metagRoot

F456402

General Info

Members	Datasets	Scaffolds	Average Seq Length
505	269	475	322

Family's Representative Sequence

Representative Sequence	3300045976\|Ga0466967_0020445\|Ga0466967_0020445_1487_2521
Length	314
Sequence	MLSTFRKSWRTETTLTLVAYAVPEPGWRLVGPAFAATPEGKGVAVTGSYGASGDQSRKVESGTPADIVNFSVEPDITRLVKAGKVADDWNADATKGIPFGSVVTLVVRPGNPKGIKDWDDLLKPGVEVVTPNPLSSGSAKWNLLAPYAAKSNGGQNQQAGLDYLNQLLTNEHLKVRPESGRAATDVFLQGSGDVLIAYENEAINAKKTHPDIEWVTPAQTFKIENPVAVIKGGPNEEKATALKNFLYTQEGQRAWAQGGFRPVDPAVLAEFKDQFPAPQKLWTIADLGGWKDVDPKLFDKTNGLISKIYTKATG

Samples

	Sample ID	Description	Type	Environment
1	2565956761	Rhodococcus qingshengii BKS 20-40	Isolate	Rhizosphere
2	2643221624	Phycicoccus sp. Root101	Isolate	Unclassified
3	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
4	2643221711	Terrabacter sp. Root85	Isolate	Unclassified
5	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
6	2738541308	Rhodococcus sp. OK551	Isolate	Unclassified
7	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
8	2738543005	Rhodococcus sp. OK519	Isolate	Unclassified
9	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
10	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
11	2738543034	Rhodococcus sp. OK269	Isolate	Unclassified
12	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
13	2818991469	Terrabacter lapilli 3265	Isolate	Rhizosphere
14	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
15	2889300758	Rhodococcus sp. PvR099	Isolate	Rhizosphere
16	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
17	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
18	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
19	2904535858	Rhodococcus erythropolis 2017	Isolate	Unclassified
20	2904765812	Rhodococcus fascians 1590	Isolate	Rhizosphere
21	2904770941	Rhodococcus fascians 1339	Isolate	Rhizosphere
22	2908811453	Rhodococcus sp. 1R11	Isolate	Unclassified
23	2919420072	Rhodococcus fascians 3241	Isolate	Rhizosphere
24	2919432681	Rhodococcus sp. 3258	Isolate	Rhizosphere
25	2922554459	Rhodococcus sp. 66b	Isolate	Unclassified
26	2928142448	Prescottella equi DPS 2018	Isolate	Unclassified
27	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
28	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
29	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
30	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
31	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
32	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
33	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
34	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
35	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
36	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
37	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
38	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
39	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
40	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
41	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
42	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
43	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
44	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
45	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
46	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
47	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
48	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
49	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
50	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
51	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
52	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
53	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
54	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
55	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
56	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
57	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
58	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
59	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
60	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
61	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
62	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
63	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
64	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
65	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
66	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
67	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
68	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
69	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
70	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
71	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
72	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
73	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
74	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
75	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
76	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
77	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
78	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
79	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
80	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
81	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
82	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
83	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
84	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
85	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
86	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
87	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
88	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
91	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
92	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
93	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
94	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
95	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
96	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
97	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
98	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
99	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
100	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
101	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
102	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
103	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
104	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
105	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
106	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
107	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
108	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
109	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
110	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
111	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
112	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
113	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
114	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
163	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
164	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
165	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
166	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
167	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
168	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
169	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
170	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
171	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
172	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
173	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
174	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
175	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
176	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
177	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
178	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
179	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
