria 1576
287 Ga0207669_10003173 3300025937 Bacteria 7095
288 Ga0207669_10004720 3300025937 Bacteria 6032
289 Ga0207704_10004738 3300025938 Bacteria 6243
290 Ga0207704_10018990 3300025938 Bacteria 3601
291 Ga0207704_10040182 3300025938 Bacteria 2731
292 Ga0207691_10004453 3300025940 Bacteria 13581
293 Ga0207691_10014051 3300025940 Bacteria 7639
294 Ga0207691_10023959 3300025940 Bacteria 5741
295 Ga0207691_10039111 3300025940 Bacteria 4389
296 Ga0207711_10000042 3300025941 Bacteria 158782
297 Ga0207711_10001247 3300025941 Bacteria 24153
298 Ga0207711_10003745 3300025941 Bacteria 13113
299 Ga0207711_10005486 3300025941 Bacteria 10722
300 Ga0207711_10007695 3300025941 Bacteria 9006
301 Ga0207711_10009331 3300025941 Bacteria 8191
302 Ga0207689_10074116 3300025942 Bacteria 2797
303 Ga0207661_10002752 3300025944 Bacteria 12105
304 Ga0207661_10145319 3300025944 Bacteria 2045
305 Ga0207679_10000323 3300025945 Bacteria 35679
306 Ga0207679_10001732 3300025945 Bacteria 13582
307 Ga0207679_10008398 3300025945 Bacteria 6578
308 Ga0207679_10238622 3300025945 Bacteria 1539
309 Ga0207667_10011906 3300025949 Bacteria 10075
310 Ga0207667_10082101 3300025949 Bacteria 3339
311 Ga0207667_10112794 3300025949 Unclassified 2803
312 Ga0207667_10303918 3300025949 Bacteria 1630
313 Ga0207651_10004464 3300025960 Bacteria 7057
314 Ga0207651_10005686 3300025960 Bacteria 6432
315 Ga0207651_10036166 3300025960 Bacteria 3220
316 Ga0207651_10039050 3300025960 Unclassified 3126
317 Ga0207651_10119735 3300025960 Bacteria 1994
318 Ga0207712_10053319 3300025961 Bacteria 2836
319 Ga0207668_10000129 3300025972 Bacteria 53619
320 Ga0207668_10027826 3300025972 Unclassified 3687
321 Ga0207640_10001164 3300025981 Bacteria 14432
322 Ga0207640_10007979 3300025981 Bacteria 5847
323 Ga0207640_10105043 3300025981 Bacteria 1989
324 Ga0207658_10001855 3300025986 Bacteria 15820
325 Ga0207658_10005014 3300025986 Bacteria 9122
326 Ga0207658_10006482 3300025986 Bacteria 7989
327 Ga0207658_10006812 3300025986 Bacteria 7787
328 Ga0207658_10016242 3300025986 Bacteria 5119
329 Ga0207658_10018332 3300025986 Bacteria 4833
330 Ga0207677_10005736 3300026023 Bacteria 6753
331 Ga0207677_10013797 3300026023 Bacteria 4693
332 Ga0207703_10001128 3300026035 Bacteria 25174
333 Ga0207703_10005591 3300026035 Bacteria 10093
334 Ga0207703_10012327 3300026035 Bacteria 6664
335 Ga0207703_10019431 3300026035 Bacteria 5309
336 Ga0207703_10066845 3300026035 Bacteria 2958
337 Ga0207639_10000740 3300026041 Bacteria 22283
338 Ga0207639_10162432 3300026041 Unclassified 1884
339 Ga0207678_10001573 3300026067 Bacteria 20999
340 Ga0207678_10005191 3300026067 Bacteria 11667
341 Ga0207678_10031195 3300026067 Bacteria 4650
342 Ga0207678_10035335 3300026067 Bacteria 4351
343 Ga0207678_10037134 3300026067 Bacteria 4239
344 Ga0207702_10000840 3300026078 Bacteria 32178
345 Ga0207702_10029315 3300026078 Bacteria 4578
346 Ga0207702_10030433 3300026078 Bacteria 4499
347 Ga0207702_10086365 3300026078 Bacteria 2736
348 Ga0207641_10000415 3300026088 Bacteria 49760
349 Ga0207641_10006423 3300026088 Bacteria 9908
350 Ga0207641_10007627 3300026088 Bacteria 8997
351 Ga0207641_10019596 3300026088 Bacteria 5554
352 Ga0207641_10116910 3300026088 Bacteria 2373
353 Ga0207641_10154601 3300026088 Bacteria 2080
354 Ga0207648_10019560 3300026089 Bacteria 6111
355 Ga0207648_10023643 3300026089 Bacteria 5502
356 Ga0207648_10095937 3300026089 Bacteria 2595
357 Ga0207676_10004550 3300026095 Bacteria 9818
358 Ga0207676_10010753 3300026095 Bacteria 6525
359 Ga0207676_10012132 3300026095 Bacteria 6168
360 Ga0207676_10047529 3300026095 Bacteria 3326
361 Ga0207676_10091627 3300026095 Bacteria 2498
362 Ga0207674_10000567 3300026116 Bacteria 48417
363 Ga0207674_10000632 3300026116 Bacteria 45854
364 Ga0207674_10008808 3300026116 Bacteria 11613
365 Ga0207674_10017607 3300026116 Bacteria 7793
366 Ga0207674_10025450 3300026116 Bacteria 6311
367 Ga0207674_10045687 3300026116 Bacteria 4502
368 Ga0207674_10093541 3300026116 Bacteria 2994
369 Ga0207674_10268188 3300026116 Bacteria 1654
370 Ga0207683_10002230 3300026121 Bacteria 17045
371 Ga0207683_10004225 3300026121 Bacteria 12404
372 Ga0207683_10027080 3300026121 Bacteria 4954
373 Ga0207698_10002807 3300026142 Bacteria 10409
374 Ga0207698_10021600 3300026142 Bacteria 4456
375 Ga0207698_10037433 3300026142 Bacteria 3573
376 Ga0207698_10042274 3300026142 Unclassified 3403
377 Ga0207698_10079410 3300026142 Bacteria 2639
378 Ga0207698_10091781 3300026142 Bacteria 2487
379 Ga0207698_10107789 3300026142 Bacteria 2327
380 Ga0207698_10204961 3300026142 Bacteria 1769
381 Ga0268266_10014214 3300028379 Bacteria 6848
382 Ga0268266_10187329 3300028379 Bacteria 1888
383 Ga0268265_10060848 3300028380 Bacteria 2895
384 Ga0268264_10000710 3300028381 Bacteria 38345
385 Ga0268264_10031110 3300028381 Bacteria 4376
386 Ga0268264_10040964 3300028381 Bacteria 3828
387 Ga0373957_0035408 3300035120 Bacteria 1855
388 Ga0373960_0039549 3300035121 Archaea 1357
389 Ga0373962_0035035 3300035242 Archaea 1392
390 Ga0373931_0008900 3300035691 Bacteria 4783
391 Ga0373937_0004093 3300036401 Bacteria 12372
392 Ga0395899_0010781 3300037312 Bacteria 7005
