F456400

General Info

Members Datasets Scaffolds Average Seq Length
505 301 439 236

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0290941|Ga0466963_0290941_66_833
Length 255
Sequence MAAVATVDEARRLDAATLDSGRDWGRLRTRADLKALAEQAGRDLEGASAVDVLRWAEQEFGPSWAVASSMADAVVPHLAAQVRPGVHVLFLDTGYHFAETIGTRDAVQATLPVVVRSIVPEQSVAEQDAEFGPRLFERNPDQCCALRKVAPLRRALQDYSAWASGLRRDEADSRASVRVVEWDDRRGMVKLNPIAAWTQDDVDRYIAENGVLVNPLLYDGYGSIGCAPCTRRLKPGEHARAGRWSGTSKTECGLH

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
9 2643221714 Streptomyces sp. Root264 Isolate Unclassified
10 2738541305 Nocardioides sp. CF167 Isolate Unclassified
11 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
12 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
13 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
14 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
15 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
16 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
17 2808606448 Streptomyces sp. 193411 Isolate Unclassified
18 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
19 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
20 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
21 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
22 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
23 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
24 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
25 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
26 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
27 2862574272 Streptomyces sp. AcE210 Isolate Nodule
28 2867369537 Streptomyces sp. Z26 Isolate Unclassified
29 2867428634 Streptomyces sp. RP5T Isolate Unclassified
30 2867475112 Streptomyces sp. TM32 Isolate Unclassified
31 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
32 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
33 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
34 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
35 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
36 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
37 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
38 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
39 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
40 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
41 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
42 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
43 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
44 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
45 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
46 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
47 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
48 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
49 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
50 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
51 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
52 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
53 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
54 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
57 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
120 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
121 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
130 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
131 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
132 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
133 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
134 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
135 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
271 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
272 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
273 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
274 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
275 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
280 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
291 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
292 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
293 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
294 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
295 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
296 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
297 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
298 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
299 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
300 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
301 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.15
Metatranscriptomes 1.78
Isolates 13.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.53
Nodule 0.79
Rhizoplane 2.97
Rhizosphere 78.22
Stem 0
Stem Tuber 0
Unclassified 11.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10080323 3300001989 Bacteria 1002
2 JGI24737J22298_10003190 3300001990 Bacteria 5817
3 JGI24735J21928_10034302 3300002067 Bacteria 1496
4 rootH1_10003304 3300003323 Bacteria 9323
5 JGI25160J50197_1061837 3300003354 Bacteria 745
6 Ga0006562J51391_1039091 3300003578 Bacteria 1330
7 Ga0070714_100019064 3300005435 Bacteria 5583
8 Ga0070714_100295404 3300005435 Bacteria 1509
9 Ga0070713_100050596 3300005436 Bacteria 3433
10 Ga0070711_100073404 3300005439 Bacteria 2417
11 Ga0070678_100284650 3300005456 Bacteria 1399
12 Ga0070665_100168868 3300005548 Bacteria 2189
13 Ga0068855_100067853 3300005563 Bacteria 4153
14 Ga0068856_100004071 3300005614 Bacteria 14629
15 Ga0068856_100068707 3300005614 Bacteria 3503
16 Ga0068856_100382630 3300005614 Bacteria 1426
17 Ga0068852_100084788 3300005616 Bacteria 2821
18 Ga0081455_10002092 3300005937 Bacteria 23828
19 Ga0081455_10048164 3300005937 Bacteria 3685
20 Ga0081540_1037017 3300005983 Bacteria 2592
21 Ga0070717_10833549 3300006028 Bacteria 839
22 Ga0075363_100226057 3300006048 Bacteria 1073
23 Ga0075363_100296608 3300006048 Bacteria 937
24 Ga0070712_100094624 3300006175 Bacteria 2196
25 Ga0075367_10024432 3300006178 Bacteria 3408
26 Ga0075370_10084188 3300006353 Bacteria 1830
27 Ga0099826_10114314 3300006948 Bacteria 1602
28 Ga0105240_10030467 3300009093 Bacteria 7013
29 Ga0105240_10091285 3300009093 Bacteria 3722
30 Ga0105240_10932565 3300009093 Bacteria 932
31 Ga0105247_10420054 3300009101 Bacteria 957
32 Ga0105247_10480435 3300009101 Bacteria 902
33 Ga0105241_10003392 3300009174 Bacteria 11854
34 Ga0105248_10520275 3300009177 Bacteria 1341
35 Ga0105237_10037249 3300009545 Bacteria 4918
36 Ga0105237_10220068 3300009545 Bacteria 1899
37 Ga0105237_10450574 3300009545 Bacteria 1293
38 Ga0105239_10020545 3300010375 Bacteria 7284
39 Ga0105239_10058710 3300010375 Bacteria 4222
40 Ga0157372_10221767 3300013307 Bacteria 2192
41 Ga0163163_10233031 3300014325 Bacteria 1891
42 Ga0183367_1001 3300015688 Bacteria 1225545
43 Ga0197907_10051208 3300020069 Bacteria 2613
44 Ga0197907_11339174 3300020069 Bacteria 1314
45 Ga0206356_11353819 3300020070 Bacteria 1825
46 Ga0224712_10022350 3300022467 Bacteria 2179
47 Ga0207426_1001177 3300025302 Bacteria 23399
48 Ga0207426_1014513 3300025302 Bacteria 2884
49 Ga0207647_10007894 3300025904 Bacteria 7652