180	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
181	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
182	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
183	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
184	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
185	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
186	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
187	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
188	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
189	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
190	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
191	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
192	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
193	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
194	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
195	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
196	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
197	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
198	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
199	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
200	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
201	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
202	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
203	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
204	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
205	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
206	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
207	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
208	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
209	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
210	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
211	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
212	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
213	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
214	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
215	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
216	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
217	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
218	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
219	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
220	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
221	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
222	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
223	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
224	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
225	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
226	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
227	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
228	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
229	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
230	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
231	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
232	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
233	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
234	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
237	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
243	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
246	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
247	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
252	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
253	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
254	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
255	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
256	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
257	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
258	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
259	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
260	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
261	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
262	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
263	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
264	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
265	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
266	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
267	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
268	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
269	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.06
Metatranscriptomes	0
Isolates	5.94

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	13.86
Nodule	0.2
Rhizoplane	11.88
Rhizosphere	62.38
Stem	0
Stem Tuber	0
Unclassified	11.68

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24743J22301_10001249	3300001991	Bacteria	3455
2	JGI24744J21845_10000059	3300002077	Bacteria	13116
3	JGI24744J21845_10012749	3300002077	Bacteria	1700
4	JGI24742J22300_10000880	3300002244	Bacteria	4607
5	Ga0055540_1000146	3300003792	Bacteria	71380
6	Ga0055540_1000923	3300003792	Bacteria	19186
7	Ga0055540_1001367	3300003792	Bacteria	14609
8	Ga0055540_1007241	3300003792	Bacteria	4234
9	Ga0070683_100076861	3300005329	Bacteria	3122
10	Ga0068869_100008662	3300005334	Bacteria	6571
11	Ga0068869_100035557	3300005334	Bacteria	3531
12	Ga0070666_10006631	3300005335	Bacteria	7121
13	Ga0070682_100018744	3300005337	Bacteria	4050
14	Ga0068868_100000529	3300005338	Bacteria	25593
15	Ga0068868_100071620	3300005338	Bacteria	2764
16	Ga0070689_100003520	3300005340	Bacteria	10414
17	Ga0070689_100148594	3300005340	Bacteria	1889
18	Ga0070668_100004162	3300005347	Bacteria	10722
19	Ga0070668_100014894	3300005347	Bacteria	5813
20	Ga0070668_100020477	3300005347	Bacteria	4993
21	Ga0070669_100000918	3300005353	Bacteria	21431
22	Ga0070675_100252202	3300005354	Bacteria	1545
23	Ga0070671_100023165	3300005355	Bacteria	5078
24	Ga0070674_100001492	3300005356	Bacteria	12474
25	Ga0070674_100068734	3300005356	Bacteria	2497
26	Ga0070673_100324919	3300005364	Bacteria	1360
27	Ga0070688_100050731	3300005365	Bacteria	2586
28	Ga0070667_100000033	3300005367	Bacteria	175463
29	Ga0070667_100012195	3300005367	Bacteria	7111
30	Ga0070667_100133197	3300005367	Bacteria	2171
31	Ga0070667_100194820	3300005367	Bacteria	1796
32	Ga0070709_10136823	3300005434	Bacteria	1679
33	Ga0070709_10247883	3300005434	Bacteria	1282
34	Ga0070713_100070932	3300005436	Bacteria	2942
35	Ga0070710_10000900	3300005437	Bacteria	14236
36	Ga0070701_10002411	3300005438	Bacteria	7200
37	Ga0070711_100001095	3300005439	Bacteria	14465
38	Ga0070705_100016818	3300005440	Bacteria	3808
39	Ga0070700_100024394	3300005441	Bacteria	3551
40	Ga0070663_100024284	3300005455	Bacteria	4077
41	Ga0070663_100178257	3300005455	Bacteria	1646
42	Ga0070678_100001465	3300005456	Bacteria	12576
43	Ga0070662_100307998	3300005457	Bacteria	1288
44	Ga0068867_100020879	3300005459	Bacteria	4671
45	Ga0070685_10018535	3300005466	Bacteria	3744
46	Ga0070697_100401075	3300005536	Bacteria	1190
47	Ga0068853_100009217	3300005539	Bacteria	7952
48	Ga0068853_100144667	3300005539	Bacteria	2136
49	Ga0068853_100164420	3300005539	Bacteria	2004
50	Ga0070695_100016421	3300005545	Bacteria	4480
51	Ga0070695_100069332	3300005545	Bacteria	2304
52	Ga0070696_100147541	3300005546	Bacteria	1724
53	Ga0070696_100203896	3300005546	Bacteria	1477
54	Ga0070665_100038198	3300005548	Bacteria	4826
55	Ga0070665_100040587	3300005548	Bacteria	4678
56	Ga0070665_100409680	3300005548	Bacteria	1364
57	Ga0070704_100000706	3300005549	Bacteria	16275
58	Ga0070704_100018699	3300005549	Bacteria	4437
59	Ga0068854_100001286	3300005578	Bacteria	15104
60	Ga0068854_100194808	3300005578	Bacteria	1590
61	Ga0068856_100346173	3300005614	Bacteria	1505
62	Ga0070702_100000766	3300005615	Bacteria	12193
63	Ga0070702_100259659	3300005615	Bacteria	1182
64	Ga0068852_100208545	3300005616	Bacteria	1852
65	Ga0068852_100280543	3300005616	Bacteria	1606
66	Ga0068859_100000300	3300005617	Bacteria	49281
67	Ga0068859_100074211	3300005617	Bacteria	3440
68	Ga0068859_100329179	3300005617	Bacteria	1622
69	Ga0068864_100147127	3300005618	Bacteria	2131
