F456396

General Info

Members Datasets Scaffolds Average Seq Length
505 239 1010 123

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0009659|Ga0451577_0009659_3957_4382
Length 141
Sequence MQISDAESVVMEVLWQRSPRSAEEVAAALAESRQWQEATVKTLLNRLLNKGAIEAIRDGRRYLYSPKLQRSDWVMDESQSLLARLFDGRVAPLVAHFSEQRRLSAEDVAELRRLVASLDDGRADMPADKPTRQETDDDRDA

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
219 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
225 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
226 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
227 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
228 2643221559 Lysobacter sp. Root559 Isolate Unclassified
229 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
230 2643221573 Lysobacter sp. Root604 Isolate Unclassified
231 2643221586 Lysobacter sp. Root667 Isolate Unclassified
232 2643221612 Lysobacter sp. Root76 Isolate Unclassified
233 2643221720 Lysobacter sp. Root916 Isolate Unclassified
234 2643221727 Lysobacter sp. Root96 Isolate Unclassified
235 2643221728 Lysobacter sp. Root983 Isolate Unclassified
236 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
237 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
238 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
239 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0.79
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.14
Nodule 0
Rhizoplane 4.16
Rhizosphere 76.04
Stem 0
Stem Tuber 0
Unclassified 2.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0009659 3300042876 Bacteria 9259
2 JGI24740J21852_10025336 3300001979 Bacteria 2000
3 JGI24735J21928_10005114 3300002067 Bacteria 4367
4 JGI24735J21928_10026567 3300002067 Bacteria 1739
5 JGI24735J21928_10206454 3300002067 Bacteria 570
6 JGI25156J39149_1024129 3300002705 Bacteria 1000
7 JGI25162J39368_1000871 3300002737 Bacteria 19773
8 JGI25162J39368_1001437 3300002737 Bacteria 12791
9 JGI25157J39369_1000717 3300002741 Bacteria 17768
10 JGI25157J39369_1011807 3300002741 Bacteria 1123
11 JGI25164J39214_1000476 3300002772 Bacteria 19773
12 JGI25164J39214_1000710 3300002772 Bacteria 12791
13 JGI25165J46597_1001432 3300003214 Bacteria 12791
14 JGI25153J46596_10019562 3300003215 Bacteria 2589
15 rootH2_10259599 3300003320 Bacteria 2682
16 rootL2_10033481 3300003322 Bacteria 2123
17 rootL2_10346672 3300003322 Bacteria 1359
18 Ga0006562J51391_1035513 3300003578 Bacteria 7700
19 Ga0055529_1004542 3300003763 Bacteria 2097
20 Ga0065704_10434403 3300005289 Bacteria 719
21 Ga0065715_10067493 3300005293 Bacteria 815
22 Ga0065715_10246154 3300005293 Bacteria 1182
23 Ga0065715_10348988 3300005293 Bacteria 954
24 Ga0070658_10095761 3300005327 Bacteria 2450
25 Ga0070658_11965395 3300005327 Bacteria 505
26 Ga0070680_100122470 3300005336 Bacteria 2171
27 Ga0070680_101620584 3300005336 Bacteria 561
28 Ga0070680_101749745 3300005336 Bacteria 539
29 Ga0070682_101037874 3300005337 Bacteria 683
30 Ga0070660_100076351 3300005339 Bacteria 2624
31 Ga0070660_100597662 3300005339 Bacteria 922
32 Ga0070691_10087541 3300005341 Bacteria 1532
33 Ga0070691_10611393 3300005341 Bacteria 644
34 Ga0070692_10261468 3300005345 Bacteria 1041
35 Ga0070668_101314846 3300005347 Bacteria 657
36 Ga0070675_100146490 3300005354 Bacteria 2022
37 Ga0070659_100097519 3300005366 Bacteria 2362
38 Ga0070659_100646674 3300005366 Bacteria 911
39 Ga0070659_100700273 3300005366 Bacteria 876
40 Ga0070659_100944000 3300005366 Bacteria 755
41 Ga0070659_101494016 3300005366 Bacteria 602
42 Ga0070714_100000020 3300005435 Bacteria 169262
43 Ga0070714_100000483 3300005435 Bacteria 28816
44 Ga0070711_100269827 3300005439 Bacteria 1342
45 Ga0070663_100069657 3300005455 Bacteria 2556
46 Ga0070662_100004570 3300005457 Bacteria 8764
47 Ga0070662_100114075 3300005457 Bacteria 2063
48 Ga0070681_10068601 3300005458 Bacteria 3512
49 Ga0070681_10230492 3300005458 Bacteria 1767
50 Ga0070681_10671989 3300005458 Bacteria 951
51 Ga0070679_100150987 3300005530 Bacteria 2300
52 Ga0070684_101379385 3300005535 Bacteria 664
53 Ga0068853_102167357 3300005539 Bacteria 539
54 Ga0070693_100130029 3300005547 Bacteria 1573
55 Ga0070693_100173565 3300005547 Bacteria 1382
56 Ga0070665_102534396 3300005548 Bacteria 514
57 Ga0068855_100059900 3300005563 Bacteria 4454
58 Ga0068855_100062159 3300005563 Bacteria 4360
59 Ga0068855_100468413 3300005563 Bacteria 1373
60 Ga0068855_100599767 3300005563 Bacteria 1188
61 Ga0068855_100641369 3300005563 Bacteria 1142
62 Ga0070664_100247806 3300005564 Bacteria 1601
63 Ga0068857_100000262 3300005577 Bacteria 35604
64 Ga0068857_100060660 3300005577 Bacteria 3359
65 Ga0068857_100247420 3300005577 Bacteria 1634
66 Ga0068857_100318996 3300005577 Bacteria 1435
67 Ga0068857_100459469 3300005577 Bacteria 1191
68 Ga0068854_100002566 3300005578 Bacteria 11245