50 Ga0207647_10079284 3300025904 Bacteria 1972
51 Ga0207705_10075649 3300025909 Bacteria 2446
52 Ga0207654_10007073 3300025911 Bacteria 5654
53 Ga0207695_10002874 3300025913 Bacteria 24990
54 Ga0207695_10023232 3300025913 Bacteria 7014
55 Ga0207695_10226313 3300025913 Bacteria 1776
56 Ga0207671_10000284 3300025914 Bacteria 74874
57 Ga0207671_10074243 3300025914 Bacteria 2541
58 Ga0207663_10050739 3300025916 Bacteria 2580
59 Ga0207694_10000669 3300025924 Bacteria 30779
60 Ga0207700_10037322 3300025928 Bacteria 3518
61 Ga0207664_10018097 3300025929 Bacteria 5176
62 Ga0207664_10061590 3300025929 Bacteria 2994
63 Ga0207667_10010681 3300025949 Bacteria 10716
64 Ga0207658_10117545 3300025986 Bacteria 2113
65 Ga0207677_10416907 3300026023 Bacteria 1143
66 Ga0207702_10007850 3300026078 Bacteria 9051
67 Ga0207702_10121535 3300026078 Bacteria 2338
68 Ga0207698_10560715 3300026142 Bacteria 1121
69 Ga0209282_1091991 3300027666 Bacteria 1586
70 Ga0268266_10254741 3300028379 Bacteria 1624
71 Ga0307517_10001330 3300028786 Bacteria 41532
72 Ga0307517_10004423 3300028786 Bacteria 21589
73 Ga0307515_10000501 3300028794 Bacteria 93663
74 Ga0307515_10005358 3300028794 Bacteria 26039
75 Ga0307515_10256124 3300028794 Bacteria 1494
76 Ga0268256_1024135 3300030500 Bacteria 1565
77 Ga0307512_10028984 3300030522 Bacteria 4842
78 Ga0307513_10017461 3300031456 Bacteria 8604
79 Ga0307513_10131381 3300031456 Bacteria 2449
80 Ga0307509_10097178 3300031507 Bacteria 2994
81 Ga0307508_10003642 3300031616 Bacteria 15443
82 Ga0307508_10015847 3300031616 Bacteria 6868
83 Ga0307508_10351627 3300031616 Bacteria 1065
84 Ga0307508_10419804 3300031616 Bacteria 929
85 Ga0307514_10003913 3300031649 Bacteria 13930
86 Ga0307514_10022176 3300031649 Bacteria 5166
87 Ga0307514_10049266 3300031649 Bacteria 3276
88 Ga0307514_10308503 3300031649 Bacteria 880
89 Ga0307514_10338673 3300031649 Bacteria 811
90 Ga0307516_10038926 3300031730 Bacteria 4741
91 Ga0307516_10052097 3300031730 Bacteria 4009
92 Ga0307507_10010364 3300033179 Bacteria 12066
93 Ga0307507_10159323 3300033179 Bacteria 1672
94 Ga0307510_10019886 3300033180 Bacteria 7865
95 Ga0307510_10082507 3300033180 Bacteria 3109
96 Ga0307510_10160207 3300033180 Bacteria 1848
97 Ga0307510_10250451 3300033180 Bacteria 1259
98 Ga0395898_0272873 3300037466 Bacteria 1613
99 Ga0395898_0654035 3300037466 Bacteria 993
100 Ga0395905_0487423 3300037471 Bacteria 1132
101 Ga0439439_0013610 3300041406 Bacteria 1973
102 Ga0451789_1276089 3300041443 Bacteria 1379
103 Ga0451849_1572190 3300041505 Bacteria 1012
104 Ga0451853_1098851 3300041512 Bacteria 2125
105 Ga0451853_2200265 3300041512 Bacteria 11798
106 Ga0439442_008382 3300042002 Bacteria 2087
107 Ga0439448_0001874 3300042005 Bacteria 5585
108 Ga0439448_0061953 3300042005 Bacteria 1237
109 Ga0439449_0000414 3300042007 Bacteria 15761
110 Ga0439455_0000981 3300042012 Bacteria 4465
111 Ga0439457_000009 3300042014 Bacteria 41871
112 Ga0439457_000296 3300042014 Bacteria 13769
113 Ga0439457_030706 3300042014 Bacteria 1191
114 Ga0439462_0018210 3300042015 Bacteria 1823
115 Ga0450894_000028 3300042131 Bacteria 21227
116 Ga0450895_000633 3300042132 Bacteria 2124
117 Ga0450896_001531 3300042133 Bacteria 2870
118 Ga0450898_000057 3300042134 Bacteria 9483
119 Ga0450899_003716 3300042135 Bacteria 1638
120 Ga0450899_006013 3300042135 Bacteria 1310
121 Ga0450903_000364 3300042138 Bacteria 9940
122 Ga0450906_000171 3300042145 Bacteria 12159
123 Ga0439458_0000381 3300042157 Bacteria 11160
124 Ga0439458_0026176 3300042157 Bacteria 1371
125 Ga0450901_006649 3300042533 Bacteria 1190
126 Ga0466969_0022995 3300044656 Bacteria 3214
127 Ga0466969_0055017 3300044656 Bacteria 1948
128 Ga0466969_0065035 3300044656 Bacteria 1764
129 Ga0466972_0007916 3300044658 Bacteria 5329
130 Ga0466972_0050289 3300044658 Bacteria 2012
131 Ga0466972_0066479 3300044658 Bacteria 1723
132 Ga0466965_0000530 3300044683 Bacteria 13704
133 Ga0466965_0001703 3300044683 Bacteria 9028
134 Ga0466965_0074628 3300044683 Bacteria 1709
135 Ga0466966_0000480 3300044684 Bacteria 25684
136 Ga0466966_0012279 3300044684 Bacteria 5676
137 Ga0466966_0018605 3300044684 Bacteria 4578
138 Ga0466966_0246929 3300044684 Bacteria 1075
139 Ga0466966_0251765 3300044684 Bacteria 1064
140 Ga0466966_0348807 3300044684 Bacteria 889
141 Ga0466961_0000749 3300044693 Bacteria 20317
142 Ga0466961_0010427 3300044693 Bacteria 5930
143 Ga0466961_0015009 3300044693 Bacteria 4974
144 Ga0466961_0029518 3300044693 Bacteria 3524
145 Ga0466961_0112674 3300044693 Bacteria 1710
146 Ga0466961_0145194 3300044693 Bacteria 1484
147 Ga0466961_0188517 3300044693 Bacteria 1279
148 Ga0466961_0253236 3300044693 Bacteria 1081
149 Ga0466963_0000053 3300044694 Bacteria 38770
150 Ga0466963_0001657 3300044694 Bacteria 12144
151 Ga0466963_0181555 3300044694 Bacteria 1469
152 Ga0466963_0225664 3300044694 Bacteria 1312
153 Ga0466963_0245310 3300044694 Bacteria 1256
154 Ga0466963_0290941 3300044694 Bacteria 1148
155 Ga0466964_0001852 3300044706 Bacteria 7367
156 Ga0466964_0062503 3300044706 Bacteria 1553
157 Ga0466964_0242150 3300044706 Bacteria 885
158 Ga0466971_0000530 3300044719 Bacteria 15092
159 Ga0466971_0010241 3300044719 Bacteria 4095
160 Ga0466971_0103744 3300044719 Bacteria 1308
161 Ga0466971_0120114 3300044719 Bacteria 1216
162 Ga0466968_0094714 3300044735 Bacteria 1327
163 Ga0466970_0000077 3300044765 Bacteria 40147
164 Ga0466970_0010609 3300044765 Bacteria 4678
165 Ga0466970_0069751 3300044765 Bacteria 1890
166 Ga0466957_0000461 3300044842 Bacteria 20154
167 Ga0466960_0001743 3300044901 Bacteria 7995
168 Ga0466960_0079524 3300044901 Bacteria 1649
169 Ga0466960_0253003 3300044901 Bacteria 979
170 Ga0466959_0000623 3300045049 Bacteria 20525
171 Ga0466959_0002375 3300045049 Bacteria 12004
172 Ga0466959_0019578 3300045049 Bacteria 4978
173 Ga0466959_0088786 3300045049 Bacteria 2222
174 Ga0466959_0237125 3300045049 Bacteria 1261
175 Ga0466959_0296676 3300045049 Bacteria 1107
176 Ga0466958_0000820 3300045836 Bacteria 13725
177 Ga0466958_0004142 3300045836 Bacteria 7611
178 Ga0466958_0219537 3300045836 Bacteria 1212
179 Ga0466967_0007988 3300045976 Bacteria 7703
180 Ga0466967_0045214 3300045976 Bacteria 3825
181 Ga0466967_0047705 3300045976 Bacteria 3735
182 Ga0466967_0047976 3300045976 Bacteria 3727
183 Ga0466967_0048418 3300045976 Bacteria 3711
184 Ga0466967_0122573 3300045976 Bacteria 2404
185 Ga0466967_0516009 3300045976 Bacteria 1174
186 Ga0495592_0001940 3300046454 Bacteria 14585
187 Ga0495592_0005101 3300046454 Bacteria 9674
188 Ga0495603_0000293 3300046455 Bacteria 26615
189 Ga0495603_0094219 3300046455 Bacteria 1750
190 Ga0495629_0000865 3300046459 Bacteria 24384
191 Ga0495629_0011955 3300046459 Bacteria 6294
192 Ga0495629_0080579 3300046459 Bacteria 2272
193 Ga0495638_0171367 3300046460 Bacteria 1245
194 Ga0495651_0004704 3300046462 Bacteria 10446
195 Ga0495582_0354575 3300046473 Bacteria 845
196 Ga0495605_0007353 3300046474 Bacteria 6253
197 Ga0495605_0023509 3300046474 Bacteria 3239
198 Ga0495662_0018662 3300046476 Bacteria 3357
199 Ga0495664_0002987 3300046477 Bacteria 9139
200 Ga0495664_0268439 3300046477 Bacteria 1031
201 Ga0495664_0278405 3300046477 Bacteria 1011
202 Ga0495585_0165935 3300046492 Bacteria 1143