70	Ga0068866_10000376	3300005718	Bacteria	21007
71	Ga0068861_100002304	3300005719	Bacteria	12399
72	Ga0068861_100078151	3300005719	Bacteria	2583
73	Ga0068863_100003284	3300005841	Bacteria	15965
74	Ga0068863_100004020	3300005841	Bacteria	14525
75	Ga0068863_100144144	3300005841	Bacteria	2278
76	Ga0068863_100341762	3300005841	Bacteria	1456
77	Ga0068858_100002465	3300005842	Bacteria	18668
78	Ga0068858_100016132	3300005842	Bacteria	7018
79	Ga0068858_100136442	3300005842	Bacteria	2302
80	Ga0068860_100000010	3300005843	Bacteria	359114
81	Ga0068860_100017648	3300005843	Bacteria	6954
82	Ga0068860_100071575	3300005843	Bacteria	3295
83	Ga0068862_100000008	3300005844	Bacteria	305510
84	Ga0068862_100002116	3300005844	Bacteria	17897
85	Ga0068862_100074422	3300005844	Bacteria	2936
86	Ga0081455_10034141	3300005937	Bacteria	4561
87	Ga0081455_10248449	3300005937	Bacteria	1303
88	Ga0075365_10012995	3300006038	Bacteria	4966
89	Ga0075365_10020072	3300006038	Bacteria	4136
90	Ga0075365_10062150	3300006038	Bacteria	2497
91	Ga0075363_100000070	3300006048	Bacteria	21051
92	Ga0075363_100000135	3300006048	Bacteria	17863
93	Ga0075363_100003827	3300006048	Bacteria	6487
94	Ga0075363_100023328	3300006048	Bacteria	3134
95	Ga0075364_10000518	3300006051	Bacteria	19574
96	Ga0075364_10004749	3300006051	Bacteria	7850
97	Ga0075364_10026516	3300006051	Bacteria	3697
98	Ga0075364_10031148	3300006051	Bacteria	3427
99	Ga0075364_10041375	3300006051	Bacteria	2992
100	Ga0075364_10147092	3300006051	Bacteria	1587
101	Ga0070716_100014551	3300006173	Bacteria	4030
102	Ga0070712_100001062	3300006175	Bacteria	16596
103	Ga0075367_10008222	3300006178	Bacteria	5393
104	Ga0075369_10000675	3300006186	Bacteria	10879
105	Ga0075369_10002547	3300006186	Bacteria	6528
106	Ga0075369_10002553	3300006186	Bacteria	6517
107	Ga0075369_10003436	3300006186	Bacteria	5770
108	Ga0075369_10053378	3300006186	Bacteria	1754
109	Ga0075370_10012149	3300006353	Bacteria	4544
110	Ga0075370_10026518	3300006353	Bacteria	3210
111	Ga0075370_10027700	3300006353	Bacteria	3146
112	Ga0075370_10039682	3300006353	Bacteria	2654
113	Ga0075370_10109048	3300006353	Bacteria	1606
114	Ga0068865_100000828	3300006881	Bacteria	17443
115	Ga0097620_100000300	3300006931	Bacteria	49281
116	Ga0097620_100074208	3300006931	Bacteria	3440
117	Ga0097620_100329156	3300006931	Bacteria	1622
118	Ga0111539_10554457	3300009094	Bacteria	1338
119	Ga0105245_10003220	3300009098	Bacteria	14625
120	Ga0105245_10138211	3300009098	Bacteria	2292
121	Ga0105247_10000019	3300009101	Bacteria	245170
122	Ga0105247_10004659	3300009101	Bacteria	8741
123	Ga0105247_10118758	3300009101	Bacteria	1711
124	Ga0114129_10085070	3300009147	Bacteria	4388
125	Ga0105243_10003249	3300009148	Bacteria	13257
126	Ga0105241_10106002	3300009174	Bacteria	2243
127	Ga0105242_10000620	3300009176	Bacteria	27832
128	Ga0105242_10201301	3300009176	Bacteria	1769
129	Ga0105248_10000188	3300009177	Bacteria	71887
130	Ga0105248_10008918	3300009177	Bacteria	11025
131	Ga0105248_10011408	3300009177	Bacteria	9794
132	Ga0105237_10004583	3300009545	Bacteria	15958
133	Ga0105237_10046154	3300009545	Bacteria	4383
134	Ga0105237_10048665	3300009545	Bacteria	4261
135	Ga0105237_10151402	3300009545	Bacteria	2316
136	Ga0105237_10331720	3300009545	Bacteria	1525
137	Ga0105249_10000019	3300009553	Bacteria	273807
138	Ga0105249_10000767	3300009553	Bacteria	28791
139	Ga0105249_10016064	3300009553	Bacteria	6635
140	Ga0105239_10007818	3300010375	Bacteria	12230
141	Ga0105239_10038939	3300010375	Bacteria	5207
142	Ga0105239_10039870	3300010375	Bacteria	5145
143	Ga0105239_10233308	3300010375	Bacteria	2065
144	Ga0157369_10060666	3300013105	Bacteria	4078
145	Ga0157369_10400806	3300013105	Bacteria	1423
146	Ga0157374_10056969	3300013296	Bacteria	3650
147	Ga0157378_10001690	3300013297	Bacteria	19860
148	Ga0157378_10121381	3300013297	Bacteria	2409
149	Ga0163162_10003614	3300013306	Bacteria	14814
150	Ga0157372_10025026	3300013307	Bacteria	6486
151	Ga0157372_10102763	3300013307	Bacteria	3265
152	Ga0157375_10003452	3300013308	Bacteria	13692
153	Ga0157375_10567344	3300013308	Bacteria	1296
154	Ga0163163_10020081	3300014325	Bacteria	6288
155	Ga0157380_10001364	3300014326	Bacteria	15911
156	Ga0157377_10021816	3300014745	Bacteria	3374
157	Ga0157379_10014997	3300014968	Bacteria	6797
158	Ga0157376_10105960	3300014969	Bacteria	2466
159	Ga0157376_10117121	3300014969	Bacteria	2355
160	Ga0163161_10004553	3300017792	Bacteria	9654
161	Ga0163161_10101349	3300017792	Bacteria	2144
162	Ga0163161_10194395	3300017792	Bacteria	1561
163	Ga0213876_10000447	3300021384	Bacteria	33381
164	Ga0213876_10030741	3300021384	Bacteria	2833
165	Ga0209673_1022247	3300025273	Bacteria	2192
166	Ga0209051_1000329	3300025303	Bacteria	71438
167	Ga0209051_1000852	3300025303	Bacteria	31125
168	Ga0209051_1001533	3300025303	Bacteria	19234
169	Ga0209051_1001769	3300025303	Bacteria	17153
170	Ga0209051_1018981	3300025303	Bacteria	3020
171	Ga0207642_10005604	3300025899	Bacteria	4110
172	Ga0207710_10000036	3300025900	Bacteria	245176
173	Ga0207710_10009692	3300025900	Bacteria	4048
174	Ga0207688_10000352	3300025901	Bacteria	21384
175	Ga0207688_10002205	3300025901	Bacteria	10494
176	Ga0207680_10003721	3300025903	Bacteria	7171
177	Ga0207647_10061520	3300025904	Bacteria	2291
178	Ga0207685_10001224	3300025905	Bacteria	5215
179	Ga0207699_10025411	3300025906	Bacteria	3251
180	Ga0207643_10168818	3300025908	Bacteria	1320
181	Ga0207671_10017537	3300025914	Bacteria	5515
182	Ga0207671_10031674	3300025914	Bacteria	3940
183	Ga0207671_10061111	3300025914	Bacteria	2795
184	Ga0207693_10001171	3300025915	Bacteria	23404
185	Ga0207693_10315808	3300025915	Bacteria	1223
186	Ga0207663_10003522	3300025916	Bacteria	7678
187	Ga0207662_10050041	3300025918	Bacteria	2481
188	Ga0207657_10349008	3300025919	Bacteria	1167
189	Ga0207681_10001678	3300025923	Bacteria	14267
190	Ga0207681_10055338	3300025923	Bacteria	2702
191	Ga0207681_10073880	3300025923	Bacteria	2387
192	Ga0207694_10247925	3300025924	Bacteria	1457
193	Ga0207650_10039599	3300025925	Bacteria	3444
194	Ga0207687_10001147	3300025927	Bacteria	18035
195	Ga0207700_10037134	3300025928	Bacteria	3525
196	Ga0207644_10014791	3300025931	Bacteria	5229
197	Ga0207644_10171542	3300025931	Bacteria	1694
198	Ga0207690_10050283	3300025932	Bacteria	2782
199	Ga0207706_10031036	3300025933	Bacteria	4763
200	Ga0207706_10064162	3300025933	Bacteria	3233
201	Ga0207686_10002598	3300025934	Bacteria	9795
202	Ga0207709_10004879	3300025935	Bacteria	7677
203	Ga0207709_10048270	3300025935	Bacteria	2593
204	Ga0207670_10006258	3300025936	Bacteria	6593
205	Ga0207669_10002110	3300025937	Bacteria	8429
206	Ga0207704_10000377	3300025938	Bacteria	20506
207	Ga0207665_10014082	3300025939	Bacteria	5262
208	Ga0207665_10021119	3300025939	Bacteria	4279
209	Ga0207711_10000168	3300025941	Bacteria	70279
210	Ga0207711_10010104	3300025941	Bacteria	7842
211	Ga0207689_10005151	3300025942	Bacteria	11745
212	Ga0207689_10017761	3300025942	Bacteria	6011
213	Ga0207661_10053725	3300025944	Bacteria	3225
214	Ga0207712_10000025	3300025961	Bacteria	274015
215	Ga0207712_10011939	3300025961	Bacteria	5540
216	Ga0207712_10202593	3300025961	Bacteria	1575
217	Ga0207668_10000179	3300025972	Bacteria	43365
218	Ga0207668_10004657	3300025972	Bacteria	8066
219	Ga0207668_10046903	3300025972	Bacteria	2955
220	Ga0207668_10140336	3300025972	Bacteria	1857
221	Ga0207640_10004643	3300025981	Bacteria	7457
222	Ga0207658_10000125	3300025986	Bacteria	83488
223	Ga0207658_10324578	3300025986	Bacteria	1333
224	Ga0207677_10018719	3300026023	Bacteria	4161
225	Ga0207703_10009197	3300026035	Bacteria	7770
226	Ga0207703_10017312	3300026035	Bacteria	5626
227	Ga0207703_10154008	3300026035	Bacteria	2007
228	Ga0207639_10022180	3300026041	Bacteria	4571
229	Ga0207678_10003778	3300026067	Bacteria	13614
230	Ga0207678_10024837	3300026067	Bacteria	5232
231	Ga0207678_10081078	3300026067	Bacteria	2777
232	Ga0207678_10325289	3300026067	Bacteria	1323
233	Ga0207708_10001592	3300026075	Bacteria	16942
234	Ga0207708_10176756	3300026075	Bacteria	1693