69 Ga0068854_100009914 3300005578 Bacteria 6163
70 Ga0068854_100060405 3300005578 Bacteria 2742
71 Ga0068856_100000154 3300005614 Bacteria 70608
72 Ga0068856_100194220 3300005614 Bacteria 2044
73 Ga0068856_100300371 3300005614 Bacteria 1623
74 Ga0068852_100933840 3300005616 Unclassified 885
75 Ga0068852_101840889 3300005616 Bacteria 628
76 Ga0068859_100131348 3300005617 Bacteria 2576
77 Ga0068864_100032535 3300005618 Bacteria 4432
78 Ga0068851_10018250 3300005834 Bacteria 3379
79 Ga0068863_100019264 3300005841 Bacteria 6527
80 Ga0068858_100026679 3300005842 Bacteria 5365
81 Ga0068858_100073611 3300005842 Bacteria 3171
82 Ga0068860_100021025 3300005843 Bacteria 6322
83 Ga0068860_101010891 3300005843 Bacteria 849
84 Ga0068862_100466902 3300005844 Bacteria 1192
85 Ga0070712_100174107 3300006175 Bacteria 1672
86 Ga0097621_101431629 3300006237 Unclassified 655
87 Ga0068871_101025113 3300006358 Unclassified 769
88 Ga0068871_101295497 3300006358 Bacteria 685
89 Ga0068865_101833013 3300006881 Bacteria 548
90 Ga0097620_100131345 3300006931 Bacteria 2576
91 Ga0105240_10001473 3300009093 Bacteria 40155
92 Ga0105240_10002105 3300009093 Bacteria 32571
93 Ga0105240_10016640 3300009093 Bacteria 9946
94 Ga0105240_10057656 3300009093 Bacteria 4851
95 Ga0105240_10078028 3300009093 Bacteria 4079
96 Ga0105240_10218392 3300009093 Bacteria 2222
97 Ga0105240_10404679 3300009093 Bacteria 1536
98 Ga0105240_10537084 3300009093 Bacteria 1295
99 Ga0114129_11290478 3300009147 Bacteria 905
100 Ga0105241_10969311 3300009174 Bacteria 794
101 Ga0105248_10414981 3300009177 Unclassified 1516
102 Ga0105248_11385843 3300009177 Bacteria 795
103 Ga0105237_10000055 3300009545 Bacteria 152778
104 Ga0105237_10000491 3300009545 Bacteria 56127
105 Ga0105237_10104820 3300009545 Bacteria 2819
106 Ga0105237_10121252 3300009545 Bacteria 2609
107 Ga0105238_10017135 3300009551 Bacteria 7354
108 Ga0105238_10025830 3300009551 Bacteria 5988
109 Ga0105238_10231299 3300009551 Bacteria 1825
110 Ga0105238_10307262 3300009551 Bacteria 1570
111 Ga0105238_10350374 3300009551 Bacteria 1465
112 Ga0105238_11016237 3300009551 Bacteria 850
113 Ga0105249_10314847 3300009553 Bacteria 1574
114 Ga0105239_10000023 3300010375 Bacteria 257478
115 Ga0105239_10214353 3300010375 Bacteria 2158
116 Ga0105239_11327150 3300010375 Bacteria 830
117 Ga0105246_10018028 3300011119 Bacteria 4496
118 Ga0157314_1001315 3300012500 Bacteria 1803
119 Ga0157373_10061117 3300013100 Bacteria 2668
120 Ga0157373_10075560 3300013100 Bacteria 2377
121 Ga0157373_10170546 3300013100 Bacteria 1531
122 Ga0157373_10271018 3300013100 Bacteria 1202
123 Ga0157371_10040231 3300013102 Bacteria 3339
124 Ga0157371_10126714 3300013102 Bacteria 1816
125 Ga0157371_11585844 3300013102 Bacteria 512
126 Ga0157370_10000778 3300013104 Bacteria 39997
127 Ga0157370_10006570 3300013104 Bacteria 12807
128 Ga0157370_10024396 3300013104 Bacteria 5989
129 Ga0157370_10097163 3300013104 Bacteria 2763
130 Ga0157370_10190161 3300013104 Bacteria 1906
131 Ga0157370_10355191 3300013104 Bacteria 1351
132 Ga0157369_10007227 3300013105 Bacteria 12794
133 Ga0157369_10221794 3300013105 Bacteria 1979
134 Ga0157369_10658727 3300013105 Bacteria 1079
135 Ga0157374_12104009 3300013296 Unclassified 591
136 Ga0163162_10000042 3300013306 Bacteria 131540
137 Ga0163162_10176667 3300013306 Bacteria 2261
138 Ga0163162_10513112 3300013306 Unclassified 1329
139 Ga0163162_13277048 3300013306 Bacteria 519
140 Ga0157372_10115904 3300013307 Bacteria 3072
141 Ga0157372_10286416 3300013307 Bacteria 1916
142 Ga0157372_10453581 3300013307 Bacteria 1494
143 Ga0157372_10570640 3300013307 Bacteria 1319
144 Ga0157375_10486187 3300013308 Bacteria 1399
145 Ga0157375_10521726 3300013308 Bacteria 1351
146 Ga0163163_10006434 3300014325 Bacteria 10268
147 Ga0163163_11910599 3300014325 Bacteria 654
148 Ga0182008_10003119 3300014497 Bacteria 10145
149 Ga0182008_10034691 3300014497 Bacteria 2529
150 Ga0182008_10042946 3300014497 Bacteria 2251
151 Ga0182008_10045696 3300014497 Bacteria 2177
152 Ga0182008_10084246 3300014497 Bacteria 1566
153 Ga0157379_10008527 3300014968 Bacteria 8918
154 Ga0157376_10009607 3300014969 Bacteria 7035
155 Ga0157376_10361156 3300014969 Bacteria 1393
156 Ga0182006_1007890 3300015261 Bacteria 4845
157 Ga0182006_1083189 3300015261 Bacteria 1164
158 Ga0182007_10011582 3300015262 Bacteria 3428
159 Ga0182007_10014107 3300015262 Bacteria 3026
160 Ga0182007_10014350 3300015262 Bacteria 2991
161 Ga0182007_10094059 3300015262 Bacteria 988
162 Ga0182005_1181891 3300015265 Bacteria 625
163 Ga0163161_10032553 3300017792 Bacteria 3723
164 Ga0206353_10212869 3300020082 Bacteria 538
165 Ga0206353_10431835 3300020082 Bacteria 1864
166 Ga0206353_11765352 3300020082 Bacteria 3722
167 Ga0209760_100750 3300025207 Bacteria 4700