203 Ga0495594_0000910 3300046499 Bacteria 15347
204 Ga0495594_0009172 3300046499 Bacteria 5105
205 Ga0495594_0128555 3300046499 Bacteria 1434
206 Ga0495594_0190602 3300046499 Bacteria 1168
207 Ga0495606_0035663 3300046507 Bacteria 3397
208 Ga0495628_0152195 3300046516 Bacteria 1761
209 Ga0495630_0086292 3300046517 Bacteria 2370
210 Ga0495631_0028536 3300046518 Bacteria 2545
211 Ga0495631_0039353 3300046518 Bacteria 2098
212 Ga0495632_0025828 3300046519 Bacteria 3102
213 Ga0495643_0023669 3300046522 Bacteria 3489
214 Ga0495648_0045127 3300046524 Bacteria 2744
215 Ga0495652_0032656 3300046529 Bacteria 4551
216 Ga0495654_0052042 3300046530 Bacteria 1996
217 Ga0495640_0104576 3300046533 Bacteria 1855
218 Ga0495586_0015888 3300046535 Bacteria 4005
219 Ga0495587_0020501 3300046536 Bacteria 4080
220 Ga0495587_0187999 3300046536 Bacteria 1170
221 Ga0495645_0011013 3300046543 Bacteria 6355
222 Ga0495622_0223620 3300046557 Bacteria 833
223 Ga0495633_0032696 3300046558 Bacteria 2512
224 Ga0495634_0130076 3300046642 Bacteria 1606
225 Ga0495611_0010340 3300046648 Bacteria 3948
226 Ga0495611_0017160 3300046648 Bacteria 3094
227 Ga0495611_0061748 3300046648 Bacteria 1703
228 Ga0495625_0010567 3300046660 Bacteria 7623
229 Ga0495625_0032246 3300046660 Bacteria 3888
230 Ga0495625_0174531 3300046660 Bacteria 1433
231 Ga0495625_0212036 3300046660 Bacteria 1272
232 Ga0495635_0002380 3300046663 Bacteria 12808
233 Ga0495661_0028891 3300046665 Bacteria 3544
234 Ga0495661_0084014 3300046665 Bacteria 1829
235 Ga0495588_0001000 3300046674 Bacteria 12321
236 Ga0495588_0003939 3300046674 Bacteria 6514
237 Ga0495657_0002647 3300046675 Bacteria 14972
238 Ga0495657_0104554 3300046675 Bacteria 1800
239 Ga0495599_0052608 3300046678 Bacteria 2551
240 Ga0495623_0008320 3300046679 Bacteria 6746
241 Ga0495623_0021961 3300046679 Bacteria 4122
242 Ga0495646_0004259 3300046680 Bacteria 9002
243 Ga0495658_0008960 3300046683 Bacteria 4974
244 Ga0495658_0019476 3300046683 Bacteria 3543
245 Ga0495613_0000824 3300046689 Bacteria 24009
246 Ga0495613_0456300 3300046689 Bacteria 865
247 Ga0495624_0025605 3300046690 Bacteria 3873
248 Ga0495624_0080020 3300046690 Bacteria 2025
249 Ga0495670_0051024 3300046691 Bacteria 2070
250 Ga0495671_0014074 3300046692 Bacteria 4313
251 Ga0495649_0060003 3300046694 Bacteria 2047
252 Ga0495649_0130776 3300046694 Bacteria 1324
253 Ga0495589_0014935 3300046794 Bacteria 3996
254 Ga0495589_0024189 3300046794 Bacteria 3087
255 Ga0495589_0028651 3300046794 Bacteria 2809
256 Ga0495600_0061776 3300046809 Bacteria 2447
257 Ga0495660_0021839 3300046810 Bacteria 3661
258 Ga0495660_0097003 3300046810 Bacteria 1522
259 Ga0495581_0031374 3300047315 Bacteria 3079
260 Ga0495581_0117029 3300047315 Bacteria 1550
261 Ga0495604_0008808 3300047317 Bacteria 7975
262 Ga0495604_0009563 3300047317 Bacteria 7668
263 Ga0495604_0021492 3300047317 Bacteria 5151
264 Ga0495636_0013050 3300047318 Bacteria 3294
265 Ga0495636_0143803 3300047318 Bacteria 1066
266 Ga0495674_0052129 3300047319 Bacteria 3602
267 Ga0495672_0029147 3300047320 Bacteria 3481
268 Ga0495676_0003837 3300047321 Bacteria 13668
269 Ga0495676_0004683 3300047321 Bacteria 12526
270 Ga0495676_0009172 3300047321 Bacteria 9018
271 Ga0495676_0071205 3300047321 Bacteria 2673
272 Ga0495676_0084402 3300047321 Bacteria 2396
273 Ga0495680_0009068 3300047322 Bacteria 8981
274 Ga0495683_0018606 3300047323 Bacteria 3589
275 Ga0495683_0107697 3300047323 Bacteria 1333
276 Ga0495687_021280 3300047443 Bacteria 3141
277 Ga0495687_047092 3300047443 Bacteria 1857
278 Ga0495687_066574 3300047443 Bacteria 1461
279 Ga0495687_079499 3300047443 Bacteria 1288
280 Ga0495675_0004558 3300047444 Bacteria 8400
281 Ga0495685_003008 3300047447 Bacteria 5332
282 Ga0495685_004561 3300047447 Bacteria 4486
283 Ga0495685_006881 3300047447 Bacteria 3740
284 Ga0495685_010378 3300047447 Bacteria 3122
285 Ga0495685_026495 3300047447 Bacteria 1994
286 Ga0495681_0001279 3300047470 Bacteria 19056
287 Ga0495681_0002006 3300047470 Bacteria 14881
288 Ga0495684_0057721 3300047471 Bacteria 2958
289 Ga0495686_0014092 3300047472 Bacteria 5518
290 Ga0495686_0056822 3300047472 Bacteria 2444
291 Ga0495593_0001957 3300047673 Bacteria 12286
292 Ga0495593_0057426 3300047673 Bacteria 2043
293 Ga0495593_0061513 3300047673 Bacteria 1964
294 Ga0495593_0099041 3300047673 Bacteria 1496
295 Ga0495593_0176834 3300047673 Bacteria 1075
296 Ga0495602_0434006 3300048088 Bacteria 930
297 Ga0495614_0000354 3300048089 Bacteria 18301
298 Ga0495614_0024809 3300048089 Bacteria 2588
299 Ga0495614_0029651 3300048089 Bacteria 2354
300 Ga0495615_0044638 3300048090 Bacteria 1120
301 Ga0496100_0200654 3300048903 Bacteria 1454
302 Ga0496100_0324889 3300048903 Bacteria 1157
303 Ga0496102_0736656 3300048905 Bacteria 909
304 Ga0496104_0124792 3300048907 Bacteria 2472
305 Ga0496105_0208247 3300048908 Bacteria 1595
306 Ga0496106_0069971 3300048909 Bacteria 2680
307 Ga0496107_0380659 3300048910 Bacteria 1050
308 Ga0496108_0064074 3300048911 Bacteria 3096
309 Ga0496108_0662800 3300048911 Bacteria 907
310 Ga0496109_0039738 3300048912 Bacteria 4259
311 Ga0496110_0493489 3300048913 Bacteria 1115
312 Ga0496114_0127028 3300048917 Bacteria 2199
313 Ga0496114_0482880 3300048917 Bacteria 1096
314 Ga0496126_0055468 3300048929 Bacteria 3585
315 Ga0501305_037715 3300049161 Bacteria 777
316 Ga0495678_041221 3300049459 Bacteria 1849
317 Ga0501311_019811 3300049527 Bacteria 905
318 Ga0501318_006202 3300049534 Bacteria 1214
319 Ga0501320_015844 3300049536 Bacteria 828
320 Ga0501031_0003983 3300049568 Bacteria 9523
321 Ga0501031_0038352 3300049568 Bacteria 3127
322 Ga0501031_0119548 3300049568 Bacteria 1721
323 Ga0501031_0318180 3300049568 Bacteria 1008
324 Ga0501032_0002106 3300049569 Bacteria 15701
325 Ga0501032_0009630 3300049569 Bacteria 7000
326 Ga0501032_0017800 3300049569 Bacteria 4986
327 Ga0501032_0024997 3300049569 Bacteria 4120
328 Ga0501032_0243006 3300049569 Bacteria 1169
329 Ga0501033_0001751 3300049570 Bacteria 19000
330 Ga0501033_0002047 3300049570 Bacteria 17529
331 Ga0501033_0005691 3300049570 Bacteria 9832
332 Ga0501034_0001946 3300049571 Bacteria 26168
333 Ga0501034_0013287 3300049571 Bacteria 8484
334 Ga0501034_0106643 3300049571 Bacteria 2794
335 Ga0501036_0001036 3300049572 Bacteria 20979
336 Ga0501036_0006679 3300049572 Bacteria 9376
337 Ga0501036_0021294 3300049572 Bacteria 5448
338 Ga0501036_0401413 3300049572 Bacteria 1143
339 Ga0501037_0000583 3300049573 Bacteria 28693
340 Ga0501037_0019326 3300049573 Bacteria 5024
341 Ga0501037_0133894 3300049573 Bacteria 1776
342 Ga0501037_0312845 3300049573 Bacteria 1088
343 Ga0501038_0007082 3300049574 Bacteria 10358
344 Ga0501038_0015186 3300049574 Bacteria 7006
345 Ga0501038_0030890 3300049574 Bacteria 4735
346 Ga0501038_0063916 3300049574 Bacteria 3140
347 Ga0501038_0075755 3300049574 Bacteria 2843
348 Ga0501039_0009401 3300049575 Bacteria 7451
349 Ga0501039_0029761 3300049575 Bacteria 4207
350 Ga0501040_0003664 3300049576 Bacteria 9951
351 Ga0501041_0119168 3300049577 Bacteria 1639
352 Ga0501042_0020658 3300049578 Bacteria 4583
353 Ga0501042_0026322 3300049578 Bacteria 4088
354 Ga0501042_0028376 3300049578 Bacteria 3942
355 Ga0501043_0002709 3300049579 Bacteria 14837