235	Ga0207641_10008728	3300026088	Bacteria	8371
236	Ga0207641_10017141	3300026088	Bacteria	5926
237	Ga0207641_10152883	3300026088	Bacteria	2091
238	Ga0207648_10001355	3300026089	Bacteria	27091
239	Ga0207648_10012935	3300026089	Bacteria	7793
240	Ga0207676_10117837	3300026095	Bacteria	2234
241	Ga0207675_100006054	3300026118	Bacteria	11511
242	Ga0207675_100067689	3300026118	Bacteria	3338
243	Ga0207675_100111816	3300026118	Bacteria	2577
244	Ga0207683_10000201	3300026121	Bacteria	51559
245	Ga0207683_10095086	3300026121	Bacteria	2656
246	Ga0268266_10028699	3300028379	Bacteria	4729
247	Ga0268266_10047322	3300028379	Bacteria	3684
248	Ga0268265_10000007	3300028380	Bacteria	431817
249	Ga0268264_10000007	3300028381	Bacteria	815790
250	Ga0268264_10007123	3300028381	Bacteria	9372
251	Ga0265327_10000067	3300031251	Bacteria	221289
252	Ga0265327_10000177	3300031251	Bacteria	136559
253	Ga0265327_10006151	3300031251	Bacteria	9710
254	Ga0307410_10038027	3300031852	Bacteria	3149
255	Ga0307410_10100648	3300031852	Bacteria	2071
256	Ga0307409_100094206	3300031995	Bacteria	2463
257	Ga0307409_100097833	3300031995	Bacteria	2425
258	Ga0373940_0022849	3300035088	Bacteria	1610
259	Ga0373932_0037330	3300035112	Bacteria	1384
260	Ga0316584_0037203	3300036712	Bacteria	3615
261	Ga0395900_0032645	3300037418	Bacteria	5355
262	Ga0395898_0002525	3300037466	Bacteria	21479
263	Ga0436364_0624575	3300037853	Bacteria	32024
264	Ga0436364_1107971	3300037853	Bacteria	8495
265	Ga0395901_0006572	3300038443	Bacteria	11751
266	Ga0436365_0131906	3300039437	Bacteria	14713
267	Ga0436365_1083994	3300039437	Bacteria	225582
268	Ga0436365_1548911	3300039437	Bacteria	4367
269	Ga0436363_0648986	3300039450	Bacteria	4086
270	Ga0436363_0820803	3300039450	Bacteria	1570
271	Ga0439466_0007335	3300041411	Bacteria	4177
272	Ga0439465_0003742	3300041413	Bacteria	4960
273	Ga0439465_0004484	3300041413	Bacteria	4514
274	Ga0439465_0005072	3300041413	Bacteria	4225
275	Ga0439431_0010308	3300041997	Bacteria	2120
276	Ga0439442_006242	3300042002	Bacteria	2391
277	Ga0439442_016501	3300042002	Bacteria	1523
278	Ga0439434_0020177	3300042435	Bacteria	2000
279	Ga0466972_0014005	3300044658	Bacteria	4021
280	Ga0466972_0031277	3300044658	Bacteria	2618
281	Ga0466972_0081628	3300044658	Bacteria	1539
282	Ga0466965_0002411	3300044683	Bacteria	7934
283	Ga0466965_0008518	3300044683	Bacteria	4743
284	Ga0466965_0013289	3300044683	Bacteria	3883
285	Ga0466963_0030087	3300044694	Bacteria	3501
286	Ga0466963_0042555	3300044694	Bacteria	2983
287	Ga0466964_0044318	3300044706	Bacteria	1807
288	Ga0466971_0004692	3300044719	Bacteria	5907
289	Ga0466971_0041698	3300044719	Bacteria	2062
290	Ga0466968_0002360	3300044735	Bacteria	6899
291	Ga0466968_0064056	3300044735	Bacteria	1590
292	Ga0466957_0005335	3300044842	Bacteria	7211
293	Ga0466957_0006786	3300044842	Bacteria	6470
294	Ga0466957_0054859	3300044842	Bacteria	2434
295	Ga0466960_0000288	3300044901	Bacteria	17571
296	Ga0466960_0034871	3300044901	Bacteria	2347
297	Ga0466959_0151998	3300045049	Bacteria	1631
298	Ga0466967_0000756	3300045976	Bacteria	16684
299	Ga0466967_0020445	3300045976	Bacteria	5352
300	Ga0495638_0004906	3300046460	Bacteria	10053
301	Ga0495638_0018417	3300046460	Bacteria	4637
302	Ga0495583_0078997	3300046506	Bacteria	1432
303	Ga0495606_0099544	3300046507	Bacteria	1772
304	Ga0495648_0001568	3300046524	Bacteria	22301
305	Ga0495654_0018727	3300046530	Bacteria	3625
306	Ga0495665_0003128	3300046531	Bacteria	8951
307	Ga0495640_0048964	3300046533	Bacteria	2917
308	Ga0495668_0000043	3300046616	Bacteria	227636
309	Ga0495611_0027130	3300046648	Bacteria	2502
310	Ga0495588_0047459	3300046674	Bacteria	2205
311	Ga0495649_0066324	3300046694	Bacteria	1937
312	Ga0495581_0039596	3300047315	Bacteria	2729
313	Ga0495674_0114453	3300047319	Bacteria	2284
314	Ga0495672_0001682	3300047320	Bacteria	21419
315	Ga0495672_0063951	3300047320	Bacteria	2109
316	Ga0495672_0168067	3300047320	Bacteria	1121
317	Ga0495676_0067175	3300047321	Bacteria	2775
318	Ga0495673_0000243	3300047469	Bacteria	77026
319	Ga0495686_0001356	3300047472	Bacteria	27343
320	Ga0495593_0052832	3300047673	Bacteria	2146
321	Ga0495626_0035122	3300048091	Bacteria	2394
322	Ga0496100_0000031	3300048903	Bacteria	102180
323	Ga0496100_0003029	3300048903	Bacteria	8666
324	Ga0496100_0033877	3300048903	Bacteria	3199
325	Ga0496100_0068762	3300048903	Bacteria	2356
326	Ga0496101_0000030	3300048904	Bacteria	198447
327	Ga0496101_0001322	3300048904	Bacteria	14833
328	Ga0496101_0007814	3300048904	Bacteria	6954
329	Ga0496101_0083887	3300048904	Bacteria	2359
330	Ga0496101_0320780	3300048904	Bacteria	1215
331	Ga0496102_0000001	3300048905	Bacteria	873433
332	Ga0496102_0000789	3300048905	Bacteria	30791
333	Ga0496102_0005166	3300048905	Bacteria	11075
334	Ga0496102_0006783	3300048905	Bacteria	9772
335	Ga0496102_0029717	3300048905	Bacteria	4890
336	Ga0496102_0033864	3300048905	Bacteria	4593
337	Ga0496102_0035633	3300048905	Bacteria	4480
338	Ga0496102_0035788	3300048905	Bacteria	4471
339	Ga0496102_0164100	3300048905	Bacteria	2090
340	Ga0496103_0000003	3300048906	Bacteria	603967
341	Ga0496103_0000409	3300048906	Bacteria	38113
342	Ga0496103_0000587	3300048906	Bacteria	28725
343	Ga0496103_0013346	3300048906	Bacteria	4869
344	Ga0496103_0117257	3300048906	Bacteria	1694
345	Ga0496104_0004851	3300048907	Bacteria	11720
346	Ga0496104_0006131	3300048907	Bacteria	10552
347	Ga0496104_0066882	3300048907	Bacteria	3413
348	Ga0496104_0164551	3300048907	Bacteria	2127
349	Ga0496105_0002866	3300048908	Bacteria	12633
350	Ga0496105_0218897	3300048908	Bacteria	1550
351	Ga0496106_0000271	3300048909	Bacteria	36697
352	Ga0496106_0006135	3300048909	Bacteria	8888
353	Ga0496106_0007995	3300048909	Bacteria	7814
354	Ga0496106_0265214	3300048909	Bacteria	1375
355	Ga0496107_0000321	3300048910	Bacteria	25887
356	Ga0496107_0002497	3300048910	Bacteria	11958
357	Ga0496107_0003060	3300048910	Bacteria	11094
358	Ga0496107_0141270	3300048910	Bacteria	1780
359	Ga0496107_0194851	3300048910	Bacteria	1506
360	Ga0496108_0000204	3300048911	Bacteria	54715
361	Ga0496108_0025544	3300048911	Bacteria	4868
362	Ga0496108_0066936	3300048911	Bacteria	3029
363	Ga0496108_0114021	3300048911	Bacteria	2314
364	Ga0496109_0000197	3300048912	Bacteria	59860
365	Ga0496109_0021272	3300048912	Bacteria	5735
366	Ga0496109_0044633	3300048912	Bacteria	4021
367	Ga0496110_0023547	3300048913	Bacteria	5239
368	Ga0496110_0034178	3300048913	Bacteria	4403
369	Ga0496110_0101275	3300048913	Bacteria	2582
370	Ga0496110_0340481	3300048913	Bacteria	1366
371	Ga0496112_0004284	3300048915	Bacteria	12045
372	Ga0496112_0017041	3300048915	Bacteria	6821
373	Ga0496112_0017777	3300048915	Bacteria	6692
374	Ga0496112_0151935	3300048915	Bacteria	2282
375	Ga0496113_0068803	3300048916	Bacteria	2687
376	Ga0496113_0353563	3300048916	Bacteria	1179
377	Ga0496114_0000495	3300048917	Bacteria	28787
378	Ga0496114_0014853	3300048917	Bacteria	6258
379	Ga0496114_0137362	3300048917	Bacteria	2114
380	Ga0496114_0145063	3300048917	Bacteria	2057
381	Ga0496115_0026326	3300048918	Bacteria	4539
382	Ga0496116_0000013	3300048919	Bacteria	603993
383	Ga0496116_0001948	3300048919	Bacteria	22243
384	Ga0496117_0000013	3300048920	Bacteria	603995
385	Ga0496117_0000564	3300048920	Bacteria	60818
386	Ga0496117_0034947	3300048920	Bacteria	3780
387	Ga0496117_0044819	3300048920	Bacteria	3201
388	Ga0496117_0055071	3300048920	Bacteria	2782
389	Ga0496118_0000011	3300048921	Bacteria	603995
390	Ga0496118_0000279	3300048921	Bacteria	89978
391	Ga0496118_0000395	3300048921	Bacteria	73903
392	Ga0496118_0007765	3300048921	Bacteria	11262
393	Ga0496118_0013774	3300048921	Bacteria	7621
394	Ga0496119_0002469	3300048922	Bacteria	20282
395	Ga0496119_0003048	3300048922	Bacteria	17729
396	Ga0496119_0012477	3300048922	Bacteria	6895
397	Ga0496120_0021025	3300048923	Bacteria	4130
398	Ga0496120_0064561	3300048923	Bacteria	2032
399	Ga0496121_0000027	3300048924	Bacteria	444747
400	Ga0496121_0000236	3300048924	Bacteria	118932
401	Ga0496122_0000335	3300048925	Bacteria	102197
402	Ga0496122_0017414	3300048925	Bacteria	6719
403	Ga0496123_0021456	3300048926	Bacteria	5019