168 Ga0209784_100011 3300025224 Bacteria 546770
169 Ga0209674_101163 3300025226 Bacteria 7613
170 Ga0209672_104332 3300025228 Bacteria 2655
171 Ga0207427_100026 3300025231 Bacteria 412764
172 Ga0207427_100111 3300025231 Bacteria 112775
173 Ga0207427_100157 3300025231 Bacteria 77115
174 Ga0207427_101252 3300025231 Bacteria 9736
175 Ga0209437_100202 3300025233 Bacteria 118709
176 Ga0209437_100217 3300025233 Bacteria 105424
177 Ga0209437_100223 3300025233 Bacteria 102763
178 Ga0209437_100254 3300025233 Bacteria 83422
179 Ga0209258_100027 3300025242 Bacteria 518449
180 Ga0209646_1000370 3300025246 Bacteria 29793
181 Ga0209646_1002246 3300025246 Bacteria 4433
182 Ga0209026_1000018 3300025250 Bacteria 381351
183 Ga0209026_1000077 3300025250 Bacteria 200561
184 Ga0209026_1000139 3300025250 Bacteria 115298
185 Ga0209026_1003150 3300025250 Bacteria 5607
186 Ga0209148_1000001 3300025254 Bacteria 2545271
187 Ga0209148_1000005 3300025254 Bacteria 1806504
188 Ga0209759_1000066 3300025256 Bacteria 184163
189 Ga0209759_1016535 3300025256 Bacteria 1858
190 Ga0209759_1018477 3300025256 Bacteria 1682
191 Ga0209233_1000002 3300025261 Bacteria 2501366
192 Ga0209233_1000252 3300025261 Bacteria 83708
193 Ga0209233_1000272 3300025261 Bacteria 73393
194 Ga0209233_1005924 3300025261 Bacteria 4002
195 Ga0209233_1008132 3300025261 Bacteria 3274
196 Ga0209455_1000019 3300025272 Bacteria 705658
197 Ga0209455_1000188 3300025272 Bacteria 92883
198 Ga0209758_1001748 3300025297 Bacteria 24178
199 Ga0207656_10005583 3300025321 Bacteria 4458
200 Ga0207647_10005961 3300025904 Bacteria 8885
201 Ga0207647_10027938 3300025904 Bacteria 3673
202 Ga0207647_10296507 3300025904 Bacteria 921
203 Ga0207705_10170737 3300025909 Bacteria 1637
204 Ga0207707_10074323 3300025912 Bacteria 2964
205 Ga0207707_10121792 3300025912 Bacteria 2281
206 Ga0207707_10441316 3300025912 Bacteria 1114
207 Ga0207707_10660364 3300025912 Bacteria 881
208 Ga0207707_11360995 3300025912 Bacteria 568
209 Ga0207707_11428788 3300025912 Bacteria 551
210 Ga0207695_10000420 3300025913 Bacteria 94361
211 Ga0207695_10000709 3300025913 Bacteria 64887
212 Ga0207695_10001457 3300025913 Bacteria 39606
213 Ga0207695_10009498 3300025913 Bacteria 12029
214 Ga0207695_10040731 3300025913 Bacteria 4977
215 Ga0207695_10057406 3300025913 Bacteria 4044
216 Ga0207695_10058426 3300025913 Bacteria 4003
217 Ga0207695_10934108 3300025913 Bacteria 747
218 Ga0207671_10000038 3300025914 Bacteria 227066
219 Ga0207671_10000610 3300025914 Bacteria 47260
220 Ga0207693_10554353 3300025915 Bacteria 896
221 Ga0207663_10222626 3300025916 Bacteria 1374
222 Ga0207660_10041850 3300025917 Bacteria 3213
223 Ga0207660_10254257 3300025917 Bacteria 1387
224 Ga0207660_11196031 3300025917 Bacteria 619
225 Ga0207660_11202499 3300025917 Bacteria 617
226 Ga0207657_10087903 3300025919 Bacteria 2599
227 Ga0207652_10459046 3300025921 Bacteria 1148
228 Ga0207652_10804311 3300025921 Bacteria 835
229 Ga0207694_10036378 3300025924 Bacteria 3779
230 Ga0207694_10135309 3300025924 Bacteria 1978
231 Ga0207694_10185776 3300025924 Bacteria 1687
232 Ga0207694_10323174 3300025924 Bacteria 1274
233 Ga0207694_10323892 3300025924 Bacteria 1272
234 Ga0207659_10559533 3300025926 Bacteria 973
235 Ga0207664_10000023 3300025929 Bacteria 204730
236 Ga0207664_10000182 3300025929 Bacteria 47958
237 Ga0207690_10001386 3300025932 Bacteria 15230
238 Ga0207690_10015121 3300025932 Bacteria 4672
239 Ga0207690_10171643 3300025932 Bacteria 1625
240 Ga0207706_10006952 3300025933 Bacteria 10458
241 Ga0207706_10133097 3300025933 Bacteria 2187
242 Ga0207691_10812425 3300025940 Bacteria 785
243 Ga0207711_10426808 3300025941 Unclassified 1233
244 Ga0207679_11102280 3300025945 Bacteria 728
245 Ga0207667_10000582 3300025949 Bacteria 47591
246 Ga0207667_10000699 3300025949 Bacteria 43519
247 Ga0207667_10151209 3300025949 Bacteria 2389
248 Ga0207667_10167373 3300025949 Bacteria 2259
249 Ga0207667_10193368 3300025949 Bacteria 2087
250 Ga0207667_10333407 3300025949 Bacteria 1549
251 Ga0207667_10577640 3300025949 Bacteria 1135
252 Ga0207712_10202967 3300025961 Bacteria 1573
253 Ga0207640_10000251 3300025981 Bacteria 36485
254 Ga0207640_10006570 3300025981 Bacteria 6383
255 Ga0207640_10017719 3300025981 Bacteria 4173
256 Ga0207640_10428734 3300025981 Bacteria 1084
257 Ga0207703_10090576 3300026035 Bacteria 2570
258 Ga0207639_10400623 3300026041 Bacteria 1236
259 Ga0207639_11438837 3300026041 Bacteria 647
260 Ga0207639_11930128 3300026041 Bacteria 551
261 Ga0207678_10077596 3300026067 Bacteria 2845
262 Ga0207678_10082263 3300026067 Bacteria 2755
263 Ga0207678_10332892 3300026067 Bacteria 1307
264 Ga0207702_10000521 3300026078 Bacteria 43193
265 Ga0207702_11324701 3300026078 Bacteria 714
266 Ga0207641_10074482 3300026088 Bacteria 2928