393 Ga0395899_0038536 3300037312 Bacteria 3579
394 Ga0395899_0069070 3300037312 Bacteria 2588
395 Ga0395899_0070000 3300037312 Bacteria 2568
396 Ga0395899_0102856 3300037312 Bacteria 2061
397 Ga0395899_0168074 3300037312 Bacteria 1546
398 Ga0395899_0284214 3300037312 Bacteria 1124
399 Ga0395900_0017368 3300037418 Bacteria 7344
400 Ga0395900_0024110 3300037418 Bacteria 6228
401 Ga0395900_0048585 3300037418 Bacteria 4371
402 Ga0395900_0106025 3300037418 Bacteria 2887
403 Ga0395898_0036405 3300037466 Bacteria 4886
404 Ga0395898_0042062 3300037466 Bacteria 4510
405 Ga0395898_0045909 3300037466 Bacteria 4293
406 Ga0395898_0072618 3300037466 Bacteria 3324
407 Ga0395898_0099362 3300037466 Bacteria 2795
408 Ga0395898_0122040 3300037466 Bacteria 2497
409 Ga0395898_0132712 3300037466 Bacteria 2384
410 Ga0395898_0158087 3300037466 Bacteria 2168
411 Ga0395905_0001936 3300037471 Bacteria 23765
412 Ga0395905_0004174 3300037471 Bacteria 15108
413 Ga0395905_0004699 3300037471 Bacteria 14117
414 Ga0395905_0008274 3300037471 Bacteria 10268
415 Ga0395905_0010138 3300037471 Bacteria 9185
416 Ga0395905_0011574 3300037471 Bacteria 8522
417 Ga0395905_0011652 3300037471 Bacteria 8490
418 Ga0395905_0012227 3300037471 Bacteria 8264
419 Ga0395905_0021193 3300037471 Bacteria 6151
420 Ga0395905_0063383 3300037471 Bacteria 3458
421 Ga0395905_0097212 3300037471 Bacteria 2764
422 Ga0395905_0316105 3300037471 Bacteria 1451
423 Ga0395905_0365331 3300037471 Bacteria 1336
424 Ga0395905_0378347 3300037471 Bacteria 1309
425 Ga0395901_0005599 3300038443 Bacteria 12711
426 Ga0395901_0026072 3300038443 Bacteria 6002
427 Ga0395901_0029305 3300038443 Bacteria 5666
428 Ga0395901_0046870 3300038443 Bacteria 4490
429 Ga0395901_0047661 3300038443 Bacteria 4449
430 Ga0395901_0062259 3300038443 Bacteria 3883
431 Ga0395901_0092414 3300038443 Bacteria 3167
432 Ga0395901_0285868 3300038443 Bacteria 1712
433 Ga0395901_0322745 3300038443 Unclassified 1597
434 Ga0436365_1078212 3300039437 Bacteria 11525
435 Ga0439458_0000176 3300042157 Bacteria 14489
436 Ga0439458_0005918 3300042157 Bacteria 2740
437 Ga0466969_0008203 3300044656 Bacteria 5542
438 Ga0466972_0022956 3300044658 Bacteria 3105
439 Ga0466972_0024087 3300044658 Bacteria 3022
440 Ga0466966_0121438 3300044684 Bacteria 1604
441 Ga0466961_0034062 3300044693 Bacteria 3271
442 Ga0466961_0067916 3300044693 Bacteria 2264
443 Ga0466963_0040481 3300044694 Bacteria 3054
444 Ga0466963_0071375 3300044694 Bacteria 2337
445 Ga0466963_0222349 3300044694 Unclassified 1322
446 Ga0466964_0000579 3300044706 Bacteria 11550
447 Ga0466968_0023539 3300044735 Bacteria 2510
448 Ga0466970_0012361 3300044765 Bacteria 4364
449 Ga0466957_0046691 3300044842 Bacteria 2630
450 Ga0466959_0011277 3300045049 Bacteria 6415
451 Ga0466959_0040967 3300045049 Bacteria 3421
452 Ga0466959_0062607 3300045049 Bacteria 2703
453 Ga0466958_0004023 3300045836 Bacteria 7708
454 Ga0466958_0015462 3300045836 Bacteria 4373
455 Ga0466967_0085883 3300045976 Bacteria 2850
456 Ga0466967_0103080 3300045976 Bacteria 2611
457 Ga0466967_0142827 3300045976 Bacteria 2231
458 Ga0495598_0025360 3300046537 Bacteria 1616
459 Ga0495668_0016173 3300046616 Bacteria 4339
460 Ga0495669_0000413 3300046684 Bacteria 20774
461 Ga0495669_0005108 3300046684 Bacteria 5460
462 Ga0495669_0005332 3300046684 Bacteria 5357
463 Ga0495669_0006064 3300046684 Bacteria 5045
464 Ga0495669_0032803 3300046684 Bacteria 2284
465 Ga0495670_0021099 3300046691 Bacteria 3212
466 Ga0496100_0041060 3300048903 Bacteria 2947
467 Ga0496100_0107919 3300048903 Bacteria 1929
468 Ga0496101_0031083 3300048904 Bacteria 3750
469 Ga0496101_0047867 3300048904 Bacteria 3071
470 Ga0496104_0154285 3300048907 Bacteria 2204
471 Ga0496106_0109908 3300048909 Bacteria 2145
472 Ga0496107_0029406 3300048910 Bacteria 3908
473 Ga0496107_0049996 3300048910 Bacteria 3013
474 Ga0496107_0090211 3300048910 Bacteria 2239
475 Ga0496108_0021364 3300048911 Bacteria 5319
476 Ga0496108_0057112 3300048911 Bacteria 3279
477 Ga0496109_0015158 3300048912 Bacteria 6710
478 Ga0496109_0036166 3300048912 Bacteria 4456
479 Ga0496109_0043020 3300048912 Bacteria 4093
480 Ga0496110_0000304 3300048913 Bacteria 32429
481 Ga0496110_0003817 3300048913 Bacteria 11612
482 Ga0496110_0024363 3300048913 Bacteria 5157
483 Ga0496111_0000223 3300048914 Bacteria 27141
484 Ga0496111_0007246 3300048914 Bacteria 7256
485 Ga0496111_0014596 3300048914 Bacteria 5372
486 Ga0496112_0000602 3300048915 Bacteria 24773
487 Ga0496112_0008649 3300048915 Bacteria 9128
488 Ga0496112_0009173 3300048915 Bacteria 8889
489 Ga0496112_0016930 3300048915 Bacteria 6840
490 Ga0496112_0112390 3300048915 Bacteria 2694
491 Ga0496112_0129543 3300048915 Bacteria 2494
492 Ga0496113_0004762 3300048916 Bacteria 8380
493 Ga0496113_0006446 3300048916 Bacteria 7440
494 Ga0496113_0015517 3300048916 Bacteria 5239
495 Ga0496113_0040359 3300048916 Bacteria 3440
496 Ga0496114_0000006 3300048917 Bacteria 472921
497 Ga0496114_0029661 3300048917 Bacteria 4498
498 Ga0496114_0047705 3300048917 Bacteria 3563
499 Ga0496115_0001435 3300048918 Bacteria 17063
500 Ga0496115_0043171 3300048918 Bacteria 3595
501 Ga0501067_0046073 3300049583 Bacteria 2420