404	Ga0496124_0000016	3300048927	Bacteria	444747
405	Ga0496125_0000008	3300048928	Bacteria	704677
406	Ga0496126_0000025	3300048929	Bacteria	444747
407	Ga0496126_0000120	3300048929	Bacteria	183747
408	Ga0496126_0002515	3300048929	Bacteria	24558
409	Ga0496126_0002966	3300048929	Bacteria	22050
410	Ga0496126_0005126	3300048929	Bacteria	15173
411	Ga0496126_0006067	3300048929	Bacteria	13562
412	Ga0496126_0160303	3300048929	Bacteria	1923
413	Ga0501032_0002928	3300049569	Bacteria	13276
414	Ga0501032_0004486	3300049569	Bacteria	10512
415	Ga0501033_0013882	3300049570	Bacteria	6128
416	Ga0501034_0001356	3300049571	Bacteria	33085
417	Ga0501034_0003572	3300049571	Bacteria	17659
418	Ga0501036_0087138	3300049572	Bacteria	2639
419	Ga0501037_0000220	3300049573	Bacteria	49798
420	Ga0501037_0002983	3300049573	Bacteria	12288
421	Ga0501038_0000980	3300049574	Bacteria	25615
422	Ga0501039_0001608	3300049575	Bacteria	16643
423	Ga0501043_0008835	3300049579	Bacteria	7928
424	Ga0501046_0000978	3300049580	Bacteria	28003
425	Ga0501047_0000570	3300049581	Bacteria	39370
426	Ga0501048_0004826	3300049582	Bacteria	10279
427	Ga0501069_0029768	3300049585	Bacteria	2998
428	Ga0501070_0006577	3300049586	Bacteria	9892
429	Ga0501070_0025412	3300049586	Bacteria	4967
430	Ga0501073_0008348	3300049589	Bacteria	7682
431	Ga0501080_0036692	3300049742	Bacteria	4576
432	Ga0501035_0003000	3300049822	Bacteria	16206
433	Ga0501044_0001306	3300049823	Bacteria	29376
434	Ga0501044_0045049	3300049823	Bacteria	4574
435	nmdc:mga03683_12171_c1	3300050489	Bacteria	3135
436	nmdc:mga03n38_137_c1	3300050490	Bacteria	15906
437	nmdc:mga03n38_15187_c1	3300050490	Bacteria	2968
438	nmdc:mga03n38_1573_c1	3300050490	Bacteria	6629
439	nmdc:mga03n38_1744_c1	3300050490	Bacteria	6429
440	nmdc:mga03n38_21518_c1	3300050490	Bacteria	2597
441	nmdc:mga03n38_24072_c1	3300050490	Bacteria	2486
442	nmdc:mga03n38_51046_c1	3300050490	Bacteria	1845
443	nmdc:mga00v17_2061_c1	3300050491	Bacteria	10357
444	nmdc:mga00v17_237199_c1	3300050491	Bacteria	1182
445	nmdc:mga00v17_24968_c1	3300050491	Bacteria	3469
446	nmdc:mga00v17_3413_c1	3300050491	Bacteria	8209
447	nmdc:mga00v17_42198_c1	3300050491	Bacteria	2742
448	nmdc:mga00v17_58665_c1	3300050491	Bacteria	2359
449	nmdc:mga00v17_8868_c1	3300050491	Bacteria	5423
450	nmdc:mga0yw44_10405_c1	3300050492	Bacteria	4751
451	nmdc:mga0yw44_40062_c1	3300050492	Bacteria	2781
452	nmdc:mga07m45_134122_c1	3300050496	Bacteria	1433
453	nmdc:mga07m45_14658_c1	3300050496	Bacteria	4180
454	nmdc:mga07m45_21878_c1	3300050496	Bacteria	3487
455	nmdc:mga07m45_393_c1	3300050496	Bacteria	18038
456	nmdc:mga07m45_56631_c1	3300050496	Bacteria	2216
457	nmdc:mga07m45_62777_c1	3300050496	Bacteria	2106
458	nmdc:mga05p37_51516_c1	3300050507	Bacteria	5062
459	nmdc:mga0qj67_32616_c1	3300050509	Bacteria	4063
460	nmdc:mga06r32_199253_c1	3300050510	Bacteria	1990
461	nmdc:mga0sz30_13589_c2	3300050516	Bacteria	2861
462	nmdc:mga0sz30_21391_c1	3300050516	Bacteria	2617
463	nmdc:mga0sz30_26480_c1	3300050516	Bacteria	2377
464	nmdc:mga0sz30_5578_c1	3300050516	Bacteria	4625
465	Ga0500635_0002917	3300053080	Bacteria	4258
466	Ga0495655_0001571	3300053083	Bacteria	3520
467	Ga0500556_0003907	3300053104	Bacteria	4310
468	Ga0500595_044626	3300053119	Bacteria	1404
469	Ga0500652_003688	3300053131	Bacteria	4667
470	Ga0500568_0050459	3300053139	Bacteria	1640
471	Ga0500616_0005620	3300053153	Bacteria	8466
472	Ga0500616_0048070	3300053153	Bacteria	2263
473	Ga0500627_0013334	3300053158	Bacteria	3113
474	Ga0500645_000175	3300053730	Bacteria	50824
475	Ga0466962_0067921	3300061719	Bacteria	1702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042002	Ga0439442_016501	Ga0439442_016501_36_1073	298
2	3300021384	Ga0213876_10030741	Ga0213876_100307412	304
3	3300046616	Ga0495668_0000043	Ga0495668_0000043_135457_136446	304
4	3300050490	nmdc:mga03n38_51046_c1	nmdc:mga03n38_51046_c1_210_1199	304
5	3300006038	Ga0075365_10020072	Ga0075365_100200724	305
6	3300006051	Ga0075364_10031148	Ga0075364_100311485	305
7	3300006178	Ga0075367_10008222	Ga0075367_100082226	305
8	3300050489	nmdc:mga03683_12171_c1	nmdc:mga03683_12171_c1_1050_2078	305
9	3300050490	nmdc:mga03n38_21518_c1	nmdc:mga03n38_21518_c1_1477_2505	305
10	3300050492	nmdc:mga0yw44_40062_c1	nmdc:mga0yw44_40062_c1_624_1616	305
11	3300050496	nmdc:mga07m45_21878_c1	nmdc:mga07m45_21878_c1_1776_2804	305
12	3300036712	Ga0316584_0037203	Ga0316584_0037203_1093_2130	306
13	3300047320	Ga0495672_0168067	Ga0495672_0168067_99_1073	306
14	3300037418	Ga0395900_0032645	Ga0395900_0032645_4270_5310	307
15	3300037466	Ga0395898_0002525	Ga0395898_0002525_12783_13823	307
16	3300037853	Ga0436364_0624575	Ga0436364_0624575_30826_31845	307
17	3300038443	Ga0395901_0006572	Ga0395901_0006572_6799_7839	307
18	3300050490	nmdc:mga03n38_24072_c1	nmdc:mga03n38_24072_c1_898_1899	307
19	3300050491	nmdc:mga00v17_3413_c1	nmdc:mga00v17_3413_c1_4573_5574	307
20	3300050496	nmdc:mga07m45_56631_c1	nmdc:mga07m45_56631_c1_592_1593	307
21	3300050516	nmdc:mga0sz30_26480_c1	nmdc:mga0sz30_26480_c1_1167_2168	307
22	3300005329	Ga0070683_100076861	Ga0070683_1000768612	308
23	3300005578	Ga0068854_100194808	Ga0068854_1001948082	308
24	3300005616	Ga0068852_100280543	Ga0068852_1002805432	308
25	3300006048	Ga0075363_100003827	Ga0075363_1000038277	308
26	3300009545	Ga0105237_10004583	Ga0105237_100045836	308
27	3300009545	Ga0105237_10331720	Ga0105237_103317203	308
28	3300010375	Ga0105239_10038939	Ga0105239_100389395	308
29	3300025914	Ga0207671_10031674	Ga0207671_100316743	308
30	3300025931	Ga0207644_10171542	Ga0207644_101715423	308
31	3300025944	Ga0207661_10053725	Ga0207661_100537252	308
32	3300026067	Ga0207678_10024837	Ga0207678_100248373	308
33	3300041413	Ga0439465_0005072	Ga0439465_0005072_560_1591	308
34	3300044735	Ga0466968_0064056	Ga0466968_0064056_434_1432	308
35	3300048905	Ga0496102_0006783	Ga0496102_0006783_2577_3620	308
36	3300048905	Ga0496102_0035788	Ga0496102_0035788_1662_2660	308
37	3300048906	Ga0496103_0013346	Ga0496103_0013346_72_1115	308
38	3300048911	Ga0496108_0025544	Ga0496108_0025544_3589_4617	308
39	3300048915	Ga0496112_0017041	Ga0496112_0017041_5771_6799	308
40	3300048917	Ga0496114_0014853	Ga0496114_0014853_2333_3376	308
41	3300048920	Ga0496117_0055071	Ga0496117_0055071_941_1939	308
42	3300048921	Ga0496118_0013774	Ga0496118_0013774_2269_3267	308
43	3300050496	nmdc:mga07m45_14658_c1	nmdc:mga07m45_14658_c1_2959_3987	308
44	3300053083	Ga0495655_0001571	Ga0495655_0001571_1076_2104	308
45	3300005356	Ga0070674_100068734	Ga0070674_1000687342	309
46	3300005548	Ga0070665_100409680	Ga0070665_1004096801	309
47	3300005842	Ga0068858_100136442	Ga0068858_1001364422	309
48	3300006038	Ga0075365_10012995	Ga0075365_100129955	309
49	3300006048	Ga0075363_100000070	Ga0075363_10000007015	309
50	3300006051	Ga0075364_10000518	Ga0075364_100005188	309
51	3300006186	Ga0075369_10000675	Ga0075369_100006758	309
52	3300009094	Ga0111539_10554457	Ga0111539_105544571	309
53	3300009098	Ga0105245_10138211	Ga0105245_101382113	309
54	3300009147	Ga0114129_10085070	Ga0114129_100850703	309
55	3300009176	Ga0105242_10201301	Ga0105242_102013011	309
56	3300009177	Ga0105248_10011408	Ga0105248_100114084	309
57	3300009553	Ga0105249_10016064	Ga0105249_100160644	309
58	3300026035	Ga0207703_10154008	Ga0207703_101540082	309
59	3300026067	Ga0207678_10325289	Ga0207678_103252891	309
60	3300031852	Ga0307410_10038027	Ga0307410_100380273	309
61	3300031995	Ga0307409_100094206	Ga0307409_1000942062	309
62	3300045976	Ga0466967_0000756	Ga0466967_0000756_3520_4551	309
63	3300046533	Ga0495640_0048964	Ga0495640_0048964_24_1052	309
64	3300047315	Ga0495581_0039596	Ga0495581_0039596_1276_2304	309
65	3300047319	Ga0495674_0114453	Ga0495674_0114453_441_1469	309
66	3300047320	Ga0495672_0063951	Ga0495672_0063951_887_1915	309
67	3300047321	Ga0495676_0067175	Ga0495676_0067175_441_1469	309
68	3300047673	Ga0495593_0052832	Ga0495593_0052832_1108_2136	309
69	3300048903	Ga0496100_0003029	Ga0496100_0003029_6621_7652	309
70	3300048904	Ga0496101_0001322	Ga0496101_0001322_6606_7637	309
71	3300048907	Ga0496104_0004851	Ga0496104_0004851_3016_4047	309