267 Ga0207676_10051419 3300026095 Bacteria 3217
268 Ga0207674_10000342 3300026116 Bacteria 59945
269 Ga0207674_10072995 3300026116 Bacteria 3446
270 Ga0207674_10102952 3300026116 Bacteria 2835
271 Ga0207674_10465857 3300026116 Bacteria 1221
272 Ga0207674_10516447 3300026116 Bacteria 1154
273 Ga0207674_11755486 3300026116 Bacteria 588
274 Ga0207698_10117759 3300026142 Bacteria 2242
275 Ga0207698_11360067 3300026142 Bacteria 725
276 Ga0207698_11506164 3300026142 Unclassified 688
277 Ga0209983_1023243 3300027665 Bacteria 1301
278 Ga0209974_10007942 3300027876 Bacteria 3638
279 Ga0209974_10236593 3300027876 Bacteria 684
280 Ga0268265_11819630 3300028380 Bacteria 615
281 Ga0268264_10586629 3300028381 Bacteria 1097
282 Ga0265337_1007188 3300028556 Bacteria 4192
283 Ga0265338_10023472 3300028800 Bacteria 6340
284 Ga0316176_1017109 3300030732 Bacteria 2619
285 Ga0265332_10294298 3300031238 Bacteria 670
286 Ga0307408_100044485 3300031548 Bacteria 3164
287 Ga0316575_10007298 3300031665 Bacteria 4000
288 Ga0307405_10492419 3300031731 Bacteria 981
289 Ga0307406_10014663 3300031901 Bacteria 4513
290 Ga0307412_10198226 3300031911 Bacteria 1523
291 Ga0307414_10004419 3300032004 Bacteria 7635
292 Ga0307414_10063873 3300032004 Bacteria 2618
293 Ga0307414_10899398 3300032004 Bacteria 811
294 Ga0307414_10991311 3300032004 Bacteria 773
295 Ga0307414_11744355 3300032004 Bacteria 581
296 Ga0373931_0384858 3300035691 Bacteria 885
297 Ga0373933_0701321 3300035724 Bacteria 666
298 Ga0373937_2022545 3300036401 Bacteria 522
299 Ga0395899_0036132 3300037312 Bacteria 3707
300 Ga0395899_0093211 3300037312 Bacteria 2180
301 Ga0395899_0196084 3300037312 Bacteria 1410
302 Ga0395899_0251270 3300037312 Bacteria 1213
303 Ga0395900_0000060 3300037418 Bacteria 205509
304 Ga0395900_0001950 3300037418 Bacteria 23337
305 Ga0395898_0001426 3300037466 Bacteria 33975
306 Ga0395898_0108207 3300037466 Bacteria 2665
307 Ga0395901_0014776 3300038443 Bacteria 7934
308 Ga0395901_0227504 3300038443 Bacteria 1948
309 Ga0439436_0009168 3300041404 Bacteria 3036
310 Ga0439436_0024525 3300041404 Bacteria 1780
311 Ga0439439_0009297 3300041406 Bacteria 2335
312 Ga0439439_0046288 3300041406 Bacteria 1135
313 Ga0439466_0188064 3300041411 Bacteria 629
314 Ga0439465_0048630 3300041413 Bacteria 1384
315 Ga0451789_1358063 3300041443 Bacteria 1575
316 Ga0451797_0909881 3300041453 Unclassified 601
317 Ga0451797_1187325 3300041453 Bacteria 955
318 Ga0451833_1002837 3300041491 Bacteria 620
319 Ga0451837_0193533 3300041494 Bacteria 1564
320 Ga0451837_0910008 3300041494 Bacteria 1125
321 Ga0451841_1211538 3300041498 Bacteria 1117
322 Ga0451853_0540102 3300041512 Bacteria 910
323 Ga0451853_3846086 3300041512 Bacteria 580
324 Ga0439445_0143007 3300042004 Bacteria 694
325 Ga0439448_0050749 3300042005 Bacteria 1358
326 Ga0439462_0043708 3300042015 Bacteria 1198
327 Ga0466988_0154348 3300044536 Bacteria 1336
328 Ga0466969_0000720 3300044656 Bacteria 17891
329 Ga0466969_0119360 3300044656 Bacteria 1229
330 Ga0466972_0021785 3300044658 Bacteria 3192
331 Ga0466975_0260386 3300044661 Bacteria 1139
332 Ga0453683_0605058 3300044673 Bacteria 715
333 Ga0466965_0015138 3300044683 Bacteria 3661
334 Ga0466966_0004651 3300044684 Bacteria 9041
335 Ga0466966_0050236 3300044684 Bacteria 2653
336 Ga0466966_0057518 3300044684 Unclassified 2458
337 Ga0466961_0003857 3300044693 Bacteria 9366
338 Ga0466961_0004437 3300044693 Bacteria 8787
339 Ga0466968_0034282 3300044735 Bacteria 2118
340 Ga0466970_0001543 3300044765 Bacteria 11084
341 Ga0466970_0043474 3300044765 Bacteria 2390
342 Ga0466959_0000152 3300045049 Bacteria 45278
343 Ga0466959_0776213 3300045049 Unclassified 641
344 Ga0466958_1051322 3300045836 Bacteria 531
345 Ga0495627_015932 3300046453 Bacteria 2585
346 Ga0495638_0000295 3300046460 Bacteria 64957
347 Ga0495638_0005483 3300046460 Bacteria 9432
348 Ga0495663_0001688 3300046525 Bacteria 6887
349 Ga0495663_0020075 3300046525 Bacteria 1916
350 Ga0495609_0043269 3300046538 Bacteria 2022
351 Ga0495633_0439464 3300046558 Bacteria 589
352 Ga0495625_0019247 3300046660 Bacteria 5302
353 Ga0496100_0049120 3300048903 Bacteria 2726
354 Ga0496100_0235841 3300048903 Bacteria 1348
355 Ga0496100_0415650 3300048903 Bacteria 1026
356 Ga0496101_0009241 3300048904 Bacteria 6473
357 Ga0496101_1219357 3300048904 Bacteria 589
358 Ga0496102_0519751 3300048905 Bacteria 1113
359 Ga0496103_0476204 3300048906 Bacteria 800
360 Ga0496104_0091951 3300048907 Bacteria 2901
361 Ga0496104_0295876 3300048907 Bacteria 1531
362 Ga0496105_0002547 3300048908 Bacteria 13226
363 Ga0496105_0162562 3300048908 Bacteria 1833
364 Ga0496106_1529640 3300048909 Bacteria 513
365 Ga0496107_0058042 3300048910 Bacteria 2798
366 Ga0496110_0319064 3300048913 Bacteria 1415
367 Ga0496113_0076827 3300048916 Bacteria 2552