502 Ga0501069_0034359 3300049585 Unclassified 2793
503 nmdc:mga03683_41345_c1 3300050489 Bacteria 1893
504 nmdc:mga0a205_5203_c1 3300050515 Bacteria 11707
505 Ga0466962_0001508 3300061719 Bacteria 10867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0284214 Ga0395899_0284214_117_1070 289
2 3300037471 Ga0395905_0316105 Ga0395905_0316105_289_1431 336
3 3300037471 Ga0395905_0365331 Ga0395905_0365331_199_1326 340
4 3300005366 Ga0070659_100021476 Ga0070659_1000214764 343
5 3300025932 Ga0207690_10012942 Ga0207690_100129422 343
6 3300037312 Ga0395899_0070000 Ga0395899_0070000_1437_2558 344
7 3300001979 JGI24740J21852_10000582 JGI24740J21852_100005824 350
8 3300001990 JGI24737J22298_10001774 JGI24737J22298_100017744 350
9 3300005328 Ga0070676_10152611 Ga0070676_101526111 350
10 3300005330 Ga0070690_100071359 Ga0070690_1000713592 350
11 3300005331 Ga0070670_100043712 Ga0070670_1000437125 350
12 3300005334 Ga0068869_100004802 Ga0068869_10000480211 350
13 3300005338 Ga0068868_100000839 Ga0068868_10000083923 350
14 3300005339 Ga0070660_100003892 Ga0070660_1000038928 350
15 3300005344 Ga0070661_100270091 Ga0070661_1002700911 350
16 3300005353 Ga0070669_100001226 Ga0070669_1000012265 350
17 3300005364 Ga0070673_100005921 Ga0070673_1000059215 350
18 3300005367 Ga0070667_100044670 Ga0070667_1000446702 350
19 3300005457 Ga0070662_100011868 Ga0070662_1000118681 350
20 3300005459 Ga0068867_100002768 Ga0068867_1000027685 350
21 3300005539 Ga0068853_100001611 Ga0068853_10000161117 350
22 3300005577 Ga0068857_100013009 Ga0068857_1000130095 350
23 3300005618 Ga0068864_100025473 Ga0068864_1000254734 350
24 3300005719 Ga0068861_100087103 Ga0068861_1000871032 350
25 3300005841 Ga0068863_100035782 Ga0068863_1000357821 350
26 3300005842 Ga0068858_100009449 Ga0068858_10000944912 350
27 3300005844 Ga0068862_100030963 Ga0068862_1000309634 350
28 3300009174 Ga0105241_10017032 Ga0105241_100170321 350
29 3300010375 Ga0105239_10009152 Ga0105239_100091524 350
30 3300013307 Ga0157372_10026260 Ga0157372_100262603 350
31 3300025290 Ga0207673_1000043 Ga0207673_10000434 350
32 3300025938 Ga0207704_10040182 Ga0207704_100401825 350
33 3300025940 Ga0207691_10023959 Ga0207691_100239597 350
34 3300025941 Ga0207711_10009331 Ga0207711_100093312 350
35 3300025949 Ga0207667_10112794 Ga0207667_101127942 350
36 3300025960 Ga0207651_10039050 Ga0207651_100390503 350
37 3300025972 Ga0207668_10027826 Ga0207668_100278263 350
38 3300025981 Ga0207640_10001164 Ga0207640_1000116417 350
39 3300026035 Ga0207703_10005591 Ga0207703_100055913 350
40 3300026041 Ga0207639_10162432 Ga0207639_101624322 350
41 3300026088 Ga0207641_10154601 Ga0207641_101546011 350
42 3300026095 Ga0207676_10012132 Ga0207676_100121325 350
43 3300026116 Ga0207674_10025450 Ga0207674_100254502 350
44 3300026142 Ga0207698_10042274 Ga0207698_100422741 350
45 3300049585 Ga0501069_0034359 Ga0501069_0034359_1449_2675 350
46 3300037466 Ga0395898_0132712 Ga0395898_0132712_972_2180 352
47 3300039437 Ga0436365_1078212 Ga0436365_1078212_3278_4471 352
48 3300005435 Ga0070714_100071189 Ga0070714_1000711892 354
49 3300048915 Ga0496112_0129543 Ga0496112_0129543_10_1158 354
50 3300025961 Ga0207712_10053319 Ga0207712_100533192 355
51 3300046684 Ga0495669_0005332 Ga0495669_0005332_3289_4512 356
52 3300049583 Ga0501067_0046073 Ga0501067_0046073_16_1206 356
53 3300005578 Ga0068854_100013602 Ga0068854_1000136022 357
54 3300009551 Ga0105238_10266715 Ga0105238_102667152 357
55 3300013100 Ga0157373_10052559 Ga0157373_100525591 357
56 3300013105 Ga0157369_10078077 Ga0157369_100780772 357
57 3300025940 Ga0207691_10014051 Ga0207691_100140512 357
58 3300037312 Ga0395899_0168074 Ga0395899_0168074_12_1205 357
59 3300038443 Ga0395901_0285868 Ga0395901_0285868_191_1405 357
60 3300044656 Ga0466969_0008203 Ga0466969_0008203_1401_2618 359
61 3300045049 Ga0466959_0040967 Ga0466959_0040967_661_1878 359
62 3300005339 Ga0070660_100046747 Ga0070660_1000467471 360
63 3300005344 Ga0070661_100028754 Ga0070661_1000287542 360
64 3300005344 Ga0070661_100032857 Ga0070661_1000328573 360
65 3300005366 Ga0070659_100006393 Ga0070659_1000063933 360
66 3300005367 Ga0070667_100005257 Ga0070667_1000052579 360
67 3300005457 Ga0070662_100017335 Ga0070662_1000173353 360
68 3300005458 Ga0070681_10038136 Ga0070681_100381362 360
69 3300005530 Ga0070679_100006646 Ga0070679_1000066463 360
70 3300005547 Ga0070693_100086503 Ga0070693_1000865032 360
71 3300005564 Ga0070664_100097327 Ga0070664_1000973272 360
72 3300005616 Ga0068852_100025623 Ga0068852_1000256234 360
73 3300006881 Ga0068865_100034904 Ga0068865_1000349043 360
74 3300009093 Ga0105240_10279614 Ga0105240_102796141 360
75 3300009098 Ga0105245_10033044 Ga0105245_100330442 360
76 3300013102 Ga0157371_10067647 Ga0157371_100676472 360
77 3300025909 Ga0207705_10002048 Ga0207705_1000204811 360
78 3300025912 Ga0207707_10173248 Ga0207707_101732482 360
79 3300025919 Ga0207657_10002987 Ga0207657_100029874 360
80 3300025919 Ga0207657_10057826 Ga0207657_100578263 360
81 3300025920 Ga0207649_10058928 Ga0207649_100589282 360
82 3300025938 Ga0207704_10018990 Ga0207704_100189902 360
83 3300026089 Ga0207648_10023643 Ga0207648_100236434 360