72	3300048908	Ga0496105_0002866	Ga0496105_0002866_2062_3093	309
73	3300048909	Ga0496106_0007995	Ga0496106_0007995_12_1043	309
74	3300048910	Ga0496107_0003060	Ga0496107_0003060_2480_3511	309
75	3300048917	Ga0496114_0145063	Ga0496114_0145063_299_1330	309
76	3300048918	Ga0496115_0026326	Ga0496115_0026326_902_1933	309
77	3300050490	nmdc:mga03n38_15187_c1	nmdc:mga03n38_15187_c1_1499_2527	309
78	3300050490	nmdc:mga03n38_1573_c1	nmdc:mga03n38_1573_c1_2726_3757	309
79	3300050492	nmdc:mga0yw44_10405_c1	nmdc:mga0yw44_10405_c1_2909_3940	309
80	3300050507	nmdc:mga05p37_51516_c1	nmdc:mga05p37_51516_c1_2684_3712	309
81	3300050509	nmdc:mga0qj67_32616_c1	nmdc:mga0qj67_32616_c1_2161_3189	309
82	3300050510	nmdc:mga06r32_199253_c1	nmdc:mga06r32_199253_c1_579_1607	309
83	3300050516	nmdc:mga0sz30_5578_c1	nmdc:mga0sz30_5578_c1_1143_2171	309
84	3300002077	JGI24744J21845_10000059	JGI24744J21845_100000599	310
85	3300002244	JGI24742J22300_10000880	JGI24742J22300_100008802	310
86	3300005334	Ga0068869_100008662	Ga0068869_1000086623	310
87	3300005335	Ga0070666_10006631	Ga0070666_100066314	310
88	3300005337	Ga0070682_100018744	Ga0070682_1000187443	310
89	3300005338	Ga0068868_100000529	Ga0068868_1000005295	310
90	3300005340	Ga0070689_100003520	Ga0070689_1000035208	310
91	3300005347	Ga0070668_100014894	Ga0070668_1000148945	310
92	3300005355	Ga0070671_100023165	Ga0070671_1000231654	310
93	3300005356	Ga0070674_100001492	Ga0070674_1000014924	310
94	3300005365	Ga0070688_100050731	Ga0070688_1000507311	310
95	3300005367	Ga0070667_100012195	Ga0070667_1000121955	310
96	3300005367	Ga0070667_100133197	Ga0070667_1001331973	310
97	3300005367	Ga0070667_100194820	Ga0070667_1001948202	310
98	3300005434	Ga0070709_10136823	Ga0070709_101368232	310
99	3300005437	Ga0070710_10000900	Ga0070710_100009003	310
100	3300005438	Ga0070701_10002411	Ga0070701_100024117	310
101	3300005439	Ga0070711_100001095	Ga0070711_10000109511	310
102	3300005440	Ga0070705_100016818	Ga0070705_1000168183	310
103	3300005441	Ga0070700_100024394	Ga0070700_1000243941	310
104	3300005455	Ga0070663_100024284	Ga0070663_1000242843	310
105	3300005456	Ga0070678_100001465	Ga0070678_1000014657	310
106	3300005459	Ga0068867_100020879	Ga0068867_1000208793	310
107	3300005466	Ga0070685_10018535	Ga0070685_100185354	310
108	3300005539	Ga0068853_100009217	Ga0068853_1000092173	310
109	3300005545	Ga0070695_100016421	Ga0070695_1000164213	310
110	3300005546	Ga0070696_100147541	Ga0070696_1001475412	310
111	3300005548	Ga0070665_100040587	Ga0070665_1000405873	310
112	3300005549	Ga0070704_100000706	Ga0070704_10000070611	310
113	3300005578	Ga0068854_100001286	Ga0068854_1000012869	310
114	3300005615	Ga0070702_100000766	Ga0070702_1000007665	310
115	3300005615	Ga0070702_100259659	Ga0070702_1002596591	310
116	3300005718	Ga0068866_10000376	Ga0068866_1000037611	310
117	3300005719	Ga0068861_100002304	Ga0068861_1000023048	310
118	3300005841	Ga0068863_100004020	Ga0068863_1000040204	310
119	3300005842	Ga0068858_100002465	Ga0068858_10000246510	310
120	3300005843	Ga0068860_100017648	Ga0068860_1000176484	310
121	3300005843	Ga0068860_100071575	Ga0068860_1000715756	310
122	3300005844	Ga0068862_100002116	Ga0068862_10000211610	310
123	3300006051	Ga0075364_10041375	Ga0075364_100413753	310
124	3300006173	Ga0070716_100014551	Ga0070716_1000145514	310
125	3300006175	Ga0070712_100001062	Ga0070712_1000010627	310
126	3300006353	Ga0075370_10027700	Ga0075370_100277002	310
127	3300006353	Ga0075370_10109048	Ga0075370_101090482	310
128	3300006881	Ga0068865_100000828	Ga0068865_10000082811	310
129	3300009098	Ga0105245_10003220	Ga0105245_1000322013	310
130	3300009101	Ga0105247_10004659	Ga0105247_100046591	310
131	3300009148	Ga0105243_10003249	Ga0105243_100032496	310
132	3300009176	Ga0105242_10000620	Ga0105242_1000062022	310
133	3300009177	Ga0105248_10008918	Ga0105248_1000891811	310
134	3300009545	Ga0105237_10048665	Ga0105237_100486653	310
135	3300009553	Ga0105249_10000767	Ga0105249_1000076726	310
136	3300010375	Ga0105239_10007818	Ga0105239_1000781812	310
137	3300013297	Ga0157378_10001690	Ga0157378_100016907	310
138	3300013306	Ga0163162_10003614	Ga0163162_1000361410	310
139	3300013307	Ga0157372_10025026	Ga0157372_100250262	310
140	3300013308	Ga0157375_10003452	Ga0157375_100034524	310
141	3300014326	Ga0157380_10001364	Ga0157380_1000136411	310
142	3300014968	Ga0157379_10014997	Ga0157379_100149974	310
143	3300014969	Ga0157376_10105960	Ga0157376_101059601	310
144	3300017792	Ga0163161_10004553	Ga0163161_100045534	310
145	3300017792	Ga0163161_10101349	Ga0163161_101013492	310
146	3300025899	Ga0207642_10005604	Ga0207642_100056045	310
147	3300025900	Ga0207710_10009692	Ga0207710_100096921	310
148	3300025901	Ga0207688_10000352	Ga0207688_100003527	310
149	3300025903	Ga0207680_10003721	Ga0207680_100037214	310
150	3300025904	Ga0207647_10061520	Ga0207647_100615201	310
151	3300025906	Ga0207699_10025411	Ga0207699_100254114	310
152	3300025914	Ga0207671_10061111	Ga0207671_100611112	310
153	3300025915	Ga0207693_10001171	Ga0207693_1000117116	310
154	3300025916	Ga0207663_10003522	Ga0207663_100035225	310
155	3300025918	Ga0207662_10050041	Ga0207662_100500412	310
156	3300025919	Ga0207657_10349008	Ga0207657_103490082	310
157	3300025923	Ga0207681_10055338	Ga0207681_100553384	310
158	3300025925	Ga0207650_10039599	Ga0207650_100395993	310
159	3300025927	Ga0207687_10001147	Ga0207687_100011478	310
160	3300025931	Ga0207644_10014791	Ga0207644_100147914	310
161	3300025932	Ga0207690_10050283	Ga0207690_100502831	310
162	3300025933	Ga0207706_10031036	Ga0207706_100310366	310
163	3300025934	Ga0207686_10002598	Ga0207686_100025984	310
164	3300025935	Ga0207709_10004879	Ga0207709_100048794	310
165	3300025936	Ga0207670_10006258	Ga0207670_100062584	310
166	3300025937	Ga0207669_10002110	Ga0207669_100021104	310
167	3300025938	Ga0207704_10000377	Ga0207704_100003779	310
168	3300025939	Ga0207665_10021119	Ga0207665_100211191	310
169	3300025941	Ga0207711_10010104	Ga0207711_100101044	310
170	3300025942	Ga0207689_10005151	Ga0207689_100051516	310
171	3300025961	Ga0207712_10011939	Ga0207712_100119395	310
172	3300025972	Ga0207668_10004657	Ga0207668_100046575	310
173	3300025981	Ga0207640_10004643	Ga0207640_100046434	310
174	3300025986	Ga0207658_10324578	Ga0207658_103245781	310
175	3300026023	Ga0207677_10018719	Ga0207677_100187192	310
176	3300026035	Ga0207703_10017312	Ga0207703_100173125	310
177	3300026067	Ga0207678_10003778	Ga0207678_100037787	310
178	3300026075	Ga0207708_10001592	Ga0207708_1000159210	310
179	3300026088	Ga0207641_10017141	Ga0207641_100171413	310
180	3300026089	Ga0207648_10001355	Ga0207648_1000135510	310
181	3300026118	Ga0207675_100006054	Ga0207675_1000060544	310
182	3300026121	Ga0207683_10000201	Ga0207683_1000020149	310
183	3300028379	Ga0268266_10028699	Ga0268266_100286994	310
184	3300028381	Ga0268264_10007123	Ga0268264_100071235	310
185	3300039450	Ga0436363_0648986	Ga0436363_0648986_1895_2914	310
186	3300041411	Ga0439466_0007335	Ga0439466_0007335_2391_3419	310
187	3300041413	Ga0439465_0003742	Ga0439465_0003742_419_1447	310
188	3300041997	Ga0439431_0010308	Ga0439431_0010308_601_1629	310
189	3300042002	Ga0439442_006242	Ga0439442_006242_144_1172	310
190	3300042435	Ga0439434_0020177	Ga0439434_0020177_767_1795	310
191	3300048903	Ga0496100_0068762	Ga0496100_0068762_1174_2205	310
192	3300048904	Ga0496101_0007814	Ga0496101_0007814_3407_4438	310
193	3300048904	Ga0496101_0083887	Ga0496101_0083887_1115_2146	310
194	3300048905	Ga0496102_0005166	Ga0496102_0005166_2709_3737	310
195	3300048906	Ga0496103_0117257	Ga0496103_0117257_445_1476	310
196	3300048907	Ga0496104_0006131	Ga0496104_0006131_2696_3724	310
197	3300048909	Ga0496106_0006135	Ga0496106_0006135_3678_4709	310
198	3300048910	Ga0496107_0000321	Ga0496107_0000321_4469_5500	310
199	3300048916	Ga0496113_0353563	Ga0496113_0353563_41_1069	310
200	3300048917	Ga0496114_0000495	Ga0496114_0000495_11970_13001	310
201	3300050491	nmdc:mga00v17_58665_c1	nmdc:mga00v17_58665_c1_760_1782	310
202	3300050496	nmdc:mga07m45_62777_c1	nmdc:mga07m45_62777_c1_404_1435	310