356 Ga0501043_0023659 3300049579 Bacteria 4817
357 Ga0501043_0087822 3300049579 Bacteria 2443
358 Ga0501046_0001733 3300049580 Bacteria 20807
359 Ga0501046_0011869 3300049580 Bacteria 7434
360 Ga0501046_0092689 3300049580 Bacteria 2322
361 Ga0501046_0345976 3300049580 Bacteria 1080
362 Ga0501047_0000036 3300049581 Bacteria 195504
363 Ga0501047_0003115 3300049581 Bacteria 15734
364 Ga0501047_0029655 3300049581 Bacteria 5274
365 Ga0501047_0049199 3300049581 Bacteria 4070
366 Ga0501047_0126041 3300049581 Bacteria 2441
367 Ga0501047_0157583 3300049581 Bacteria 2143
368 Ga0501048_0032977 3300049582 Bacteria 3742
369 Ga0501048_0251461 3300049582 Bacteria 1255
370 Ga0501067_0026969 3300049583 Bacteria 3181
371 Ga0501067_0218368 3300049583 Bacteria 1062
372 Ga0501068_0007663 3300049584 Bacteria 5975
373 Ga0501068_0233404 3300049584 Bacteria 1170
374 Ga0501070_0005095 3300049586 Bacteria 11198
375 Ga0501070_0008677 3300049586 Bacteria 8592
376 Ga0501070_0036012 3300049586 Bacteria 4133
377 Ga0501071_0001130 3300049587 Bacteria 14911
378 Ga0501072_0000332 3300049588 Bacteria 33590
379 Ga0501073_0016085 3300049589 Bacteria 5423
380 Ga0501074_0014378 3300049590 Bacteria 5760
381 Ga0501074_0039015 3300049590 Bacteria 3440
382 Ga0501075_0184210 3300049591 Bacteria 1593
383 Ga0501076_0007436 3300049592 Bacteria 7974
384 Ga0501077_0002268 3300049593 Bacteria 11599
385 Ga0501077_0144875 3300049593 Bacteria 1507
386 Ga0501235_026022 3300049669 Bacteria 1310
387 Ga0501079_0001534 3300049741 Bacteria 16336
388 Ga0501080_0081292 3300049742 Bacteria 3011
389 Ga0501083_0000304 3300049744 Bacteria 30994
390 Ga0501035_0028760 3300049822 Bacteria 5071
391 Ga0501035_0100411 3300049822 Bacteria 2540
392 Ga0501035_0102594 3300049822 Bacteria 2509
393 Ga0501035_0155973 3300049822 Bacteria 1979
394 Ga0501044_0002714 3300049823 Bacteria 20128
395 Ga0501044_0002967 3300049823 Bacteria 19278
396 Ga0501044_0016489 3300049823 Bacteria 7929
397 Ga0501044_0027946 3300049823 Bacteria 5953
398 Ga0501044_0059581 3300049823 Bacteria 3911
399 Ga0501044_0085871 3300049823 Bacteria 3179
400 Ga0501044_0155483 3300049823 Bacteria 2266
401 Ga0501044_0187947 3300049823 Bacteria 2030
402 Ga0501045_0011037 3300049824 Bacteria 6332
403 Ga0501045_0282679 3300049824 Bacteria 1235
404 Ga0501045_0411729 3300049824 Bacteria 1006
405 nmdc:mga03n38_191080_c1 3300050490 Bacteria 1055
406 nmdc:mga03n38_5292_c1 3300050490 Bacteria 4378
407 nmdc:mga06z11_36250_c1 3300050494 Bacteria 2434
408 nmdc:mga07m45_195242_c1 3300050496 Bacteria 1177
409 Ga0495619_0063615 3300053085 Bacteria 2458
410 Ga0500578_0089289 3300053086 Bacteria 1956
411 Ga0500566_0049258 3300053094 Bacteria 2413
412 Ga0500566_0228095 3300053094 Bacteria 921
413 Ga0500640_069222 3300053095 Bacteria 1516
414 Ga0500654_018250 3300053099 Bacteria 4561
415 Ga0500660_025112 3300053100 Bacteria 3149
416 Ga0500560_002617 3300053107 Bacteria 3480
417 Ga0500560_060149 3300053107 Bacteria 1237
418 Ga0500614_005185 3300053123 Bacteria 2734
419 Ga0500652_000523 3300053131 Bacteria 13547
420 Ga0500658_0005806 3300053134 Bacteria 4597
421 Ga0500561_0009535 3300053137 Bacteria 1975
422 Ga0500573_0028480 3300053140 Bacteria 3217
423 Ga0500573_0059024 3300053140 Bacteria 2199
424 Ga0500588_0048780 3300053146 Bacteria 1311
425 Ga0500600_0007714 3300053149 Bacteria 6476
426 Ga0500600_0128929 3300053149 Bacteria 1291
427 Ga0500616_0061487 3300053153 Bacteria 1943
428 Ga0500633_0001949 3300053160 Bacteria 4090
429 Ga0500634_0020364 3300053161 Bacteria 3586
430 Ga0500636_0254918 3300053177 Bacteria 892
431 Ga0500656_000182 3300053732 Bacteria 4117
432 Ga0501084_0003191 3300054114 Bacteria 13268
433 Ga0501084_0370066 3300054114 Bacteria 1211
434 Ga0501082_0045380 3300060353 Bacteria 3790
435 Ga0466962_0000217 3300061719 Bacteria 23834
436 Ga0466962_0002222 3300061719 Bacteria 9177
437 Ga0466962_0007099 3300061719 Bacteria 5370
438 Ga0466962_0176798 3300061719 Bacteria 1040
439 Ga0530510_0029009 3300061734 Bacteria 3969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0278405 Ga0495664_0278405_343_999 218
2 3300044683 Ga0466965_0000530 Ga0466965_0000530_6707_7372 221
3 3300048917 Ga0496114_0127028 Ga0496114_0127028_420_1088 221
4 3300025986 Ga0207658_10117545 Ga0207658_101175453 224
5 3300048908 Ga0496105_0208247 Ga0496105_0208247_897_1571 224
6 3300053094 Ga0500566_0228095 Ga0500566_0228095_227_901 224
7 iso_pu_bacteria 8054160619 8054163087 225
8 3300026023 Ga0207677_10416907 Ga0207677_104169071 226
9 3300048903 Ga0496100_0324889 Ga0496100_0324889_376_1110 226
10 3300048910 Ga0496107_0380659 Ga0496107_0380659_139_873 226
11 iso_pu_bacteria 2582581313 2585309284 226
12 iso_pu_bacteria 2867475112 2867476546 226
13 3300046455 Ga0495603_0094219 Ga0495603_0094219_267_1004 227
14 3300046473 Ga0495582_0354575 Ga0495582_0354575_87_824 227
15 3300046474 Ga0495605_0007353 Ga0495605_0007353_35_772 227
16 3300046507 Ga0495606_0035663 Ga0495606_0035663_1919_2656 227
17 3300046518 Ga0495631_0039353 Ga0495631_0039353_125_862 227
18 3300046660 Ga0495625_0212036 Ga0495625_0212036_80_817 227
19 3300046665 Ga0495661_0028891 Ga0495661_0028891_2367_3104 227
20 3300046694 Ga0495649_0130776 Ga0495649_0130776_397_1134 227
21 3300046810 Ga0495660_0097003 Ga0495660_0097003_23_760 227
22 3300047321 Ga0495676_0009172 Ga0495676_0009172_7676_8413 227
23 iso_pu_bacteria 2808606982 2811843747 227
24 3300005435 Ga0070714_100019064 Ga0070714_1000190645 228
25 3300005983 Ga0081540_1037017 Ga0081540_10370173 228
26 3300025929 Ga0207664_10018097 Ga0207664_100180973 228
27 3300047320 Ga0495672_0029147 Ga0495672_0029147_1357_2103 228
28 3300047472 Ga0495686_0014092 Ga0495686_0014092_98_844 228
29 iso_pu_bacteria 8033684223 8033685015 228
30 3300047318 Ga0495636_0143803 Ga0495636_0143803_117_854 229
31 3300047323 Ga0495683_0107697 Ga0495683_0107697_456_1184 229
32 3300049568 Ga0501031_0318180 Ga0501031_0318180_292_990 229
33 3300049569 Ga0501032_0243006 Ga0501032_0243006_275_973 229
34 3300049574 Ga0501038_0075755 Ga0501038_0075755_484_1182 229
35 3300049575 Ga0501039_0029761 Ga0501039_0029761_351_1049 229
36 3300049581 Ga0501047_0126041 Ga0501047_0126041_1599_2297 229
37 3300049582 Ga0501048_0251461 Ga0501048_0251461_141_839 229
38 3300049590 Ga0501074_0039015 Ga0501074_0039015_575_1273 229
39 3300049822 Ga0501035_0155973 Ga0501035_0155973_98_796 229
40 3300049823 Ga0501044_0085871 Ga0501044_0085871_1711_2409 229
41 iso_pu_bacteria 2554235005 2554260497 229
42 iso_pu_bacteria 2791355406 2793978323 229
43 iso_pu_bacteria 2862178590 2862182435 229
44 iso_pu_bacteria 2997600082 2997602031 229
45 iso_pu_bacteria 8047893842 8047895441 229
46 iso_pu_bacteria 8048127548 8048132475 229
47 iso_pu_bacteria 8048356638 8048363513 229
48 iso_pu_bacteria 8048369669 8048372466 229
49 iso_pu_bacteria 8048379754 8048381400 229
50 3300009093 Ga0105240_10932565 Ga0105240_109325652 230
51 3300025913 Ga0207695_10226313 Ga0207695_102263133 230
52 3300045049 Ga0466959_0019578 Ga0466959_0019578_1260_1970 230
53 3300046499 Ga0495594_0190602 Ga0495594_0190602_287_985 230
54 3300046679 Ga0495623_0008320 Ga0495623_0008320_3038_3736 230
55 3300047317 Ga0495604_0008808 Ga0495604_0008808_6907_7605 230