84 3300026142 Ga0207698_10204961 Ga0207698_102049611 360
85 3300037471 Ga0395905_0097212 Ga0395905_0097212_376_1608 360
86 3300037471 Ga0395905_0378347 Ga0395905_0378347_37_1257 360
87 3300038443 Ga0395901_0005599 Ga0395901_0005599_7313_8545 360
88 3300048907 Ga0496104_0154285 Ga0496104_0154285_752_1966 360
89 3300048909 Ga0496106_0109908 Ga0496106_0109908_27_1241 360
90 3300021384 Ga0213876_10094534 Ga0213876_100945342 361
91 3300025920 Ga0207649_10118253 Ga0207649_101182532 361
92 3300037418 Ga0395900_0106025 Ga0395900_0106025_110_1336 361
93 3300009176 Ga0105242_10011130 Ga0105242_100111304 362
94 3300014325 Ga0163163_10129456 Ga0163163_101294562 362
95 3300025931 Ga0207644_10000344 Ga0207644_1000034412 362
96 3300025960 Ga0207651_10005686 Ga0207651_100056864 362
97 3300026121 Ga0207683_10002230 Ga0207683_100022303 362
98 3300044693 Ga0466961_0067916 Ga0466961_0067916_322_1539 362
99 3300044694 Ga0466963_0040481 Ga0466963_0040481_936_2153 362
100 3300044842 Ga0466957_0046691 Ga0466957_0046691_889_2106 362
101 3300045836 Ga0466958_0004023 Ga0466958_0004023_5261_6478 362
102 3300048904 Ga0496101_0031083 Ga0496101_0031083_888_2102 362
103 3300048910 Ga0496107_0029406 Ga0496107_0029406_1666_2880 362
104 3300048912 Ga0496109_0036166 Ga0496109_0036166_1261_2475 362
105 3300048913 Ga0496110_0000304 Ga0496110_0000304_14134_15348 362
106 3300048914 Ga0496111_0000223 Ga0496111_0000223_15818_17032 362
107 3300048915 Ga0496112_0000602 Ga0496112_0000602_8761_9975 362
108 3300048916 Ga0496113_0015517 Ga0496113_0015517_2906_4120 362
109 3300061719 Ga0466962_0001508 Ga0466962_0001508_7201_8418 362
110 3300005364 Ga0070673_100047538 Ga0070673_1000475382 364
111 3300037312 Ga0395899_0069070 Ga0395899_0069070_1197_2465 364
112 3300037466 Ga0395898_0072618 Ga0395898_0072618_1963_3231 364
113 3300037471 Ga0395905_0010138 Ga0395905_0010138_2807_4036 364
114 3300038443 Ga0395901_0029305 Ga0395901_0029305_750_1979 364
115 3300038443 Ga0395901_0092414 Ga0395901_0092414_552_1820 364
116 3300048911 Ga0496108_0057112 Ga0496108_0057112_1445_2665 364
117 3300001990 JGI24737J22298_10000319 JGI24737J22298_100003196 365
118 3300005331 Ga0070670_100005046 Ga0070670_1000050469 365
119 3300005577 Ga0068857_100021218 Ga0068857_1000212184 365
120 3300005841 Ga0068863_100017910 Ga0068863_1000179104 365
121 3300014325 Ga0163163_10016280 Ga0163163_100162802 365
122 3300025925 Ga0207650_10155119 Ga0207650_101551192 365
123 3300025949 Ga0207667_10303918 Ga0207667_103039182 365
124 3300026088 Ga0207641_10019596 Ga0207641_100195962 365
125 3300026095 Ga0207676_10091627 Ga0207676_100916272 365
126 3300026116 Ga0207674_10000567 Ga0207674_1000056749 365
127 3300005334 Ga0068869_100041786 Ga0068869_1000417863 366
128 3300005353 Ga0070669_100026252 Ga0070669_1000262522 366
129 3300005366 Ga0070659_100190233 Ga0070659_1001902332 366
130 3300005455 Ga0070663_100027408 Ga0070663_1000274082 366
131 3300005457 Ga0070662_100119406 Ga0070662_1001194062 366
132 3300005618 Ga0068864_100027653 Ga0068864_1000276533 366
133 3300005841 Ga0068863_100051651 Ga0068863_1000516513 366
134 3300005842 Ga0068858_100021946 Ga0068858_1000219464 366
135 3300005844 Ga0068862_100036017 Ga0068862_1000360173 366
136 3300025932 Ga0207690_10083246 Ga0207690_100832462 366
137 3300025981 Ga0207640_10105043 Ga0207640_101050432 366
138 3300026067 Ga0207678_10037134 Ga0207678_100371342 366
139 3300026088 Ga0207641_10116910 Ga0207641_101169102 366
140 3300026095 Ga0207676_10047529 Ga0207676_100475293 366
141 3300026116 Ga0207674_10000632 Ga0207674_100006323 366
142 3300028380 Ga0268265_10060848 Ga0268265_100608481 366
143 3300028381 Ga0268264_10040964 Ga0268264_100409642 366
144 3300001989 JGI24739J22299_10024365 JGI24739J22299_100243652 367
145 3300001990 JGI24737J22298_10001975 JGI24737J22298_100019752 367
146 3300005327 Ga0070658_10000305 Ga0070658_100003055 367
147 3300005329 Ga0070683_100000872 Ga0070683_10000087220 367
148 3300005330 Ga0070690_100024321 Ga0070690_1000243212 367
149 3300005331 Ga0070670_100016847 Ga0070670_1000168473 367
150 3300005335 Ga0070666_10001510 Ga0070666_100015108 367
151 3300005339 Ga0070660_100000129 Ga0070660_10000012911 367
152 3300005344 Ga0070661_100000033 Ga0070661_10000003381 367
153 3300005355 Ga0070671_100015971 Ga0070671_1000159714 367
154 3300005364 Ga0070673_100160741 Ga0070673_1001607412 367
155 3300005366 Ga0070659_100000142 Ga0070659_10000014231 367
156 3300005455 Ga0070663_100000230 Ga0070663_10000023024 367
157 3300005457 Ga0070662_100000021 Ga0070662_10000002136 367
158 3300005535 Ga0070684_100149146 Ga0070684_1001491462 367
159 3300005539 Ga0068853_100000220 Ga0068853_10000022010 367
160 3300005547 Ga0070693_100002649 Ga0070693_1000026494 367
161 3300005563 Ga0068855_100001017 Ga0068855_10000101738 367
162 3300005564 Ga0070664_100000153 Ga0070664_10000015339 367
163 3300005614 Ga0068856_100000177 Ga0068856_10000017739 367
164 3300005614 Ga0068856_100108894 Ga0068856_1001088942 367
165 3300005616 Ga0068852_100003922 Ga0068852_1000039225 367
166 3300005617 Ga0068859_100057978 Ga0068859_1000579782 367
167 3300005617 Ga0068859_100248165 Ga0068859_1002481652 367