203	iso_pu_bacteria	2565956761	2566994068	310
204	iso_pu_bacteria	2643221624	2644134537	310
205	iso_pu_bacteria	2738541308	2738889634	310
206	iso_pu_bacteria	2738543005	2739203409	310
207	iso_pu_bacteria	2738543005	2739203411	310
208	iso_pu_bacteria	2744054611	2744955762	310
209	iso_pu_bacteria	2904535858	2904539837	310
210	iso_pu_bacteria	2922554459	2922560407	310
211	iso_pu_bacteria	2928142448	2928146238	310
212	3300006051	Ga0075364_10026516	Ga0075364_100265164	311
213	3300017792	Ga0163161_10194395	Ga0163161_101943951	311
214	3300046506	Ga0495583_0078997	Ga0495583_0078997_134_1174	311
215	3300046507	Ga0495606_0099544	Ga0495606_0099544_697_1737	311
216	3300046524	Ga0495648_0001568	Ga0495648_0001568_15089_16129	311
217	3300046530	Ga0495654_0018727	Ga0495654_0018727_1623_2663	311
218	3300046648	Ga0495611_0027130	Ga0495611_0027130_836_1876	311
219	3300047320	Ga0495672_0001682	Ga0495672_0001682_14053_15093	311
220	3300047469	Ga0495673_0000243	Ga0495673_0000243_45572_46612	311
221	3300048904	Ga0496101_0320780	Ga0496101_0320780_57_1085	311
222	3300048913	Ga0496110_0023547	Ga0496110_0023547_103_1131	311
223	3300050491	nmdc:mga00v17_24968_c1	nmdc:mga00v17_24968_c1_2418_3446	311
224	iso_pu_bacteria	2738543034	2739363732	311
225	iso_pu_bacteria	2818991469	2819727920	311
226	iso_pu_bacteria	2904765812	2904769519	311
227	iso_pu_bacteria	2904770941	2904773084	311
228	iso_pu_bacteria	2908811453	2908814084	311
229	iso_pu_bacteria	2919420072	2919422558	311
230	iso_pu_bacteria	2919432681	2919435189	311
231	3300009545	Ga0105237_10046154	Ga0105237_100461543	312
232	3300010375	Ga0105239_10039870	Ga0105239_100398703	312
233	3300025914	Ga0207671_10017537	Ga0207671_100175375	312
234	3300031251	Ga0265327_10000177	Ga0265327_1000017783	312
235	3300031251	Ga0265327_10006151	Ga0265327_100061515	312
236	3300044658	Ga0466972_0081628	Ga0466972_0081628_543_1481	312
237	3300045976	Ga0466967_0020445	Ga0466967_0020445_1487_2521	312
238	3300046694	Ga0495649_0066324	Ga0495649_0066324_312_1340	312
239	3300048913	Ga0496110_0340481	Ga0496110_0340481_277_1311	312
240	iso_pu_bacteria	2643221711	2644610503	312
241	3300003792	Ga0055540_1000146	Ga0055540_100014616	313
242	3300005347	Ga0070668_100020477	Ga0070668_1000204774	313
243	3300005614	Ga0068856_100346173	Ga0068856_1003461732	313
244	3300005844	Ga0068862_100074422	Ga0068862_1000744222	313
245	3300005937	Ga0081455_10034141	Ga0081455_100341414	313
246	3300006051	Ga0075364_10004749	Ga0075364_100047494	313
247	3300006186	Ga0075369_10002553	Ga0075369_100025534	313
248	3300006353	Ga0075370_10026518	Ga0075370_100265183	313
249	3300006353	Ga0075370_10039682	Ga0075370_100396822	313
250	3300013308	Ga0157375_10567344	Ga0157375_105673442	313
251	3300025303	Ga0209051_1000329	Ga0209051_100032941	313
252	3300025935	Ga0207709_10048270	Ga0207709_100482702	313
253	3300025961	Ga0207712_10202593	Ga0207712_102025932	313
254	3300025972	Ga0207668_10046903	Ga0207668_100469033	313
255	3300026118	Ga0207675_100111816	Ga0207675_1001118162	313
256	3300039437	Ga0436365_0131906	Ga0436365_0131906_10859_11974	313
257	3300044658	Ga0466972_0014005	Ga0466972_0014005_455_1483	313
258	3300044683	Ga0466965_0013289	Ga0466965_0013289_1270_2310	313
259	3300044706	Ga0466964_0044318	Ga0466964_0044318_417_1445	313
260	3300044719	Ga0466971_0041698	Ga0466971_0041698_916_1944	313
261	3300044842	Ga0466957_0054859	Ga0466957_0054859_500_1528	313
262	3300045049	Ga0466959_0151998	Ga0466959_0151998_405_1433	313
263	3300046531	Ga0495665_0003128	Ga0495665_0003128_2272_3303	313
264	3300046674	Ga0495588_0047459	Ga0495588_0047459_378_1409	313
265	3300048905	Ga0496102_0035633	Ga0496102_0035633_3207_4235	313
266	3300048912	Ga0496109_0044633	Ga0496109_0044633_1451_2479	313
267	3300048913	Ga0496110_0034178	Ga0496110_0034178_655_1683	313
268	3300048915	Ga0496112_0004284	Ga0496112_0004284_2927_3955	313
269	3300048925	Ga0496122_0017414	Ga0496122_0017414_3790_4821	313
270	3300053080	Ga0500635_0002917	Ga0500635_0002917_2910_3944	313
271	3300053131	Ga0500652_003688	Ga0500652_003688_345_1379	313
272	3300005436	Ga0070713_100070932	Ga0070713_1000709322	314
273	3300005617	Ga0068859_100329179	Ga0068859_1003291792	314
274	3300005937	Ga0081455_10248449	Ga0081455_102484492	314
275	3300006931	Ga0097620_100329156	Ga0097620_1003291564	314
276	3300013105	Ga0157369_10060666	Ga0157369_100606663	314
277	3300025928	Ga0207700_10037134	Ga0207700_100371343	314
278	3300044658	Ga0466972_0031277	Ga0466972_0031277_580_1614	314
279	3300044683	Ga0466965_0008518	Ga0466965_0008518_1261_2295	314
280	3300044735	Ga0466968_0002360	Ga0466968_0002360_2551_3585	314
281	3300044842	Ga0466957_0005335	Ga0466957_0005335_1807_2841	314
282	3300044901	Ga0466960_0034871	Ga0466960_0034871_1132_2166	314
283	3300048903	Ga0496100_0000031	Ga0496100_0000031_85341_86381	314
284	3300048905	Ga0496102_0029717	Ga0496102_0029717_2163_3203	314
285	3300048906	Ga0496103_0000587	Ga0496103_0000587_21306_22346	314
286	3300048909	Ga0496106_0000271	Ga0496106_0000271_482_1522	314
287	3300048910	Ga0496107_0002497	Ga0496107_0002497_6891_7931	314
288	3300048911	Ga0496108_0066936	Ga0496108_0066936_1929_2969	314
289	3300048912	Ga0496109_0000197	Ga0496109_0000197_58746_59786	314
290	3300048915	Ga0496112_0151935	Ga0496112_0151935_299_1333	314
291	3300048916	Ga0496113_0068803	Ga0496113_0068803_685_1719	314
292	3300048917	Ga0496114_0137362	Ga0496114_0137362_1023_2063	314
293	3300048919	Ga0496116_0001948	Ga0496116_0001948_4613_5653	314
294	3300048920	Ga0496117_0034947	Ga0496117_0034947_578_1618	314
295	3300048921	Ga0496118_0007765	Ga0496118_0007765_6310_7350	314
296	3300048922	Ga0496119_0002469	Ga0496119_0002469_11917_12957	314
297	3300048923	Ga0496120_0064561	Ga0496120_0064561_952_1992	314
298	3300048924	Ga0496121_0000027	Ga0496121_0000027_358353_359393	314
299	3300048925	Ga0496122_0000335	Ga0496122_0000335_85355_86395	314
300	3300048926	Ga0496123_0021456	Ga0496123_0021456_88_1128	314
301	3300048927	Ga0496124_0000016	Ga0496124_0000016_358353_359393	314
302	3300048928	Ga0496125_0000008	Ga0496125_0000008_358353_359393	314
303	3300048929	Ga0496126_0000025	Ga0496126_0000025_358353_359393	314
304	3300048929	Ga0496126_0006067	Ga0496126_0006067_8963_9997	314
305	iso_pu_bacteria	2738541264	2738666093	314
306	iso_pu_bacteria	2738541356	2739145227	314
307	iso_pu_bacteria	2738543011	2739237255	314
308	iso_pu_bacteria	2889300758	2889302396	314
309	iso_pu_bacteria	2929212328	2929216497	314
310	iso_pu_bacteria	2939743619	2939748857	314
311	3300005353	Ga0070669_100000918	Ga0070669_10000091811	315
312	3300005367	Ga0070667_100000033	Ga0070667_100000033132	315
313	3300005617	Ga0068859_100000300	Ga0068859_10000030016	315
314	3300005841	Ga0068863_100003284	Ga0068863_1000032845	315
315	3300005842	Ga0068858_100016132	Ga0068858_1000161324	315
316	3300005843	Ga0068860_100000010	Ga0068860_100000010135	315
317	3300005844	Ga0068862_100000008	Ga0068862_100000008190	315
318	3300006931	Ga0097620_100000300	Ga0097620_10000030038	315
319	3300009101	Ga0105247_10000019	Ga0105247_1000001969	315
320	3300009177	Ga0105248_10000188	Ga0105248_1000018858	315
321	3300009553	Ga0105249_10000019	Ga0105249_10000019186	315
322	3300014325	Ga0163163_10020081	Ga0163163_100200816	315
323	3300025900	Ga0207710_10000036	Ga0207710_10000036169	315
324	3300025923	Ga0207681_10001678	Ga0207681_100016786	315
325	3300025941	Ga0207711_10000168	Ga0207711_1000016813	315
326	3300025961	Ga0207712_10000025	Ga0207712_1000002565	315
327	3300025986	Ga0207658_10000125	Ga0207658_1000012555	315
328	3300026035	Ga0207703_10009197	Ga0207703_100091975	315
329	3300026088	Ga0207641_10008728	Ga0207641_100087286	315
330	3300028379	Ga0268266_10047322	Ga0268266_100473221	315
331	3300028380	Ga0268265_10000007	Ga0268265_10000007186	315
332	3300028381	Ga0268264_10000007	Ga0268264_10000007321	315
333	3300039437	Ga0436365_1548911	Ga0436365_1548911_3009_4040	315
334	3300039450	Ga0436363_0820803	Ga0436363_0820803_178_1209	315
335	3300041413	Ga0439465_0004484	Ga0439465_0004484_1371_2402	315
336	3300048905	Ga0496102_0000789	Ga0496102_0000789_9324_10373	315