56 3300047444 Ga0495675_0004558 Ga0495675_0004558_1973_2671 230
57 3300049591 Ga0501075_0184210 Ga0501075_0184210_285_995 230
58 3300049593 Ga0501077_0144875 Ga0501077_0144875_692_1402 230
59 iso_pu_bacteria 3006321560 3006327158 230
60 iso_pu_bacteria 8025413630 8025417645 230
61 3300005614 Ga0068856_100068707 Ga0068856_1000687072 231
62 3300044684 Ga0466966_0251765 Ga0466966_0251765_26_724 231
63 3300044693 Ga0466961_0010427 Ga0466961_0010427_608_1306 231
64 3300044693 Ga0466961_0253236 Ga0466961_0253236_130_828 231
65 3300044694 Ga0466963_0001657 Ga0466963_0001657_3069_3767 231
66 3300044706 Ga0466964_0062503 Ga0466964_0062503_103_801 231
67 3300044719 Ga0466971_0103744 Ga0466971_0103744_135_833 231
68 3300045049 Ga0466959_0237125 Ga0466959_0237125_175_873 231
69 3300045836 Ga0466958_0219537 Ga0466958_0219537_364_1062 231
70 3300045976 Ga0466967_0048418 Ga0466967_0048418_23_721 231
71 3300053107 Ga0500560_060149 Ga0500560_060149_315_1022 231
72 3300053140 Ga0500573_0028480 Ga0500573_0028480_1454_2161 231
73 iso_pu_bacteria 2918501144 2918507269 231
74 iso_pu_bacteria 2935390628 2935391212 231
75 iso_pu_bacteria 3006425503 3006430154 231
76 3300005435 Ga0070714_100295404 Ga0070714_1002954042 232
77 3300005436 Ga0070713_100050596 Ga0070713_1000505963 232
78 3300005439 Ga0070711_100073404 Ga0070711_1000734043 232
79 3300005937 Ga0081455_10002092 Ga0081455_1000209221 232
80 3300006028 Ga0070717_10833549 Ga0070717_108335491 232
81 3300006175 Ga0070712_100094624 Ga0070712_1000946243 232
82 3300020069 Ga0197907_10051208 Ga0197907_100512082 232
83 3300022467 Ga0224712_10022350 Ga0224712_100223503 232
84 3300025916 Ga0207663_10050739 Ga0207663_100507392 232
85 3300025928 Ga0207700_10037322 Ga0207700_100373223 232
86 3300025929 Ga0207664_10061590 Ga0207664_100615903 232
87 3300044656 Ga0466969_0022995 Ga0466969_0022995_1719_2420 232
88 3300044684 Ga0466966_0012279 Ga0466966_0012279_3683_4384 232
89 3300044684 Ga0466966_0246929 Ga0466966_0246929_83_787 232
90 3300044684 Ga0466966_0348807 Ga0466966_0348807_127_828 232
91 3300044693 Ga0466961_0029518 Ga0466961_0029518_928_1629 232
92 3300044693 Ga0466961_0112674 Ga0466961_0112674_344_1045 232
93 3300044693 Ga0466961_0145194 Ga0466961_0145194_94_798 232
94 3300044693 Ga0466961_0188517 Ga0466961_0188517_510_1211 232
95 3300044694 Ga0466963_0225664 Ga0466963_0225664_287_988 232
96 3300044694 Ga0466963_0245310 Ga0466963_0245310_290_991 232
97 3300044719 Ga0466971_0010241 Ga0466971_0010241_2568_3269 232
98 3300044765 Ga0466970_0069751 Ga0466970_0069751_512_1216 232
99 3300045049 Ga0466959_0000623 Ga0466959_0000623_19179_19880 232
100 3300045049 Ga0466959_0088786 Ga0466959_0088786_1499_2200 232
101 3300045049 Ga0466959_0296676 Ga0466959_0296676_81_782 232
102 3300045836 Ga0466958_0004142 Ga0466958_0004142_1027_1728 232
103 3300046459 Ga0495629_0000865 Ga0495629_0000865_16175_16876 232
104 3300046460 Ga0495638_0171367 Ga0495638_0171367_17_718 232
105 3300046499 Ga0495594_0000910 Ga0495594_0000910_12477_13178 232
106 3300046648 Ga0495611_0010340 Ga0495611_0010340_1731_2432 232
107 3300046674 Ga0495588_0003939 Ga0495588_0003939_3311_4012 232
108 3300047321 Ga0495676_0003837 Ga0495676_0003837_4555_5256 232
109 3300048905 Ga0496102_0736656 Ga0496102_0736656_43_747 232
110 3300061719 Ga0466962_0002222 Ga0466962_0002222_7140_7841 232
111 iso_pu_bacteria 2547132111 2547407541 232
112 iso_pu_bacteria 2582581314 2585316657 232
113 iso_pu_bacteria 2616644814 2616699797 232
114 iso_pu_bacteria 2643221647 2644264736 232
115 iso_pu_bacteria 2643221714 2644626741 232
116 iso_pu_bacteria 2784132148 2784591259 232
117 iso_pu_bacteria 2784746763 2785340427 232
118 iso_pu_bacteria 2784746768 2785372337 232
119 iso_pu_bacteria 2786546132 2786673474 232
120 iso_pu_bacteria 2808606375 2808914348 232
121 iso_pu_bacteria 2808606448 2809234831 232
122 iso_pu_bacteria 2811994879 2812355177 232
123 iso_pu_bacteria 2811994917 2812477911 232
124 iso_pu_bacteria 2852635781 2852638682 232
125 iso_pu_bacteria 2862281513 2862283739 232
126 iso_pu_bacteria 2862290372 2862291896 232
127 iso_pu_bacteria 2867369537 2867374500 232
128 iso_pu_bacteria 2867428634 2867432180 232
129 iso_pu_bacteria 2877676314 2877678313 232
130 iso_pu_bacteria 2912723979 2912729429 232
131 iso_pu_bacteria 2946064051 2946070715 232
132 iso_pu_bacteria 2946072368 2946078432 232
133 iso_pu_bacteria 2947224130 2947226081 232
134 iso_pu_bacteria 2954002825 2954010253 232
135 iso_pu_bacteria 2954380949 2954383226 232
136 iso_pu_bacteria 2954673503 2954679779 232
137 iso_pu_bacteria 2954682443 2954684374 232
138 iso_pu_bacteria 2954691527 2954693936 232
139 iso_pu_bacteria 2954701450 2954709042 232
140 iso_pu_bacteria 2954711539 2954713547 232
141 iso_pu_bacteria 2954721474 2954723510 232
142 iso_pu_bacteria 2954731030 2954738320 232
143 iso_pu_bacteria 2954740390 2954742414 232
144 iso_pu_bacteria 2954749733 2954757180 232
145 iso_pu_bacteria 2954759201 2954761383 232
146 iso_pu_bacteria 2990044586 2990049146 232
147 iso_pu_bacteria 3006493962 3006500637 232
148 iso_pu_bacteria 8008574985 8008576430 232
149 iso_pu_bacteria 8023623736 8023630241 232
150 iso_pu_bacteria 8056829672 8056829810 232
151 3300003354 JGI25160J50197_1061837 JGI25160J50197_10618371 233
152 3300005456 Ga0070678_100284650 Ga0070678_1002846501 233
153 3300005548 Ga0070665_100168868 Ga0070665_1001688683 233
154 3300005563 Ga0068855_100067853 Ga0068855_1000678532 233
155 3300005614 Ga0068856_100004071 Ga0068856_10000407112 233
156 3300005614 Ga0068856_100382630 Ga0068856_1003826302 233
157 3300005616 Ga0068852_100084788 Ga0068852_1000847882 233
158 3300009093 Ga0105240_10030467 Ga0105240_100304673 233
159 3300009093 Ga0105240_10091285 Ga0105240_100912851 233
160 3300009101 Ga0105247_10480435 Ga0105247_104804351 233
161 3300009174 Ga0105241_10003392 Ga0105241_100033922 233
162 3300009545 Ga0105237_10037249 Ga0105237_100372495 233
163 3300009545 Ga0105237_10220068 Ga0105237_102200682 233
164 3300009545 Ga0105237_10450574 Ga0105237_104505741 233
165 3300010375 Ga0105239_10020545 Ga0105239_100205455 233
166 3300010375 Ga0105239_10058710 Ga0105239_100587103 233
167 3300020069 Ga0197907_11339174 Ga0197907_113391741 233
168 3300020070 Ga0206356_11353819 Ga0206356_113538191 233
169 3300025302 Ga0207426_1001177 Ga0207426_10011776 233
170 3300025302 Ga0207426_1014513 Ga0207426_10145134 233
171 3300025904 Ga0207647_10007894 Ga0207647_100078945 233
172 3300025909 Ga0207705_10075649 Ga0207705_100756492 233
173 3300025911 Ga0207654_10007073 Ga0207654_100070735 233
174 3300025913 Ga0207695_10002874 Ga0207695_1000287416 233
175 3300025913 Ga0207695_10023232 Ga0207695_100232326 233
176 3300025914 Ga0207671_10000284 Ga0207671_1000028442 233
177 3300025914 Ga0207671_10074243 Ga0207671_100742432 233
178 3300025924 Ga0207694_10000669 Ga0207694_1000066917 233
179 3300025949 Ga0207667_10010681 Ga0207667_1001068111 233
180 3300026078 Ga0207702_10007850 Ga0207702_100078503 233
181 3300026078 Ga0207702_10121535 Ga0207702_101215352 233
182 3300026142 Ga0207698_10560715 Ga0207698_105607151 233
183 3300028379 Ga0268266_10254741 Ga0268266_102547412 233
184 3300031616 Ga0307508_10015847 Ga0307508_100158478 233
185 3300031649 Ga0307514_10049266 Ga0307514_100492664 233