168 3300005618 Ga0068864_100010316 Ga0068864_1000103164 367
169 3300006931 Ga0097620_100057979 Ga0097620_1000579792 367
170 3300006931 Ga0097620_100248169 Ga0097620_1002481692 367
171 3300009174 Ga0105241_10152828 Ga0105241_101528282 367
172 3300009177 Ga0105248_10006145 Ga0105248_1000614510 367
173 3300009551 Ga0105238_10076664 Ga0105238_100766642 367
174 3300013100 Ga0157373_10008231 Ga0157373_100082312 367
175 3300013102 Ga0157371_10000934 Ga0157371_100009344 367
176 3300013105 Ga0157369_10029519 Ga0157369_100295192 367
177 3300014325 Ga0163163_10002761 Ga0163163_100027614 367
178 3300014968 Ga0157379_10114782 Ga0157379_101147821 367
179 3300025903 Ga0207680_10000516 Ga0207680_100005168 367
180 3300025904 Ga0207647_10070480 Ga0207647_100704802 367
181 3300025909 Ga0207705_10000174 Ga0207705_1000017410 367
182 3300025911 Ga0207654_10009921 Ga0207654_100099214 367
183 3300025919 Ga0207657_10000173 Ga0207657_1000017339 367
184 3300025920 Ga0207649_10000014 Ga0207649_1000001478 367
185 3300025924 Ga0207694_10063629 Ga0207694_100636292 367
186 3300025925 Ga0207650_10027562 Ga0207650_100275622 367
187 3300025931 Ga0207644_10004512 Ga0207644_100045125 367
188 3300025932 Ga0207690_10000150 Ga0207690_1000015025 367
189 3300025933 Ga0207706_10000358 Ga0207706_1000035820 367
190 3300025933 Ga0207706_10161080 Ga0207706_101610801 367
191 3300025941 Ga0207711_10003745 Ga0207711_100037454 367
192 3300025944 Ga0207661_10002752 Ga0207661_100027525 367
193 3300025945 Ga0207679_10000323 Ga0207679_1000032326 367
194 3300025949 Ga0207667_10011906 Ga0207667_100119064 367
195 3300025960 Ga0207651_10119735 Ga0207651_101197352 367
196 3300025986 Ga0207658_10016242 Ga0207658_100162423 367
197 3300026035 Ga0207703_10066845 Ga0207703_100668452 367
198 3300026041 Ga0207639_10000740 Ga0207639_100007405 367
199 3300026067 Ga0207678_10001573 Ga0207678_1000157324 367
200 3300026078 Ga0207702_10000840 Ga0207702_1000084022 367
201 3300026095 Ga0207676_10010753 Ga0207676_100107534 367
202 3300026142 Ga0207698_10002807 Ga0207698_100028074 367
203 3300035121 Ga0373960_0039549 Ga0373960_0039549_95_1312 367
204 3300035242 Ga0373962_0035035 Ga0373962_0035035_102_1319 367
205 3300035691 Ga0373931_0008900 Ga0373931_0008900_3377_4594 367
206 3300037418 Ga0395900_0017368 Ga0395900_0017368_744_1967 367
207 3300042157 Ga0439458_0005918 Ga0439458_0005918_810_2039 367
208 3300009551 Ga0105238_10125780 Ga0105238_101257803 368
209 3300017792 Ga0163161_10149390 Ga0163161_101493902 368
210 3300026023 Ga0207677_10013797 Ga0207677_100137972 368
211 3300009148 Ga0105243_10159078 Ga0105243_101590782 369
212 3300014497 Ga0182008_10052691 Ga0182008_100526912 369
213 3300037418 Ga0395900_0024110 Ga0395900_0024110_3321_4547 369
214 3300037466 Ga0395898_0099362 Ga0395898_0099362_391_1620 369
215 3300037466 Ga0395898_0122040 Ga0395898_0122040_465_1691 369
216 3300037471 Ga0395905_0004699 Ga0395905_0004699_11053_12282 369
217 3300037471 Ga0395905_0011652 Ga0395905_0011652_3200_4426 369
218 3300038443 Ga0395901_0047661 Ga0395901_0047661_481_1707 369
219 3300038443 Ga0395901_0322745 Ga0395901_0322745_46_1275 369
220 3300005335 Ga0070666_10041013 Ga0070666_100410131 370
221 3300005355 Ga0070671_100090230 Ga0070671_1000902302 370
222 3300025903 Ga0207680_10085315 Ga0207680_100853152 370
223 3300037466 Ga0395898_0158087 Ga0395898_0158087_460_1689 370
224 3300037471 Ga0395905_0001936 Ga0395905_0001936_7561_8790 370
225 3300037471 Ga0395905_0011574 Ga0395905_0011574_6343_7569 370
226 3300005355 Ga0070671_100046280 Ga0070671_1000462803 371
227 3300009177 Ga0105248_10036489 Ga0105248_100364894 371
228 3300025931 Ga0207644_10015322 Ga0207644_100153223 371
229 3300037312 Ga0395899_0010781 Ga0395899_0010781_1386_2606 371
230 3300037466 Ga0395898_0042062 Ga0395898_0042062_1163_2383 371
231 3300037471 Ga0395905_0012227 Ga0395905_0012227_4986_6206 371
232 3300038443 Ga0395901_0046870 Ga0395901_0046870_2013_3233 371
233 3300048904 Ga0496101_0047867 Ga0496101_0047867_218_1438 371
234 3300048912 Ga0496109_0043020 Ga0496109_0043020_11_1231 371
235 3300048913 Ga0496110_0024363 Ga0496110_0024363_310_1530 371
236 3300048914 Ga0496111_0014596 Ga0496111_0014596_3831_5051 371
237 3300048915 Ga0496112_0008649 Ga0496112_0008649_6167_7387 371
238 3300005834 Ga0068851_10036338 Ga0068851_100363382 372
239 3300025321 Ga0207656_10011828 Ga0207656_100118282 372
240 3300025909 Ga0207705_10016807 Ga0207705_100168074 372
241 3300025945 Ga0207679_10238622 Ga0207679_102386222 372
242 3300048916 Ga0496113_0006446 Ga0496113_0006446_691_1911 372
243 3300001989 JGI24739J22299_10001907 JGI24739J22299_100019072 373
244 3300005327 Ga0070658_10023104 Ga0070658_100231043 373
245 3300005331 Ga0070670_100001610 Ga0070670_10000161010 373
246 3300005335 Ga0070666_10038587 Ga0070666_100385872 373
247 3300005548 Ga0070665_100010939 Ga0070665_1000109392 373
248 3300013307 Ga0157372_10038905 Ga0157372_100389054 373
249 3300025903 Ga0207680_10005461 Ga0207680_100054615 373
250 3300025904 Ga0207647_10077532 Ga0207647_100775322 373
251 3300025919 Ga0207657_10001564 Ga0207657_1000156425 373
252 3300025933 Ga0207706_10000479 Ga0207706_1000047940 373