368 Ga0496115_0042006 3300048918 Bacteria 3641
369 Ga0496115_0049800 3300048918 Bacteria 3354
370 Ga0496115_0738467 3300048918 Bacteria 771
371 Ga0496117_0004864 3300048920 Bacteria 14500
372 Ga0496117_0008822 3300048920 Bacteria 9510
373 Ga0496117_0049175 3300048920 Bacteria 3002
374 Ga0496118_0007289 3300048921 Bacteria 11777
375 Ga0496118_0009912 3300048921 Bacteria 9521
376 Ga0496118_0030866 3300048921 Bacteria 4459
377 Ga0496118_0044560 3300048921 Bacteria 3472
378 Ga0496118_0055141 3300048921 Bacteria 3002
379 Ga0496119_0002561 3300048922 Bacteria 19778
380 Ga0496119_0010895 3300048922 Bacteria 7596
381 Ga0496120_0001010 3300048923 Bacteria 37745
382 Ga0496120_0002298 3300048923 Bacteria 19794
383 Ga0496121_0001154 3300048924 Bacteria 46299
384 Ga0496121_0014633 3300048924 Bacteria 8299
385 Ga0496121_0041675 3300048924 Bacteria 4009
386 Ga0496121_0042377 3300048924 Bacteria 3961
387 Ga0496122_0001795 3300048925 Bacteria 32865
388 Ga0496122_0011653 3300048925 Bacteria 8865
389 Ga0496122_0012681 3300048925 Bacteria 8349
390 Ga0496123_0000960 3300048926 Bacteria 44650
391 Ga0496123_0008788 3300048926 Bacteria 9209
392 Ga0496123_0009606 3300048926 Bacteria 8685
393 Ga0496123_0187682 3300048926 Unclassified 1072
394 Ga0496124_0051337 3300048927 Bacteria 3509
395 Ga0496124_0058726 3300048927 Bacteria 3234
396 Ga0496124_0293595 3300048927 Bacteria 1178
397 Ga0496125_0000512 3300048928 Bacteria 67294
398 Ga0496125_0012801 3300048928 Bacteria 8293
399 Ga0496125_0013446 3300048928 Bacteria 8042
400 Ga0496126_0003634 3300048929 Bacteria 19276
401 Ga0496126_0020121 3300048929 Bacteria 6552
402 Ga0496126_0037678 3300048929 Bacteria 4509
403 Ga0496126_0041335 3300048929 Bacteria 4268
404 Ga0501290_010103 3300049513 Bacteria 1204
405 Ga0501031_0047106 3300049568 Bacteria 2810
406 Ga0501031_0114138 3300049568 Bacteria 1764
407 Ga0501031_0183414 3300049568 Bacteria 1367
408 Ga0501031_0308484 3300049568 Bacteria 1025
409 Ga0501032_0036130 3300049569 Bacteria 3374
410 Ga0501032_0171248 3300049569 Bacteria 1424
411 Ga0501032_0887797 3300049569 Bacteria 561
412 Ga0501033_0001262 3300049570 Bacteria 22590
413 Ga0501033_0004589 3300049570 Bacteria 11065
414 Ga0501033_0012048 3300049570 Bacteria 6601
415 Ga0501033_0093135 3300049570 Bacteria 2203
416 Ga0501034_0009785 3300049571 Bacteria 10027
417 Ga0501034_0062558 3300049571 Bacteria 3737
418 Ga0501034_0282505 3300049571 Bacteria 1599
419 Ga0501034_0458667 3300049571 Bacteria 1191
420 Ga0501034_0516141 3300049571 Bacteria 1107
421 Ga0501037_0082860 3300049573 Bacteria 2323
422 Ga0501037_0222294 3300049573 Bacteria 1328
423 Ga0501037_0341910 3300049573 Bacteria 1033
424 Ga0501038_0022631 3300049574 Bacteria 5628
425 Ga0501038_0086876 3300049574 Bacteria 2627
426 Ga0501038_0153895 3300049574 Bacteria 1873
427 Ga0501038_0336035 3300049574 Bacteria 1179
428 Ga0501038_0571022 3300049574 Bacteria 858
429 Ga0501039_0028602 3300049575 Bacteria 4291
430 Ga0501039_0080347 3300049575 Bacteria 2537
431 Ga0501039_0203498 3300049575 Bacteria 1557
432 Ga0501043_0026860 3300049579 Bacteria 4517
433 Ga0501043_0033914 3300049579 Bacteria 4016
434 Ga0501043_0077235 3300049579 Bacteria 2616
435 Ga0501043_0100157 3300049579 Bacteria 2278
436 Ga0501043_0110000 3300049579 Bacteria 2164
437 Ga0501046_0774957 3300049580 Bacteria 673
438 Ga0501047_0013231 3300049581 Bacteria 7815
439 Ga0501047_0018863 3300049581 Bacteria 6616
440 Ga0501047_0030978 3300049581 Bacteria 5157
441 Ga0501047_0054650 3300049581 Bacteria 3862
442 Ga0501047_0139587 3300049581 Bacteria 2302
443 Ga0501047_0239897 3300049581 Bacteria 1664
444 Ga0501047_0511662 3300049581 Bacteria 1027
445 Ga0501047_0742071 3300049581 Bacteria 798
446 Ga0501048_0165195 3300049582 Bacteria 1567
447 Ga0501068_0749540 3300049584 Bacteria 639
448 Ga0501069_0004153 3300049585 Bacteria 7481
449 Ga0501069_0132763 3300049585 Bacteria 1426
450 Ga0501070_0002959 3300049586 Bacteria 14795
451 Ga0501070_0003423 3300049586 Bacteria 13763
452 Ga0501070_0118749 3300049586 Bacteria 2185
453 Ga0501070_0188554 3300049586 Unclassified 1695
454 Ga0501070_0238168 3300049586 Bacteria 1490
455 Ga0501070_0526103 3300049586 Bacteria 948
456 Ga0501070_1101886 3300049586 Bacteria 612
457 Ga0501071_0059648 3300049587 Bacteria 2761
458 Ga0501073_0008268 3300049589 Bacteria 7719
459 Ga0501073_0463254 3300049589 Bacteria 876
460 Ga0501074_0001069 3300049590 Bacteria 17857
461 Ga0501074_0011486 3300049590 Bacteria 6439
462 Ga0501202_147708 3300049652 Bacteria 613
463 Ga0501079_0723983 3300049741 Bacteria 783
464 Ga0501080_0000246 3300049742 Bacteria 40744
465 Ga0501080_0108462 3300049742 Bacteria 2573
466 Ga0501265_001260 3300049762 Bacteria 2852
467 Ga0501275_000182 3300049772 Bacteria 7195
468 Ga0501035_0003051 3300049822 Bacteria 16065