186 3300031730 Ga0307516_10052097 Ga0307516_100520972 233
187 3300044694 Ga0466963_0290941 Ga0466963_0290941_66_833 233
188 3300044706 Ga0466964_0242150 Ga0466964_0242150_85_852 233
189 3300046476 Ga0495662_0018662 Ga0495662_0018662_30_776 233
190 3300046533 Ga0495640_0104576 Ga0495640_0104576_1079_1834 233
191 3300046679 Ga0495623_0021961 Ga0495623_0021961_2450_3187 233
192 3300046690 Ga0495624_0080020 Ga0495624_0080020_197_934 233
193 3300047315 Ga0495581_0117029 Ga0495581_0117029_364_1104 233
194 3300047317 Ga0495604_0021492 Ga0495604_0021492_2527_3282 233
195 3300047443 Ga0495687_066574 Ga0495687_066574_484_1212 233
196 3300047673 Ga0495593_0057426 Ga0495593_0057426_777_1532 233
197 3300047673 Ga0495593_0099041 Ga0495593_0099041_520_1248 233
198 3300048929 Ga0496126_0055468 Ga0496126_0055468_1217_1921 233
199 3300049569 Ga0501032_0017800 Ga0501032_0017800_1129_1845 233
200 3300049572 Ga0501036_0021294 Ga0501036_0021294_2933_3691 233
201 3300049573 Ga0501037_0019326 Ga0501037_0019326_3114_3815 233
202 3300049578 Ga0501042_0028376 Ga0501042_0028376_3160_3861 233
203 3300049579 Ga0501043_0023659 Ga0501043_0023659_3858_4574 233
204 3300049579 Ga0501043_0087822 Ga0501043_0087822_1208_1966 233
205 3300049581 Ga0501047_0000036 Ga0501047_0000036_156132_156833 233
206 3300049581 Ga0501047_0049199 Ga0501047_0049199_1728_2486 233
207 3300049583 Ga0501067_0218368 Ga0501067_0218368_169_885 233
208 3300049584 Ga0501068_0233404 Ga0501068_0233404_152_910 233
209 3300049586 Ga0501070_0008677 Ga0501070_0008677_2484_3242 233
210 3300049823 Ga0501044_0155483 Ga0501044_0155483_307_1023 233
211 3300049823 Ga0501044_0187947 Ga0501044_0187947_771_1472 233
212 iso_pu_bacteria 2818991463 2819699845 233
213 3300028786 Ga0307517_10001330 Ga0307517_1000133027 234
214 3300031616 Ga0307508_10003642 Ga0307508_100036423 234
215 3300031649 Ga0307514_10022176 Ga0307514_100221766 234
216 3300033179 Ga0307507_10159323 Ga0307507_101593233 234
217 3300046499 Ga0495594_0009172 Ga0495594_0009172_1753_2466 234
218 3300046499 Ga0495594_0128555 Ga0495594_0128555_86_790 234
219 3300046519 Ga0495632_0025828 Ga0495632_0025828_1589_2302 234
220 3300046522 Ga0495643_0023669 Ga0495643_0023669_1694_2407 234
221 3300046558 Ga0495633_0032696 Ga0495633_0032696_1503_2216 234
222 3300046642 Ga0495634_0130076 Ga0495634_0130076_858_1571 234
223 3300046683 Ga0495658_0008960 Ga0495658_0008960_3010_3723 234
224 3300046691 Ga0495670_0051024 Ga0495670_0051024_390_1103 234
225 3300046794 Ga0495589_0014935 Ga0495589_0014935_2756_3469 234
226 3300046810 Ga0495660_0021839 Ga0495660_0021839_637_1350 234
227 3300047317 Ga0495604_0009563 Ga0495604_0009563_5030_5734 234
228 3300047323 Ga0495683_0018606 Ga0495683_0018606_2180_2893 234
229 3300047443 Ga0495687_047092 Ga0495687_047092_670_1383 234
230 3300047447 Ga0495685_003008 Ga0495685_003008_3937_4650 234
231 3300047470 Ga0495681_0001279 Ga0495681_0001279_2050_2763 234
232 3300047673 Ga0495593_0176834 Ga0495593_0176834_333_1046 234
233 3300049568 Ga0501031_0003983 Ga0501031_0003983_1863_2567 234
234 3300049568 Ga0501031_0038352 Ga0501031_0038352_1351_2055 234
235 3300049569 Ga0501032_0002106 Ga0501032_0002106_2911_3615 234
236 3300049569 Ga0501032_0009630 Ga0501032_0009630_6231_6935 234
237 3300049570 Ga0501033_0001751 Ga0501033_0001751_1199_1903 234
238 3300049570 Ga0501033_0005691 Ga0501033_0005691_8036_8740 234
239 3300049571 Ga0501034_0001946 Ga0501034_0001946_6957_7661 234
240 3300049571 Ga0501034_0013287 Ga0501034_0013287_1635_2339 234
241 3300049572 Ga0501036_0001036 Ga0501036_0001036_2580_3284 234
242 3300049572 Ga0501036_0006679 Ga0501036_0006679_362_1066 234
243 3300049573 Ga0501037_0000583 Ga0501037_0000583_2617_3321 234
244 3300049573 Ga0501037_0133894 Ga0501037_0133894_871_1575 234
245 3300049574 Ga0501038_0007082 Ga0501038_0007082_2592_3296 234
246 3300049574 Ga0501038_0015186 Ga0501038_0015186_3839_4543 234
247 3300049575 Ga0501039_0009401 Ga0501039_0009401_4292_4996 234
248 3300049576 Ga0501040_0003664 Ga0501040_0003664_4411_5115 234
249 3300049577 Ga0501041_0119168 Ga0501041_0119168_177_881 234
250 3300049578 Ga0501042_0026322 Ga0501042_0026322_1013_1717 234
251 3300049579 Ga0501043_0002709 Ga0501043_0002709_2580_3284 234
252 3300049580 Ga0501046_0001733 Ga0501046_0001733_2408_3112 234
253 3300049580 Ga0501046_0345976 Ga0501046_0345976_18_722 234
254 3300049581 Ga0501047_0003115 Ga0501047_0003115_11615_12319 234
255 3300049582 Ga0501048_0032977 Ga0501048_0032977_631_1335 234
256 3300049583 Ga0501067_0026969 Ga0501067_0026969_22_726 234
257 3300049584 Ga0501068_0007663 Ga0501068_0007663_2816_3520 234
258 3300049586 Ga0501070_0005095 Ga0501070_0005095_2408_3112 234
259 3300049587 Ga0501071_0001130 Ga0501071_0001130_4292_4996 234
260 3300049588 Ga0501072_0000332 Ga0501072_0000332_23209_23913 234
261 3300049589 Ga0501073_0016085 Ga0501073_0016085_2456_3160 234
262 3300049590 Ga0501074_0014378 Ga0501074_0014378_2901_3605 234
263 3300049592 Ga0501076_0007436 Ga0501076_0007436_1430_2134 234
264 3300049593 Ga0501077_0002268 Ga0501077_0002268_3587_4291 234
265 3300049741 Ga0501079_0001534 Ga0501079_0001534_4292_4996 234
266 3300049744 Ga0501083_0000304 Ga0501083_0000304_22092_22796 234
267 3300049822 Ga0501035_0028760 Ga0501035_0028760_1912_2616 234
268 3300049823 Ga0501044_0002967 Ga0501044_0002967_11618_12322 234
269 3300049824 Ga0501045_0011037 Ga0501045_0011037_2901_3605 234
270 3300049824 Ga0501045_0282679 Ga0501045_0282679_474_1178 234
271 3300053086 Ga0500578_0089289 Ga0500578_0089289_945_1658 234
272 3300053094 Ga0500566_0049258 Ga0500566_0049258_906_1619 234
273 3300053099 Ga0500654_018250 Ga0500654_018250_1785_2498 234
274 3300053100 Ga0500660_025112 Ga0500660_025112_889_1602 234
275 3300053123 Ga0500614_005185 Ga0500614_005185_331_1044 234
276 3300053131 Ga0500652_000523 Ga0500652_000523_8297_9010 234
277 3300053134 Ga0500658_0005806 Ga0500658_0005806_3514_4227 234
278 3300053137 Ga0500561_0009535 Ga0500561_0009535_964_1677 234
279 3300053140 Ga0500573_0059024 Ga0500573_0059024_497_1282 234
280 3300053146 Ga0500588_0048780 Ga0500588_0048780_222_935 234
281 3300053149 Ga0500600_0007714 Ga0500600_0007714_4528_5241 234
282 3300053153 Ga0500616_0061487 Ga0500616_0061487_890_1603 234
283 3300053160 Ga0500633_0001949 Ga0500633_0001949_1408_2121 234
284 3300053161 Ga0500634_0020364 Ga0500634_0020364_2682_3395 234
285 3300053732 Ga0500656_000182 Ga0500656_000182_2772_3485 234
286 3300054114 Ga0501084_0003191 Ga0501084_0003191_759_1463 234
287 3300060353 Ga0501082_0045380 Ga0501082_0045380_2443_3147 234
288 3300061734 Ga0530510_0029009 Ga0530510_0029009_2741_3445 234
289 iso_pu_bacteria 2738541305 2738871795 234
290 iso_pu_bacteria 2811994874 2812333233 234
291 iso_pu_bacteria 2862574272 2862576719 234
292 iso_pu_bacteria 8008558824 8008563702 234
293 3300006048 Ga0075363_100296608 Ga0075363_1002966082 235
294 3300006353 Ga0075370_10084188 Ga0075370_100841883 235
295 3300028794 Ga0307515_10256124 Ga0307515_102561242 235
296 3300030500 Ga0268256_1024135 Ga0268256_10241352 235
297 3300030522 Ga0307512_10028984 Ga0307512_100289845 235
298 3300045976 Ga0466967_0045214 Ga0466967_0045214_2201_2941 235
299 3300045976 Ga0466967_0047976 Ga0466967_0047976_330_1037 235