253 3300025944 Ga0207661_10145319 Ga0207661_101453192 373
254 3300025945 Ga0207679_10001732 Ga0207679_1000173210 373
255 3300026116 Ga0207674_10008808 Ga0207674_100088089 373
256 3300005435 Ga0070714_100002762 Ga0070714_10000276211 374
257 3300025929 Ga0207664_10077566 Ga0207664_100775661 374
258 3300048917 Ga0496114_0000006 Ga0496114_0000006_30800_31999 374
259 3300045976 Ga0466967_0142827 Ga0466967_0142827_287_1516 375
260 3300028379 Ga0268266_10187329 Ga0268266_101873291 376
261 3300046616 Ga0495668_0016173 Ga0495668_0016173_2403_3656 376
262 3300046684 Ga0495669_0006064 Ga0495669_0006064_2371_3624 376
263 3300005328 Ga0070676_10000684 Ga0070676_1000068414 377
264 3300005347 Ga0070668_100000565 Ga0070668_10000056515 377
265 3300005353 Ga0070669_100063807 Ga0070669_1000638071 377
266 3300005356 Ga0070674_100011978 Ga0070674_1000119784 377
267 3300005364 Ga0070673_100028715 Ga0070673_1000287154 377
268 3300005367 Ga0070667_100035265 Ga0070667_1000352653 377
269 3300005456 Ga0070678_100054899 Ga0070678_1000548992 377
270 3300005459 Ga0068867_100013532 Ga0068867_1000135323 377
271 3300005543 Ga0070672_100030061 Ga0070672_1000300612 377
272 3300006881 Ga0068865_100015120 Ga0068865_1000151203 377
273 3300025907 Ga0207645_10001931 Ga0207645_100019313 377
274 3300025923 Ga0207681_10017961 Ga0207681_100179612 377
275 3300025928 Ga0207700_10099467 Ga0207700_100994672 377
276 3300025937 Ga0207669_10004720 Ga0207669_100047205 377
277 3300025938 Ga0207704_10004738 Ga0207704_100047385 377
278 3300025940 Ga0207691_10039111 Ga0207691_100391112 377
279 3300025942 Ga0207689_10074116 Ga0207689_100741162 377
280 3300025960 Ga0207651_10004464 Ga0207651_100044644 377
281 3300025972 Ga0207668_10000129 Ga0207668_1000012916 377
282 3300025986 Ga0207658_10006812 Ga0207658_100068123 377
283 3300026089 Ga0207648_10019560 Ga0207648_100195603 377
284 3300026121 Ga0207683_10027080 Ga0207683_100270804 377
285 3300045976 Ga0466967_0103080 Ga0466967_0103080_717_1937 377
286 3300046684 Ga0495669_0000413 Ga0495669_0000413_11212_12420 377
287 3300005327 Ga0070658_10032404 Ga0070658_100324044 378
288 3300005330 Ga0070690_100011418 Ga0070690_1000114184 378
289 3300005335 Ga0070666_10000404 Ga0070666_1000040427 378
290 3300005338 Ga0068868_100001635 Ga0068868_1000016356 378
291 3300005364 Ga0070673_100005942 Ga0070673_1000059426 378
292 3300005367 Ga0070667_100000368 Ga0070667_10000036835 378
293 3300005367 Ga0070667_100001727 Ga0070667_10000172711 378
294 3300005617 Ga0068859_100000221 Ga0068859_10000022137 378
295 3300005618 Ga0068864_100000324 Ga0068864_10000032432 378
296 3300005841 Ga0068863_100001640 Ga0068863_10000164016 378
297 3300005842 Ga0068858_100002510 Ga0068858_10000251014 378
298 3300005842 Ga0068858_100003711 Ga0068858_1000037115 378
299 3300005843 Ga0068860_100001066 Ga0068860_10000106610 378
300 3300006931 Ga0097620_100000221 Ga0097620_10000022137 378
301 3300009092 Ga0105250_10015358 Ga0105250_100153582 378
302 3300009101 Ga0105247_10082001 Ga0105247_100820011 378
303 3300009177 Ga0105248_10000502 Ga0105248_100005024 378
304 3300009177 Ga0105248_10001683 Ga0105248_1000168324 378
305 3300013306 Ga0163162_10061110 Ga0163162_100611103 378
306 3300014325 Ga0163163_10000164 Ga0163163_100001645 378
307 3300014968 Ga0157379_10013589 Ga0157379_100135892 378
308 3300025711 Ga0207696_1008783 Ga0207696_10087832 378
309 3300025909 Ga0207705_10021410 Ga0207705_100214102 378
310 3300025937 Ga0207669_10003173 Ga0207669_100031734 378
311 3300025941 Ga0207711_10000042 Ga0207711_10000042125 378
312 3300025941 Ga0207711_10001247 Ga0207711_100012474 378
313 3300025986 Ga0207658_10001855 Ga0207658_100018557 378
314 3300025986 Ga0207658_10018332 Ga0207658_100183324 378
315 3300026023 Ga0207677_10005736 Ga0207677_100057362 378
316 3300026035 Ga0207703_10001128 Ga0207703_100011283 378
317 3300026035 Ga0207703_10012327 Ga0207703_100123273 378
318 3300026067 Ga0207678_10031195 Ga0207678_100311954 378
319 3300026088 Ga0207641_10000415 Ga0207641_1000041517 378
320 3300028381 Ga0268264_10000710 Ga0268264_1000071010 378
321 3300038443 Ga0395901_0062259 Ga0395901_0062259_1047_2270 378
322 3300006028 Ga0070717_10005021 Ga0070717_100050214 379
323 3300025919 Ga0207657_10047598 Ga0207657_100475983 379
324 3300035120 Ga0373957_0035408 Ga0373957_0035408_269_1489 379
325 3300036401 Ga0373937_0004093 Ga0373937_0004093_9517_10737 379
326 3300037312 Ga0395899_0102856 Ga0395899_0102856_468_1694 379
327 3300037418 Ga0395900_0048585 Ga0395900_0048585_3014_4228 379
328 3300037466 Ga0395898_0045909 Ga0395898_0045909_2933_4159 379
329 3300037471 Ga0395905_0021193 Ga0395905_0021193_3692_4906 379
330 3300037471 Ga0395905_0063383 Ga0395905_0063383_610_1836 379
331 3300038443 Ga0395901_0026072 Ga0395901_0026072_3491_4717 379
332 3300044693 Ga0466961_0034062 Ga0466961_0034062_471_1697 379
333 3300046684 Ga0495669_0032803 Ga0495669_0032803_695_1930 379
334 3300048903 Ga0496100_0041060 Ga0496100_0041060_839_2074 379
335 3300048910 Ga0496107_0090211 Ga0496107_0090211_810_2045 379
336 3300048918 Ga0496115_0001435 Ga0496115_0001435_360_1595 379
337 3300001979 JGI24740J21852_10019985 JGI24740J21852_100199852 380