469 Ga0501035_0023189 3300049822 Bacteria 5693
470 Ga0501035_0035523 3300049822 Bacteria 4522
471 Ga0501035_0055712 3300049822 Bacteria 3529
472 Ga0501035_0153934 3300049822 Bacteria 1993
473 Ga0501035_0188068 3300049822 Bacteria 1776
474 Ga0501035_0510748 3300049822 Bacteria 988
475 Ga0501035_0553206 3300049822 Bacteria 942
476 Ga0501035_0626099 3300049822 Bacteria 874
477 Ga0501035_0705386 3300049822 Bacteria 813
478 Ga0501044_0003619 3300049823 Bacteria 17388
479 Ga0501044_0033697 3300049823 Bacteria 5379
480 Ga0501044_0049665 3300049823 Bacteria 4330
481 Ga0501044_0054429 3300049823 Bacteria 4113
482 Ga0501044_0144615 3300049823 Bacteria 2364
483 Ga0501044_0170317 3300049823 Bacteria 2149
484 Ga0501044_0276859 3300049823 Bacteria 1613
485 Ga0501044_0288214 3300049823 Bacteria 1574
486 Ga0501044_0651818 3300049823 Bacteria 942
487 nmdc:mga0yw44_955685_c1 3300050492 Bacteria 580
488 Ga0466962_0001540 3300061719 Bacteria 10772
489 Ga0466962_0020285 3300061719 Bacteria 3194
490 2525556439 2524614729 Bacteria 3091755
491 2538834887 2537561836 Bacteria 3910579
492 2578457190 2576861471 Bacteria 4648976
493 2630649668 2627854209 Bacteria 3093011
494 2643816748 2643221559 Bacteria 4424915
495 2643829438 2643221562 Bacteria 4048635
496 2643880875 2643221573 Bacteria 4784121
497 2643938572 2643221586 Bacteria 4446529
498 2644077681 2643221612 Bacteria 4361984
499 2644661445 2643221720 Bacteria 4694283
500 2644694004 2643221727 Bacteria 4415595
501 2644699526 2643221728 Bacteria 4797149
502 2687584254 2687453130 Bacteria 4227172
503 2857445150 2857442823 Bacteria 4562550
504 2939612837 2939611941 Bacteria 3892017
505 2987608576 2987605356 Bacteria 4187822
506 Ga0451577_0009659
507 JGI24740J21852_10025336
508 JGI24735J21928_10005114
509 JGI24735J21928_10026567
510 JGI24735J21928_10206454
511 JGI25156J39149_1024129
512 JGI25162J39368_1000871
513 JGI25162J39368_1001437
514 JGI25157J39369_1000717
515 JGI25157J39369_1011807
516 JGI25164J39214_1000476
517 JGI25164J39214_1000710
518 JGI25165J46597_1001432
519 JGI25153J46596_10019562
520 rootH2_10259599
521 rootL2_10033481
522 rootL2_10346672
523 Ga0006562J51391_1035513
524 Ga0055529_1004542
525 Ga0065704_10434403
526 Ga0065715_10067493
527 Ga0065715_10246154
528 Ga0065715_10348988
529 Ga0070658_10095761
530 Ga0070658_11965395
531 Ga0070680_100122470
532 Ga0070680_101620584
533 Ga0070680_101749745
534 Ga0070682_101037874
535 Ga0070660_100076351
536 Ga0070660_100597662
537 Ga0070691_10087541
538 Ga0070691_10611393
539 Ga0070692_10261468
540 Ga0070668_101314846
541 Ga0070675_100146490
542 Ga0070659_100097519
543 Ga0070659_100646674
544 Ga0070659_100700273
545 Ga0070659_100944000
546 Ga0070659_101494016
547 Ga0070714_100000020
548 Ga0070714_100000483
549 Ga0070711_100269827
550 Ga0070663_100069657
551 Ga0070662_100004570
552 Ga0070662_100114075
553 Ga0070681_10068601
554 Ga0070681_10230492
555 Ga0070681_10671989
556 Ga0070679_100150987
557 Ga0070684_101379385
558 Ga0068853_102167357
559 Ga0070693_100130029
560 Ga0070693_100173565
561 Ga0070665_102534396
562 Ga0068855_100059900
563 Ga0068855_100062159
564 Ga0068855_100468413
565 Ga0068855_100599767
566 Ga0068855_100641369
567 Ga0070664_100247806
568 Ga0068857_100000262
569 Ga0068857_100060660
570 Ga0068857_100247420
571 Ga0068857_100318996
572 Ga0068857_100459469
573 Ga0068854_100002566
574 Ga0068854_100009914
575 Ga0068854_100060405
576 Ga0068856_100000154
577 Ga0068856_100194220
578 Ga0068856_100300371
579 Ga0068852_100933840
580 Ga0068852_101840889
581 Ga0068859_100131348
582 Ga0068864_100032535
583 Ga0068851_10018250
584 Ga0068863_100019264
585 Ga0068858_100026679
586 Ga0068858_100073611
587 Ga0068860_100021025
588 Ga0068860_101010891
589 Ga0068862_100466902
590 Ga0070712_100174107
591 Ga0097621_101431629
592 Ga0068871_101025113
593 Ga0068871_101295497
594 Ga0068865_101833013
595 Ga0097620_100131345
596 Ga0105240_10001473
597 Ga0105240_10002105
598 Ga0105240_10016640
599 Ga0105240_10057656
600 Ga0105240_10078028
601 Ga0105240_10218392
602 Ga0105240_10404679
603 Ga0105240_10537084
604 Ga0114129_11290478
605 Ga0105241_10969311
606 Ga0105248_10414981
607 Ga0105248_11385843
608 Ga0105237_10000055
609 Ga0105237_10000491
610 Ga0105237_10104820
611 Ga0105237_10121252
612 Ga0105238_10017135
613 Ga0105238_10025830
614 Ga0105238_10231299
615 Ga0105238_10307262
616 Ga0105238_10350374
617 Ga0105238_11016237
618 Ga0105249_10314847
619 Ga0105239_10000023
620 Ga0105239_10214353
621 Ga0105239_11327150
622 Ga0105246_10018028
623 Ga0157314_1001315
624 Ga0157373_10061117
625 Ga0157373_10075560
626 Ga0157373_10170546
627 Ga0157373_10271018
628 Ga0157371_10040231
629 Ga0157371_10126714
630 Ga0157371_11585844
631 Ga0157370_10000778
632 Ga0157370_10006570
633 Ga0157370_10024396
634 Ga0157370_10097163
635 Ga0157370_10190161
636 Ga0157370_10355191