300 3300049586 Ga0501070_0036012 Ga0501070_0036012_2874_3614 235
301 3300050490 nmdc:mga03n38_5292_c1 nmdc:mga03n38_5292_c1_113_820 235
302 3300050496 nmdc:mga07m45_195242_c1 nmdc:mga07m45_195242_c1_97_804 235
303 3300054114 Ga0501084_0370066 Ga0501084_0370066_131_841 235
304 iso_pu_bacteria 2643221587 2643943273 235
305 iso_pu_bacteria 2643221677 2644430741 235
306 3300001989 JGI24739J22299_10080323 JGI24739J22299_100803231 236
307 3300001990 JGI24737J22298_10003190 JGI24737J22298_100031904 236
308 3300002067 JGI24735J21928_10034302 JGI24735J21928_100343023 236
309 3300003323 rootH1_10003304 rootH1_100033048 236
310 3300003578 Ga0006562J51391_1039091 Ga0006562J51391_10390913 236
311 3300005937 Ga0081455_10048164 Ga0081455_100481644 236
312 3300006048 Ga0075363_100226057 Ga0075363_1002260573 236
313 3300006178 Ga0075367_10024432 Ga0075367_100244323 236
314 3300006948 Ga0099826_10114314 Ga0099826_101143142 236
315 3300009101 Ga0105247_10420054 Ga0105247_104200541 236
316 3300009177 Ga0105248_10520275 Ga0105248_105202751 236
317 3300013307 Ga0157372_10221767 Ga0157372_102217673 236
318 3300014325 Ga0163163_10233031 Ga0163163_102330312 236
319 3300015688 Ga0183367_1001 Ga0183367_1001297 236
320 3300025904 Ga0207647_10079284 Ga0207647_100792842 236
321 3300027666 Ga0209282_1091991 Ga0209282_10919912 236
322 3300028786 Ga0307517_10004423 Ga0307517_1000442312 236
323 3300028794 Ga0307515_10000501 Ga0307515_100005014 236
324 3300028794 Ga0307515_10005358 Ga0307515_100053583 236
325 3300031456 Ga0307513_10017461 Ga0307513_100174616 236
326 3300031456 Ga0307513_10131381 Ga0307513_101313813 236
327 3300031507 Ga0307509_10097178 Ga0307509_100971783 236
328 3300031616 Ga0307508_10351627 Ga0307508_103516272 236
329 3300031616 Ga0307508_10419804 Ga0307508_104198042 236
330 3300031649 Ga0307514_10003913 Ga0307514_1000391311 236
331 3300031649 Ga0307514_10308503 Ga0307514_103085031 236
332 3300031649 Ga0307514_10338673 Ga0307514_103386731 236
333 3300031730 Ga0307516_10038926 Ga0307516_100389266 236
334 3300033179 Ga0307507_10010364 Ga0307507_100103642 236
335 3300033180 Ga0307510_10019886 Ga0307510_100198864 236
336 3300033180 Ga0307510_10082507 Ga0307510_100825073 236
337 3300033180 Ga0307510_10160207 Ga0307510_101602073 236
338 3300033180 Ga0307510_10250451 Ga0307510_102504511 236
339 3300037466 Ga0395898_0272873 Ga0395898_0272873_782_1492 236
340 3300037466 Ga0395898_0654035 Ga0395898_0654035_147_893 236
341 3300037471 Ga0395905_0487423 Ga0395905_0487423_292_1038 236
342 3300041406 Ga0439439_0013610 Ga0439439_0013610_953_1717 236
343 3300041443 Ga0451789_1276089 Ga0451789_1276089_517_1227 236
344 3300041505 Ga0451849_1572190 Ga0451849_1572190_208_918 236
345 3300041512 Ga0451853_1098851 Ga0451853_1098851_994_1704 236
346 3300041512 Ga0451853_2200265 Ga0451853_2200265_1298_2053 236
347 3300042002 Ga0439442_008382 Ga0439442_008382_1046_1756 236
348 3300042005 Ga0439448_0001874 Ga0439448_0001874_222_932 236
349 3300042005 Ga0439448_0061953 Ga0439448_0061953_29_739 236
350 3300042007 Ga0439449_0000414 Ga0439449_0000414_3478_4188 236
351 3300042012 Ga0439455_0000981 Ga0439455_0000981_653_1363 236
352 3300042014 Ga0439457_000009 Ga0439457_000009_23852_24616 236
353 3300042014 Ga0439457_000296 Ga0439457_000296_3223_3933 236
354 3300042014 Ga0439457_030706 Ga0439457_030706_178_933 236
355 3300042015 Ga0439462_0018210 Ga0439462_0018210_878_1588 236
356 3300042131 Ga0450894_000028 Ga0450894_000028_10471_11226 236
357 3300042132 Ga0450895_000633 Ga0450895_000633_86_841 236
358 3300042133 Ga0450896_001531 Ga0450896_001531_106_861 236
359 3300042134 Ga0450898_000057 Ga0450898_000057_2635_3390 236
360 3300042135 Ga0450899_003716 Ga0450899_003716_689_1444 236
361 3300042135 Ga0450899_006013 Ga0450899_006013_236_1000 236
362 3300042138 Ga0450903_000364 Ga0450903_000364_7543_8253 236
363 3300042145 Ga0450906_000171 Ga0450906_000171_4373_5128 236
364 3300042157 Ga0439458_0000381 Ga0439458_0000381_2682_3392 236
365 3300042157 Ga0439458_0026176 Ga0439458_0026176_297_1007 236
366 3300042533 Ga0450901_006649 Ga0450901_006649_21_731 236
367 3300044656 Ga0466969_0055017 Ga0466969_0055017_604_1314 236
368 3300044656 Ga0466969_0065035 Ga0466969_0065035_491_1201 236
369 3300044658 Ga0466972_0007916 Ga0466972_0007916_3917_4627 236
370 3300044658 Ga0466972_0050289 Ga0466972_0050289_278_988 236
371 3300044658 Ga0466972_0066479 Ga0466972_0066479_979_1689 236
372 3300044683 Ga0466965_0001703 Ga0466965_0001703_7381_8127 236
373 3300044683 Ga0466965_0074628 Ga0466965_0074628_475_1185 236
374 3300044684 Ga0466966_0000480 Ga0466966_0000480_18416_19126 236
375 3300044684 Ga0466966_0018605 Ga0466966_0018605_2005_2715 236
376 3300044693 Ga0466961_0000749 Ga0466961_0000749_8498_9208 236
377 3300044693 Ga0466961_0015009 Ga0466961_0015009_521_1231 236
378 3300044694 Ga0466963_0000053 Ga0466963_0000053_7559_8269 236
379 3300044694 Ga0466963_0181555 Ga0466963_0181555_250_960 236
380 3300044706 Ga0466964_0001852 Ga0466964_0001852_3744_4454 236
381 3300044719 Ga0466971_0000530 Ga0466971_0000530_11609_12319 236
382 3300044719 Ga0466971_0120114 Ga0466971_0120114_56_766 236
383 3300044735 Ga0466968_0094714 Ga0466968_0094714_576_1286 236
384 3300044765 Ga0466970_0000077 Ga0466970_0000077_6834_7544 236
385 3300044765 Ga0466970_0010609 Ga0466970_0010609_1652_2362 236
386 3300044842 Ga0466957_0000461 Ga0466957_0000461_9872_10582 236
387 3300044901 Ga0466960_0001743 Ga0466960_0001743_4197_4907 236
388 3300044901 Ga0466960_0079524 Ga0466960_0079524_252_962 236
389 3300044901 Ga0466960_0253003 Ga0466960_0253003_25_771 236
390 3300045049 Ga0466959_0002375 Ga0466959_0002375_2272_2982 236
391 3300045836 Ga0466958_0000820 Ga0466958_0000820_8498_9208 236
392 3300045976 Ga0466967_0007988 Ga0466967_0007988_892_1602 236
393 3300045976 Ga0466967_0047705 Ga0466967_0047705_1985_2695 236
394 3300045976 Ga0466967_0122573 Ga0466967_0122573_119_829 236
395 3300045976 Ga0466967_0516009 Ga0466967_0516009_442_1152 236
396 3300046454 Ga0495592_0001940 Ga0495592_0001940_4198_4908 236
397 3300046454 Ga0495592_0005101 Ga0495592_0005101_3110_3838 236
398 3300046455 Ga0495603_0000293 Ga0495603_0000293_1360_2076 236
399 3300046459 Ga0495629_0011955 Ga0495629_0011955_1964_2680 236
400 3300046459 Ga0495629_0080579 Ga0495629_0080579_700_1410 236
401 3300046462 Ga0495651_0004704 Ga0495651_0004704_8725_9435 236
402 3300046474 Ga0495605_0023509 Ga0495605_0023509_1165_1887 236
403 3300046477 Ga0495664_0002987 Ga0495664_0002987_7197_7907 236
404 3300046477 Ga0495664_0268439 Ga0495664_0268439_274_990 236
405 3300046492 Ga0495585_0165935 Ga0495585_0165935_317_1045 236
406 3300046516 Ga0495628_0152195 Ga0495628_0152195_383_1093 236
407 3300046517 Ga0495630_0086292 Ga0495630_0086292_573_1283 236
408 3300046518 Ga0495631_0028536 Ga0495631_0028536_1156_1878 236
409 3300046524 Ga0495648_0045127 Ga0495648_0045127_631_1377 236
410 3300046529 Ga0495652_0032656 Ga0495652_0032656_1214_1924 236
411 3300046530 Ga0495654_0052042 Ga0495654_0052042_1237_1956 236
412 3300046535 Ga0495586_0015888 Ga0495586_0015888_2737_3447 236
413 3300046536 Ga0495587_0020501 Ga0495587_0020501_2465_3175 236
414 3300046536 Ga0495587_0187999 Ga0495587_0187999_271_981 236