338 3300005327 Ga0070658_10018829 Ga0070658_100188294 380
339 3300005327 Ga0070658_10052619 Ga0070658_100526192 380
340 3300005339 Ga0070660_100036290 Ga0070660_1000362902 380
341 3300005355 Ga0070671_100001360 Ga0070671_10000136021 380
342 3300005355 Ga0070671_100119516 Ga0070671_1001195162 380
343 3300005367 Ga0070667_100009487 Ga0070667_1000094873 380
344 3300005458 Ga0070681_10018603 Ga0070681_100186034 380
345 3300005458 Ga0070681_10110345 Ga0070681_101103452 380
346 3300005530 Ga0070679_100057816 Ga0070679_1000578163 380
347 3300005564 Ga0070664_100292567 Ga0070664_1002925672 380
348 3300005577 Ga0068857_100011019 Ga0068857_1000110194 380
349 3300005577 Ga0068857_100316961 Ga0068857_1003169611 380
350 3300005614 Ga0068856_100074754 Ga0068856_1000747542 380
351 3300005614 Ga0068856_100147780 Ga0068856_1001477802 380
352 3300005616 Ga0068852_100055234 Ga0068852_1000552342 380
353 3300005616 Ga0068852_100069985 Ga0068852_1000699852 380
354 3300005985 Ga0081539_10089681 Ga0081539_100896812 380
355 3300006177 Ga0075362_10048978 Ga0075362_100489782 380
356 3300009174 Ga0105241_10104523 Ga0105241_101045232 380
357 3300013100 Ga0157373_10002473 Ga0157373_100024733 380
358 3300013100 Ga0157373_10115016 Ga0157373_101150162 380
359 3300013102 Ga0157371_10107294 Ga0157371_101072942 380
360 3300013104 Ga0157370_10042914 Ga0157370_100429142 380
361 3300013105 Ga0157369_10038800 Ga0157369_100388004 380
362 3300013105 Ga0157369_10147715 Ga0157369_101477152 380
363 3300013306 Ga0163162_10047912 Ga0163162_100479122 380
364 3300025904 Ga0207647_10025843 Ga0207647_100258433 380
365 3300025909 Ga0207705_10007111 Ga0207705_100071114 380
366 3300025909 Ga0207705_10082203 Ga0207705_100822032 380
367 3300025912 Ga0207707_10124422 Ga0207707_101244222 380
368 3300025917 Ga0207660_10137528 Ga0207660_101375282 380
369 3300025919 Ga0207657_10073650 Ga0207657_100736502 380
370 3300025920 Ga0207649_10049237 Ga0207649_100492372 380
371 3300025920 Ga0207649_10081479 Ga0207649_100814792 380
372 3300025931 Ga0207644_10011248 Ga0207644_100112483 380
373 3300025931 Ga0207644_10021480 Ga0207644_100214802 380
374 3300025941 Ga0207711_10007695 Ga0207711_100076953 380
375 3300025986 Ga0207658_10005014 Ga0207658_100050145 380
376 3300026067 Ga0207678_10035335 Ga0207678_100353353 380
377 3300026078 Ga0207702_10086365 Ga0207702_100863652 380
378 3300026116 Ga0207674_10017607 Ga0207674_100176074 380
379 3300026116 Ga0207674_10093541 Ga0207674_100935412 380
380 3300026142 Ga0207698_10037433 Ga0207698_100374332 380
381 3300026142 Ga0207698_10079410 Ga0207698_100794102 380
382 3300026142 Ga0207698_10107789 Ga0207698_101077892 380
383 3300028381 Ga0268264_10031110 Ga0268264_100311104 380
384 3300042157 Ga0439458_0000176 Ga0439458_0000176_5934_7163 380
385 3300044684 Ga0466966_0121438 Ga0466966_0121438_80_1300 380
386 3300044694 Ga0466963_0222349 Ga0466963_0222349_58_1284 380
387 3300045049 Ga0466959_0011277 Ga0466959_0011277_3302_4522 380
388 3300048915 Ga0496112_0112390 Ga0496112_0112390_369_1586 380
389 3300048916 Ga0496113_0040359 Ga0496113_0040359_536_1762 380
390 3300048917 Ga0496114_0047705 Ga0496114_0047705_279_1517 380
391 3300050489 nmdc:mga03683_41345_c1 nmdc:mga03683_41345_c1_225_1448 380
392 3300001979 JGI24740J21852_10014511 JGI24740J21852_100145112 381
393 3300005327 Ga0070658_10056057 Ga0070658_100560572 381
394 3300005327 Ga0070658_10132538 Ga0070658_101325382 381
395 3300005329 Ga0070683_100066522 Ga0070683_1000665222 381
396 3300005336 Ga0070680_100081289 Ga0070680_1000812892 381
397 3300005337 Ga0070682_100143785 Ga0070682_1001437852 381
398 3300005344 Ga0070661_100061054 Ga0070661_1000610542 381
399 3300005355 Ga0070671_100085052 Ga0070671_1000850522 381
400 3300005366 Ga0070659_100129015 Ga0070659_1001290151 381
401 3300005366 Ga0070659_100200826 Ga0070659_1002008261 381
402 3300005539 Ga0068853_100064691 Ga0068853_1000646912 381
403 3300005564 Ga0070664_100122648 Ga0070664_1001226482 381
404 3300005577 Ga0068857_100044848 Ga0068857_1000448482 381
405 3300005614 Ga0068856_100036643 Ga0068856_1000366434 381
406 3300005614 Ga0068856_100131001 Ga0068856_1001310012 381
407 3300006844 Ga0075428_100188850 Ga0075428_1001888502 381
408 3300009545 Ga0105237_10128906 Ga0105237_101289062 381
409 3300009551 Ga0105238_10052968 Ga0105238_100529683 381
410 3300013104 Ga0157370_10039613 Ga0157370_100396131 381
411 3300013307 Ga0157372_10107855 Ga0157372_101078552 381
412 3300025321 Ga0207656_10033325 Ga0207656_100333252 381
413 3300025904 Ga0207647_10012789 Ga0207647_100127892 381
414 3300025909 Ga0207705_10028081 Ga0207705_100280812 381
415 3300025913 Ga0207695_10038379 Ga0207695_100383791 381
416 3300025919 Ga0207657_10053152 Ga0207657_100531523 381
417 3300025949 Ga0207667_10082101 Ga0207667_100821013 381
418 3300025981 Ga0207640_10007979 Ga0207640_100079794 381
419 3300026078 Ga0207702_10029315 Ga0207702_100293153 381
420 3300026078 Ga0207702_10030433 Ga0207702_100304334 381
421 3300026116 Ga0207674_10045687 Ga0207674_100456873 381
422 3300026142 Ga0207698_10091781 Ga0207698_100917812 381
423 3300037312 Ga0395899_0038536 Ga0395899_0038536_1569_2792 381