637 Ga0157369_10007227
638 Ga0157369_10221794
639 Ga0157369_10658727
640 Ga0157374_12104009
641 Ga0163162_10000042
642 Ga0163162_10176667
643 Ga0163162_10513112
644 Ga0163162_13277048
645 Ga0157372_10115904
646 Ga0157372_10286416
647 Ga0157372_10453581
648 Ga0157372_10570640
649 Ga0157375_10486187
650 Ga0157375_10521726
651 Ga0163163_10006434
652 Ga0163163_11910599
653 Ga0182008_10003119
654 Ga0182008_10034691
655 Ga0182008_10042946
656 Ga0182008_10045696
657 Ga0182008_10084246
658 Ga0157379_10008527
659 Ga0157376_10009607
660 Ga0157376_10361156
661 Ga0182006_1007890
662 Ga0182006_1083189
663 Ga0182007_10011582
664 Ga0182007_10014107
665 Ga0182007_10014350
666 Ga0182007_10094059
667 Ga0182005_1181891
668 Ga0163161_10032553
669 Ga0206353_10212869
670 Ga0206353_10431835
671 Ga0206353_11765352
672 Ga0209760_100750
673 Ga0209784_100011
674 Ga0209674_101163
675 Ga0209672_104332
676 Ga0207427_100026
677 Ga0207427_100111
678 Ga0207427_100157
679 Ga0207427_101252
680 Ga0209437_100202
681 Ga0209437_100217
682 Ga0209437_100223
683 Ga0209437_100254
684 Ga0209258_100027
685 Ga0209646_1000370
686 Ga0209646_1002246
687 Ga0209026_1000018
688 Ga0209026_1000077
689 Ga0209026_1000139
690 Ga0209026_1003150
691 Ga0209148_1000001
692 Ga0209148_1000005
693 Ga0209759_1000066
694 Ga0209759_1016535
695 Ga0209759_1018477
696 Ga0209233_1000002
697 Ga0209233_1000252
698 Ga0209233_1000272
699 Ga0209233_1005924
700 Ga0209233_1008132
701 Ga0209455_1000019
702 Ga0209455_1000188
703 Ga0209758_1001748
704 Ga0207656_10005583
705 Ga0207647_10005961
706 Ga0207647_10027938
707 Ga0207647_10296507
708 Ga0207705_10170737
709 Ga0207707_10074323
710 Ga0207707_10121792
711 Ga0207707_10441316
712 Ga0207707_10660364
713 Ga0207707_11360995
714 Ga0207707_11428788
715 Ga0207695_10000420
716 Ga0207695_10000709
717 Ga0207695_10001457
718 Ga0207695_10009498
719 Ga0207695_10040731
720 Ga0207695_10057406
721 Ga0207695_10058426
722 Ga0207695_10934108
723 Ga0207671_10000038
724 Ga0207671_10000610
725 Ga0207693_10554353
726 Ga0207663_10222626
727 Ga0207660_10041850
728 Ga0207660_10254257
729 Ga0207660_11196031
730 Ga0207660_11202499
731 Ga0207657_10087903
732 Ga0207652_10459046
733 Ga0207652_10804311
734 Ga0207694_10036378
735 Ga0207694_10135309
736 Ga0207694_10185776
737 Ga0207694_10323174
738 Ga0207694_10323892
739 Ga0207659_10559533
740 Ga0207664_10000023
741 Ga0207664_10000182
742 Ga0207690_10001386
743 Ga0207690_10015121
744 Ga0207690_10171643
745 Ga0207706_10006952
746 Ga0207706_10133097
747 Ga0207691_10812425
748 Ga0207711_10426808
749 Ga0207679_11102280
750 Ga0207667_10000582
751 Ga0207667_10000699
752 Ga0207667_10151209
753 Ga0207667_10167373
754 Ga0207667_10193368
755 Ga0207667_10333407
756 Ga0207667_10577640
757 Ga0207712_10202967
758 Ga0207640_10000251
759 Ga0207640_10006570
760 Ga0207640_10017719
761 Ga0207640_10428734
762 Ga0207703_10090576
763 Ga0207639_10400623
764 Ga0207639_11438837
765 Ga0207639_11930128
766 Ga0207678_10077596
767 Ga0207678_10082263
768 Ga0207678_10332892
769 Ga0207702_10000521
770 Ga0207702_11324701
771 Ga0207641_10074482
772 Ga0207676_10051419
773 Ga0207674_10000342
774 Ga0207674_10072995
775 Ga0207674_10102952
776 Ga0207674_10465857
777 Ga0207674_10516447
778 Ga0207674_11755486
779 Ga0207698_10117759
780 Ga0207698_11360067
781 Ga0207698_11506164
782 Ga0209983_1023243
783 Ga0209974_10007942
784 Ga0209974_10236593
785 Ga0268265_11819630
786 Ga0268264_10586629
787 Ga0265337_1007188
788 Ga0265338_10023472
789 Ga0316176_1017109
790 Ga0265332_10294298
791 Ga0307408_100044485
792 Ga0316575_10007298
793 Ga0307405_10492419
794 Ga0307406_10014663
795 Ga0307412_10198226
796 Ga0307414_10004419
797 Ga0307414_10063873
798 Ga0307414_10899398
799 Ga0307414_10991311
800 Ga0307414_11744355
801 Ga0373931_0384858
802 Ga0373933_0701321
803 Ga0373937_2022545
804 Ga0395899_0036132
805 Ga0395899_0093211
806 Ga0395899_0196084
807 Ga0395899_0251270
808 Ga0395900_0000060
809 Ga0395900_0001950
810 Ga0395898_0001426
811 Ga0395898_0108207
812 Ga0395901_0014776
813 Ga0395901_0227504
814 Ga0439436_0009168
815 Ga0439436_0024525
816 Ga0439439_0009297
817 Ga0439439_0046288
818 Ga0439466_0188064
819 Ga0439465_0048630
820 Ga0451789_1358063
821 Ga0451797_0909881
822 Ga0451797_1187325
823 Ga0451833_1002837
824 Ga0451837_0193533
825 Ga0451837_0910008
826 Ga0451841_1211538
827 Ga0451853_0540102
828 Ga0451853_3846086
829 Ga0439445_0143007
830 Ga0439448_0050749
831 Ga0439462_0043708
832 Ga0466988_0154348
833 Ga0466969_0000720
834 Ga0466969_0119360
835 Ga0466972_0021785
836 Ga0466975_0260386
837 Ga0453683_0605058
838 Ga0466965_0015138
839 Ga0466966_0004651
840 Ga0466966_0050236
841 Ga0466966_0057518
842 Ga0466961_0003857
843 Ga0466961_0004437
844 Ga0466968_0034282
845 Ga0466970_0001543
846 Ga0466970_0043474
847 Ga0466959_0000152