415 3300046543 Ga0495645_0011013 Ga0495645_0011013_977_1687 236
416 3300046557 Ga0495622_0223620 Ga0495622_0223620_57_767 236
417 3300046648 Ga0495611_0017160 Ga0495611_0017160_1751_2479 236
418 3300046648 Ga0495611_0061748 Ga0495611_0061748_304_1026 236
419 3300046660 Ga0495625_0010567 Ga0495625_0010567_6167_6877 236
420 3300046660 Ga0495625_0032246 Ga0495625_0032246_263_1006 236
421 3300046660 Ga0495625_0174531 Ga0495625_0174531_486_1208 236
422 3300046663 Ga0495635_0002380 Ga0495635_0002380_741_1451 236
423 3300046665 Ga0495661_0084014 Ga0495661_0084014_110_832 236
424 3300046674 Ga0495588_0001000 Ga0495588_0001000_747_1457 236
425 3300046675 Ga0495657_0002647 Ga0495657_0002647_13128_13838 236
426 3300046675 Ga0495657_0104554 Ga0495657_0104554_605_1333 236
427 3300046678 Ga0495599_0052608 Ga0495599_0052608_1547_2266 236
428 3300046680 Ga0495646_0004259 Ga0495646_0004259_7415_8125 236
429 3300046683 Ga0495658_0019476 Ga0495658_0019476_759_1469 236
430 3300046689 Ga0495613_0000824 Ga0495613_0000824_21364_22080 236
431 3300046689 Ga0495613_0456300 Ga0495613_0456300_128_838 236
432 3300046690 Ga0495624_0025605 Ga0495624_0025605_871_1581 236
433 3300046692 Ga0495671_0014074 Ga0495671_0014074_2885_3595 236
434 3300046694 Ga0495649_0060003 Ga0495649_0060003_1189_1908 236
435 3300046794 Ga0495589_0024189 Ga0495589_0024189_2217_2939 236
436 3300046794 Ga0495589_0028651 Ga0495589_0028651_742_1464 236
437 3300046809 Ga0495600_0061776 Ga0495600_0061776_997_1707 236
438 3300047315 Ga0495581_0031374 Ga0495581_0031374_729_1439 236
439 3300047318 Ga0495636_0013050 Ga0495636_0013050_1878_2588 236
440 3300047319 Ga0495674_0052129 Ga0495674_0052129_521_1231 236
441 3300047321 Ga0495676_0004683 Ga0495676_0004683_714_1424 236
442 3300047321 Ga0495676_0071205 Ga0495676_0071205_1291_2007 236
443 3300047321 Ga0495676_0084402 Ga0495676_0084402_178_897 236
444 3300047322 Ga0495680_0009068 Ga0495680_0009068_7634_8362 236
445 3300047443 Ga0495687_021280 Ga0495687_021280_1243_1953 236
446 3300047443 Ga0495687_079499 Ga0495687_079499_134_880 236
447 3300047447 Ga0495685_004561 Ga0495685_004561_3290_4000 236
448 3300047447 Ga0495685_006881 Ga0495685_006881_719_1441 236
449 3300047447 Ga0495685_010378 Ga0495685_010378_1761_2471 236
450 3300047447 Ga0495685_026495 Ga0495685_026495_714_1460 236
451 3300047470 Ga0495681_0002006 Ga0495681_0002006_7267_7977 236
452 3300047471 Ga0495684_0057721 Ga0495684_0057721_416_1135 236
453 3300047472 Ga0495686_0056822 Ga0495686_0056822_1244_1954 236
454 3300047673 Ga0495593_0001957 Ga0495593_0001957_1218_1928 236
455 3300047673 Ga0495593_0061513 Ga0495593_0061513_982_1698 236
456 3300048088 Ga0495602_0434006 Ga0495602_0434006_22_750 236
457 3300048089 Ga0495614_0000354 Ga0495614_0000354_2514_3230 236
458 3300048089 Ga0495614_0024809 Ga0495614_0024809_589_1317 236
459 3300048089 Ga0495614_0029651 Ga0495614_0029651_898_1608 236
460 3300048090 Ga0495615_0044638 Ga0495615_0044638_243_953 236
461 3300048903 Ga0496100_0200654 Ga0496100_0200654_546_1256 236
462 3300048907 Ga0496104_0124792 Ga0496104_0124792_1397_2143 236
463 3300048909 Ga0496106_0069971 Ga0496106_0069971_606_1322 236
464 3300048911 Ga0496108_0064074 Ga0496108_0064074_1981_2691 236
465 3300048911 Ga0496108_0662800 Ga0496108_0662800_94_840 236
466 3300048912 Ga0496109_0039738 Ga0496109_0039738_1420_2130 236
467 3300048913 Ga0496110_0493489 Ga0496110_0493489_129_842 236
468 3300048917 Ga0496114_0482880 Ga0496114_0482880_44_790 236
469 3300049161 Ga0501305_037715 Ga0501305_037715_11_721 236
470 3300049459 Ga0495678_041221 Ga0495678_041221_682_1419 236
471 3300049527 Ga0501311_019811 Ga0501311_019811_44_754 236
472 3300049534 Ga0501318_006202 Ga0501318_006202_356_1066 236
473 3300049536 Ga0501320_015844 Ga0501320_015844_78_797 236
474 3300049568 Ga0501031_0119548 Ga0501031_0119548_211_960 236
475 3300049569 Ga0501032_0024997 Ga0501032_0024997_927_1676 236
476 3300049570 Ga0501033_0002047 Ga0501033_0002047_10650_11360 236
477 3300049571 Ga0501034_0106643 Ga0501034_0106643_1906_2655 236
478 3300049572 Ga0501036_0401413 Ga0501036_0401413_196_906 236
479 3300049573 Ga0501037_0312845 Ga0501037_0312845_210_920 236
480 3300049574 Ga0501038_0030890 Ga0501038_0030890_3213_3923 236
481 3300049574 Ga0501038_0063916 Ga0501038_0063916_1645_2394 236
482 3300049578 Ga0501042_0020658 Ga0501042_0020658_1655_2404 236
483 3300049580 Ga0501046_0011869 Ga0501046_0011869_870_1619 236
484 3300049580 Ga0501046_0092689 Ga0501046_0092689_215_964 236
485 3300049581 Ga0501047_0029655 Ga0501047_0029655_1741_2490 236
486 3300049581 Ga0501047_0157583 Ga0501047_0157583_609_1319 236
487 3300049669 Ga0501235_026022 Ga0501235_026022_538_1254 236
488 3300049742 Ga0501080_0081292 Ga0501080_0081292_1652_2362 236
489 3300049822 Ga0501035_0100411 Ga0501035_0100411_914_1663 236
490 3300049822 Ga0501035_0102594 Ga0501035_0102594_1349_2059 236
491 3300049823 Ga0501044_0002714 Ga0501044_0002714_10628_11338 236
492 3300049823 Ga0501044_0016489 Ga0501044_0016489_274_984 236
493 3300049823 Ga0501044_0027946 Ga0501044_0027946_178_927 236
494 3300049823 Ga0501044_0059581 Ga0501044_0059581_1908_2657 236
495 3300049824 Ga0501045_0411729 Ga0501045_0411729_244_954 236
496 3300050490 nmdc:mga03n38_191080_c1 nmdc:mga03n38_191080_c1_123_833 236
497 3300050494 nmdc:mga06z11_36250_c1 nmdc:mga06z11_36250_c1_504_1217 236
498 3300053085 Ga0495619_0063615 Ga0495619_0063615_1196_1906 236
499 3300053095 Ga0500640_069222 Ga0500640_069222_728_1438 236
500 3300053107 Ga0500560_002617 Ga0500560_002617_1673_2383 236
501 3300053149 Ga0500600_0128929 Ga0500600_0128929_209_952 236
502 3300053177 Ga0500636_0254918 Ga0500636_0254918_83_793 236
503 3300061719 Ga0466962_0000217 Ga0466962_0000217_10527_11237 236
504 3300061719 Ga0466962_0007099 Ga0466962_0007099_4378_5088 236
505 3300061719 Ga0466962_0176798 Ga0466962_0176798_210_920 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

62

232

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9828 10 212
7lhs-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9813 10 213
7lhu-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9784 10 213
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9766 10 213
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9626 10 213
ID Description Score Start End Superfamily
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9653 11 234 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9172 11 234 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9122 12 206 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8804 13 223 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8641 18 233 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7K2LX36-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 1.002 10 207 GO:0004604
GO:0005737
GO:0019379
AF-A0A6B3GXH0-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 1.002 10 177 GO:0004604
GO:0005737
GO:0019379
AF-A0A7Y5XDX2-F1-model_v4 deleted 0.9904 11 102
AF-A0A1C4TK60-F1-model_v4 Phosphoadenosine phosphosulfate reductase 0.9875 11 102 GO:0004604
GO:0005737
GO:0019379
AF-A0A2Z5QS77-F1-model_v4 deleted 0.9839 11 151

Feature Viewer

pLDDT pTM Quality
90.51 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map