424 3300037466 Ga0395898_0036405 Ga0395898_0036405_2885_4108 381
425 3300044658 Ga0466972_0022956 Ga0466972_0022956_1115_2335 381
426 3300044706 Ga0466964_0000579 Ga0466964_0000579_719_1939 381
427 3300044735 Ga0466968_0023539 Ga0466968_0023539_335_1555 381
428 3300044765 Ga0466970_0012361 Ga0466970_0012361_1238_2458 381
429 3300045049 Ga0466959_0062607 Ga0466959_0062607_1259_2479 381
430 3300045836 Ga0466958_0015462 Ga0466958_0015462_2198_3418 381
431 3300045976 Ga0466967_0085883 Ga0466967_0085883_966_2186 381
432 3300046537 Ga0495598_0025360 Ga0495598_0025360_352_1572 381
433 3300046684 Ga0495669_0005108 Ga0495669_0005108_838_2058 381
434 3300046691 Ga0495670_0021099 Ga0495670_0021099_148_1368 381
435 3300048903 Ga0496100_0107919 Ga0496100_0107919_301_1524 381
436 3300048910 Ga0496107_0049996 Ga0496107_0049996_752_1975 381
437 3300048915 Ga0496112_0009173 Ga0496112_0009173_809_2032 381
438 3300048917 Ga0496114_0029661 Ga0496114_0029661_653_1876 381
439 3300048918 Ga0496115_0043171 Ga0496115_0043171_1686_2909 381
440 3300001976 JGI24752J21851_1001738 JGI24752J21851_10017382 382
441 3300005331 Ga0070670_100003445 Ga0070670_1000034459 382
442 3300005335 Ga0070666_10013364 Ga0070666_100133644 382
443 3300005344 Ga0070661_100075479 Ga0070661_1000754792 382
444 3300005355 Ga0070671_100054490 Ga0070671_1000544902 382
445 3300005364 Ga0070673_100004324 Ga0070673_1000043246 382
446 3300005367 Ga0070667_100004054 Ga0070667_1000040545 382
447 3300005435 Ga0070714_100144277 Ga0070714_1001442772 382
448 3300005436 Ga0070713_100025541 Ga0070713_1000255413 382
449 3300005456 Ga0070678_100003094 Ga0070678_1000030947 382
450 3300005457 Ga0070662_100002861 Ga0070662_1000028615 382
451 3300005459 Ga0068867_100078383 Ga0068867_1000783832 382
452 3300005466 Ga0070685_10056115 Ga0070685_100561152 382
453 3300005543 Ga0070672_100012302 Ga0070672_1000123023 382
454 3300005548 Ga0070665_100019380 Ga0070665_1000193803 382
455 3300005564 Ga0070664_100018694 Ga0070664_1000186944 382
456 3300005577 Ga0068857_100012805 Ga0068857_1000128056 382
457 3300005616 Ga0068852_100057035 Ga0068852_1000570352 382
458 3300005618 Ga0068864_100038110 Ga0068864_1000381103 382
459 3300005841 Ga0068863_100003096 Ga0068863_10000309611 382
460 3300005841 Ga0068863_100062948 Ga0068863_1000629482 382
461 3300005844 Ga0068862_100179296 Ga0068862_1001792962 382
462 3300006237 Ga0097621_100009565 Ga0097621_1000095657 382
463 3300006852 Ga0075433_10022730 Ga0075433_100227305 382
464 3300009177 Ga0105248_10020411 Ga0105248_100204114 382
465 3300009553 Ga0105249_10135556 Ga0105249_101355562 382
466 3300011119 Ga0105246_10127701 Ga0105246_101277012 382
467 3300013296 Ga0157374_10027445 Ga0157374_100274452 382
468 3300013297 Ga0157378_10073605 Ga0157378_100736052 382
469 3300013306 Ga0163162_10001373 Ga0163162_100013736 382
470 3300013308 Ga0157375_10005377 Ga0157375_100053778 382
471 3300014325 Ga0163163_10003982 Ga0163163_100039824 382
472 3300014745 Ga0157377_10109695 Ga0157377_101096952 382
473 3300025903 Ga0207680_10039005 Ga0207680_100390052 382
474 3300025915 Ga0207693_10175127 Ga0207693_101751271 382
475 3300025925 Ga0207650_10017158 Ga0207650_100171584 382
476 3300025928 Ga0207700_10012555 Ga0207700_100125553 382
477 3300025931 Ga0207644_10013676 Ga0207644_100136762 382
478 3300025933 Ga0207706_10002282 Ga0207706_100022825 382
479 3300025933 Ga0207706_10242337 Ga0207706_102423372 382
480 3300025940 Ga0207691_10004453 Ga0207691_100044534 382
481 3300025941 Ga0207711_10005486 Ga0207711_100054868 382
482 3300025945 Ga0207679_10008398 Ga0207679_100083983 382
483 3300025960 Ga0207651_10036166 Ga0207651_100361662 382
484 3300025986 Ga0207658_10006482 Ga0207658_100064822 382
485 3300026035 Ga0207703_10019431 Ga0207703_100194314 382
486 3300026067 Ga0207678_10005191 Ga0207678_100051918 382
487 3300026088 Ga0207641_10006423 Ga0207641_100064233 382
488 3300026088 Ga0207641_10007627 Ga0207641_100076276 382
489 3300026089 Ga0207648_10095937 Ga0207648_100959372 382
490 3300026095 Ga0207676_10004550 Ga0207676_100045509 382
491 3300026116 Ga0207674_10268188 Ga0207674_102681882 382
492 3300026121 Ga0207683_10004225 Ga0207683_100042259 382
493 3300026142 Ga0207698_10021600 Ga0207698_100216002 382
494 3300028379 Ga0268266_10014214 Ga0268266_100142144 382
495 3300037471 Ga0395905_0004174 Ga0395905_0004174_4884_6107 382
496 3300037471 Ga0395905_0008274 Ga0395905_0008274_5161_6387 382
497 3300044658 Ga0466972_0024087 Ga0466972_0024087_1580_2806 382
498 3300044694 Ga0466963_0071375 Ga0466963_0071375_14_1240 382
499 3300048911 Ga0496108_0021364 Ga0496108_0021364_1002_2225 382
500 3300048912 Ga0496109_0015158 Ga0496109_0015158_5130_6353 382
501 3300048913 Ga0496110_0003817 Ga0496110_0003817_949_2172 382
502 3300048914 Ga0496111_0007246 Ga0496111_0007246_5257_6480 382
503 3300048915 Ga0496112_0016930 Ga0496112_0016930_3407_4630 382
504 3300048916 Ga0496113_0004762 Ga0496113_0004762_3850_5073 382
505 3300050515 nmdc:mga0a205_5203_c1 nmdc:mga0a205_5203_c1_4355_5578 382

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

11

344

0.83

Feature Viewer

pLDDT pTM Quality
56.04 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map