848 Ga0466959_0776213
849 Ga0466958_1051322
850 Ga0495627_015932
851 Ga0495638_0000295
852 Ga0495638_0005483
853 Ga0495663_0001688
854 Ga0495663_0020075
855 Ga0495609_0043269
856 Ga0495633_0439464
857 Ga0495625_0019247
858 Ga0496100_0049120
859 Ga0496100_0235841
860 Ga0496100_0415650
861 Ga0496101_0009241
862 Ga0496101_1219357
863 Ga0496102_0519751
864 Ga0496103_0476204
865 Ga0496104_0091951
866 Ga0496104_0295876
867 Ga0496105_0002547
868 Ga0496105_0162562
869 Ga0496106_1529640
870 Ga0496107_0058042
871 Ga0496110_0319064
872 Ga0496113_0076827
873 Ga0496115_0042006
874 Ga0496115_0049800
875 Ga0496115_0738467
876 Ga0496117_0004864
877 Ga0496117_0008822
878 Ga0496117_0049175
879 Ga0496118_0007289
880 Ga0496118_0009912
881 Ga0496118_0030866
882 Ga0496118_0044560
883 Ga0496118_0055141
884 Ga0496119_0002561
885 Ga0496119_0010895
886 Ga0496120_0001010
887 Ga0496120_0002298
888 Ga0496121_0001154
889 Ga0496121_0014633
890 Ga0496121_0041675
891 Ga0496121_0042377
892 Ga0496122_0001795
893 Ga0496122_0011653
894 Ga0496122_0012681
895 Ga0496123_0000960
896 Ga0496123_0008788
897 Ga0496123_0009606
898 Ga0496123_0187682
899 Ga0496124_0051337
900 Ga0496124_0058726
901 Ga0496124_0293595
902 Ga0496125_0000512
903 Ga0496125_0012801
904 Ga0496125_0013446
905 Ga0496126_0003634
906 Ga0496126_0020121
907 Ga0496126_0037678
908 Ga0496126_0041335
909 Ga0501290_010103
910 Ga0501031_0047106
911 Ga0501031_0114138
912 Ga0501031_0183414
913 Ga0501031_0308484
914 Ga0501032_0036130
915 Ga0501032_0171248
916 Ga0501032_0887797
917 Ga0501033_0001262
918 Ga0501033_0004589
919 Ga0501033_0012048
920 Ga0501033_0093135
921 Ga0501034_0009785
922 Ga0501034_0062558
923 Ga0501034_0282505
924 Ga0501034_0458667
925 Ga0501034_0516141
926 Ga0501037_0082860
927 Ga0501037_0222294
928 Ga0501037_0341910
929 Ga0501038_0022631
930 Ga0501038_0086876
931 Ga0501038_0153895
932 Ga0501038_0336035
933 Ga0501038_0571022
934 Ga0501039_0028602
935 Ga0501039_0080347
936 Ga0501039_0203498
937 Ga0501043_0026860
938 Ga0501043_0033914
939 Ga0501043_0077235
940 Ga0501043_0100157
941 Ga0501043_0110000
942 Ga0501046_0774957
943 Ga0501047_0013231
944 Ga0501047_0018863
945 Ga0501047_0030978
946 Ga0501047_0054650
947 Ga0501047_0139587
948 Ga0501047_0239897
949 Ga0501047_0511662
950 Ga0501047_0742071
951 Ga0501048_0165195
952 Ga0501068_0749540
953 Ga0501069_0004153
954 Ga0501069_0132763
955 Ga0501070_0002959
956 Ga0501070_0003423
957 Ga0501070_0118749
958 Ga0501070_0188554
959 Ga0501070_0238168
960 Ga0501070_0526103
961 Ga0501070_1101886
962 Ga0501071_0059648
963 Ga0501073_0008268
964 Ga0501073_0463254
965 Ga0501074_0001069
966 Ga0501074_0011486
967 Ga0501202_147708
968 Ga0501079_0723983
969 Ga0501080_0000246
970 Ga0501080_0108462
971 Ga0501265_001260
972 Ga0501275_000182
973 Ga0501035_0003051
974 Ga0501035_0023189
975 Ga0501035_0035523
976 Ga0501035_0055712
977 Ga0501035_0153934
978 Ga0501035_0188068
979 Ga0501035_0510748
980 Ga0501035_0553206
981 Ga0501035_0626099
982 Ga0501035_0705386
983 Ga0501044_0003619
984 Ga0501044_0033697
985 Ga0501044_0049665
986 Ga0501044_0054429
987 Ga0501044_0144615
988 Ga0501044_0170317
989 Ga0501044_0276859
990 Ga0501044_0288214
991 Ga0501044_0651818
992 nmdc:mga0yw44_955685_c1
993 Ga0466962_0001540
994 Ga0466962_0020285
995 2525556439
996 2538834887
997 2578457190
998 2630649668
999 2643816748
1000 2643829438
1001 2643880875
1002 2643938572
1003 2644077681
1004 2644661445
1005 2644694004
1006 2644699526
1007 2687584254
1008 2857445150
1009 2939612837
1010 2987608576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

3

117

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9635 5 66
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9313 5 66
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9256 7 66
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9156 5 66
1u2w-assembly2.cif.gz_C crystal structure of the staphylococcus aureus pi258 cadc 0.9097 3 66
ID Description Score Start End Superfamily
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9635 5 66 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9556 5 66 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9522 4 65 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9448 4 66 1.10.10.10
af_P9WMI9_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9393 4 66 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N6A194-F1-model_v4 Transcriptional regulator 0.9633 1 70 GO:0003677
GO:0005737
GO:0045892
AF-A0A6V8QD68-F1-model_v4 Penicillinase repressor 0.9604 2 75 GO:0003677
GO:0045892
AF-A0A1G3MWN9-F1-model_v4 Uncharacterized protein 0.958 2 86 GO:0003677
GO:0045892
AF-A0A524HCJ2-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9474 1 75 GO:0003677
GO:0045892
AF-K1TLV8-F1-model_v4 Penicillinase repressor 0.9448 1 72 GO:0003677
GO:0045892

Map