337	3300048906	Ga0496103_0000409	Ga0496103_0000409_15683_16732	315
338	3300048920	Ga0496117_0000564	Ga0496117_0000564_32246_33295	315
339	3300048921	Ga0496118_0000279	Ga0496118_0000279_7250_8299	315
340	3300048922	Ga0496119_0003048	Ga0496119_0003048_2240_3289	315
341	3300048923	Ga0496120_0021025	Ga0496120_0021025_3053_4102	315
342	3300048929	Ga0496126_0002966	Ga0496126_0002966_1922_2971	315
343	iso_pu_bacteria	2842134933	2842137286	315
344	3300006186	Ga0075369_10002547	Ga0075369_100025475	316
345	3300031995	Ga0307409_100097833	Ga0307409_1000978334	316
346	3300003792	Ga0055540_1000923	Ga0055540_10009236	317
347	3300003792	Ga0055540_1007241	Ga0055540_10072413	317
348	3300005539	Ga0068853_100144667	Ga0068853_1001446672	317
349	3300005841	Ga0068863_100341762	Ga0068863_1003417622	317
350	3300009101	Ga0105247_10118758	Ga0105247_101187581	317
351	3300013105	Ga0157369_10400806	Ga0157369_104008061	317
352	3300025303	Ga0209051_1000852	Ga0209051_100085214	317
353	3300025303	Ga0209051_1001533	Ga0209051_100153320	317
354	3300025303	Ga0209051_1018981	Ga0209051_10189812	317
355	3300026041	Ga0207639_10022180	Ga0207639_100221802	317
356	3300031251	Ga0265327_10000067	Ga0265327_10000067164	317
357	3300044694	Ga0466963_0030087	Ga0466963_0030087_320_1351	317
358	3300044694	Ga0466963_0042555	Ga0466963_0042555_1880_2911	317
359	3300044842	Ga0466957_0006786	Ga0466957_0006786_60_1091	317
360	3300046460	Ga0495638_0018417	Ga0495638_0018417_2749_3789	317
361	3300047472	Ga0495686_0001356	Ga0495686_0001356_21094_22134	317
362	3300048904	Ga0496101_0000030	Ga0496101_0000030_189734_190786	317
363	3300048905	Ga0496102_0000001	Ga0496102_0000001_493528_494580	317
364	3300048905	Ga0496102_0164100	Ga0496102_0164100_90_1124	317
365	3300048906	Ga0496103_0000003	Ga0496103_0000003_224590_225642	317
366	3300048907	Ga0496104_0066882	Ga0496104_0066882_2117_3151	317
367	3300048909	Ga0496106_0265214	Ga0496106_0265214_23_1057	317
368	3300048910	Ga0496107_0194851	Ga0496107_0194851_236_1270	317
369	3300048911	Ga0496108_0114021	Ga0496108_0114021_1003_2037	317
370	3300048919	Ga0496116_0000013	Ga0496116_0000013_378352_379404	317
371	3300048920	Ga0496117_0000013	Ga0496117_0000013_224590_225642	317
372	3300048921	Ga0496118_0000011	Ga0496118_0000011_378354_379406	317
373	3300048922	Ga0496119_0012477	Ga0496119_0012477_5383_6435	317
374	3300048924	Ga0496121_0000236	Ga0496121_0000236_110219_111271	317
375	3300048929	Ga0496126_0000120	Ga0496126_0000120_105397_106449	317
376	3300049569	Ga0501032_0004486	Ga0501032_0004486_3710_4741	317
377	3300049570	Ga0501033_0013882	Ga0501033_0013882_2672_3703	317
378	3300049571	Ga0501034_0003572	Ga0501034_0003572_16175_17206	317
379	3300049572	Ga0501036_0087138	Ga0501036_0087138_404_1435	317
380	3300049573	Ga0501037_0002983	Ga0501037_0002983_6852_7883	317
381	3300049580	Ga0501046_0000978	Ga0501046_0000978_3262_4293	317
382	3300049581	Ga0501047_0000570	Ga0501047_0000570_16302_17333	317
383	3300049582	Ga0501048_0004826	Ga0501048_0004826_3878_4909	317
384	3300049585	Ga0501069_0029768	Ga0501069_0029768_503_1534	317
385	3300049586	Ga0501070_0006577	Ga0501070_0006577_5725_6756	317
386	3300049742	Ga0501080_0036692	Ga0501080_0036692_343_1374	317
387	3300049822	Ga0501035_0003000	Ga0501035_0003000_9774_10805	317
388	3300049823	Ga0501044_0001306	Ga0501044_0001306_17408_18439	317
389	3300050516	nmdc:mga0sz30_13589_c2	nmdc:mga0sz30_13589_c2_1264_2304	317
390	3300053119	Ga0500595_044626	Ga0500595_044626_285_1325	317
391	3300053139	Ga0500568_0050459	Ga0500568_0050459_58_1098	317
392	3300053153	Ga0500616_0005620	Ga0500616_0005620_3411_4547	317
393	3300053158	Ga0500627_0013334	Ga0500627_0013334_38_1078	317
394	3300053730	Ga0500645_000175	Ga0500645_000175_25110_26150	317
395	iso_pu_bacteria	2643221687	2644489121	317
396	iso_pu_bacteria	2738543028	2739330533	317
397	iso_pu_bacteria	2902792274	2902796823	317
398	iso_pu_bacteria	2902799365	2902799561	317
399	iso_pu_bacteria	2902837492	2902837821	317
400	3300003792	Ga0055540_1001367	Ga0055540_10013676	318
401	3300005347	Ga0070668_100004162	Ga0070668_1000041627	318
402	3300006038	Ga0075365_10062150	Ga0075365_100621504	318
403	3300006048	Ga0075363_100000135	Ga0075363_10000013517	318
404	3300006048	Ga0075363_100023328	Ga0075363_1000233284	318
405	3300006051	Ga0075364_10147092	Ga0075364_101470922	318
406	3300006186	Ga0075369_10003436	Ga0075369_100034361	318
407	3300006186	Ga0075369_10053378	Ga0075369_100533781	318
408	3300006353	Ga0075370_10012149	Ga0075370_100121493	318
409	3300021384	Ga0213876_10000447	Ga0213876_100004475	318
410	3300025273	Ga0209673_1022247	Ga0209673_10222473	318
411	3300025303	Ga0209051_1001769	Ga0209051_10017693	318
412	3300025972	Ga0207668_10000179	Ga0207668_1000017944	318
413	3300031852	Ga0307410_10100648	Ga0307410_101006481	318
414	3300037853	Ga0436364_1107971	Ga0436364_1107971_3771_4820	318
415	3300039437	Ga0436365_1083994	Ga0436365_1083994_202852_203901	318
416	3300044683	Ga0466965_0002411	Ga0466965_0002411_3105_4166	318
417	3300044719	Ga0466971_0004692	Ga0466971_0004692_4326_5363	318
418	3300044901	Ga0466960_0000288	Ga0466960_0000288_2579_3640	318
419	3300046460	Ga0495638_0004906	Ga0495638_0004906_8849_9886	318
420	3300048091	Ga0495626_0035122	Ga0495626_0035122_866_1903	318
421	3300048905	Ga0496102_0033864	Ga0496102_0033864_1407_2444	318
422	3300048920	Ga0496117_0044819	Ga0496117_0044819_295_1332	318
423	3300048921	Ga0496118_0000395	Ga0496118_0000395_70629_71666	318
424	3300048929	Ga0496126_0002515	Ga0496126_0002515_22646_23683	318
425	3300048929	Ga0496126_0005126	Ga0496126_0005126_8420_9457	318
426	3300048929	Ga0496126_0160303	Ga0496126_0160303_165_1211	318
427	3300049569	Ga0501032_0002928	Ga0501032_0002928_542_1582	318
428	3300049571	Ga0501034_0001356	Ga0501034_0001356_23029_24069	318
429	3300049573	Ga0501037_0000220	Ga0501037_0000220_11567_12607	318
430	3300049574	Ga0501038_0000980	Ga0501038_0000980_14888_15928	318
431	3300049575	Ga0501039_0001608	Ga0501039_0001608_3670_4710	318
432	3300049579	Ga0501043_0008835	Ga0501043_0008835_4749_5789	318
433	3300049586	Ga0501070_0025412	Ga0501070_0025412_659_1699	318
434	3300049589	Ga0501073_0008348	Ga0501073_0008348_3405_4445	318
435	3300049823	Ga0501044_0045049	Ga0501044_0045049_665_1705	318
436	3300050490	nmdc:mga03n38_137_c1	nmdc:mga03n38_137_c1_10662_11690	318
437	3300050490	nmdc:mga03n38_1744_c1	nmdc:mga03n38_1744_c1_2622_3659	318
438	3300050491	nmdc:mga00v17_2061_c1	nmdc:mga00v17_2061_c1_3606_4643	318
439	3300050491	nmdc:mga00v17_237199_c1	nmdc:mga00v17_237199_c1_129_1169	318
440	3300050491	nmdc:mga00v17_42198_c1	nmdc:mga00v17_42198_c1_1497_2540	318
441	3300050491	nmdc:mga00v17_8868_c1	nmdc:mga00v17_8868_c1_2236_3264	318
442	3300050496	nmdc:mga07m45_134122_c1	nmdc:mga07m45_134122_c1_68_1105	318
443	3300050496	nmdc:mga07m45_393_c1	nmdc:mga07m45_393_c1_6648_7676	318
444	3300050516	nmdc:mga0sz30_21391_c1	nmdc:mga0sz30_21391_c1_686_1723	318
445	3300053104	Ga0500556_0003907	Ga0500556_0003907_1674_2786	318
446	3300053153	Ga0500616_0048070	Ga0500616_0048070_923_2035	318
447	3300061719	Ga0466962_0067921	Ga0466962_0067921_230_1267	318
448	iso_pu_bacteria	2939582691	2939588569	318
449	3300001991	JGI24743J22301_10001249	JGI24743J22301_100012493	323
450	3300002077	JGI24744J21845_10012749	JGI24744J21845_100127492	323
451	3300005334	Ga0068869_100035557	Ga0068869_1000355572	323
452	3300005338	Ga0068868_100071620	Ga0068868_1000716202	323
453	3300005340	Ga0070689_100148594	Ga0070689_1001485943	323
454	3300005354	Ga0070675_100252202	Ga0070675_1002522022	323
455	3300005364	Ga0070673_100324919	Ga0070673_1003249191	323
456	3300005434	Ga0070709_10247883	Ga0070709_102478832	323
457	3300005455	Ga0070663_100178257	Ga0070663_1001782572	323
458	3300005457	Ga0070662_100307998	Ga0070662_1003079981	323
459	3300005536	Ga0070697_100401075	Ga0070697_1004010751	323
460	3300005539	Ga0068853_100164420	Ga0068853_1001644202	323
461	3300005545	Ga0070695_100069332	Ga0070695_1000693322	323
462	3300005546	Ga0070696_100203896	Ga0070696_1002038963	323
463	3300005548	Ga0070665_100038198	Ga0070665_1000381982	323
464	3300005549	Ga0070704_100018699	Ga0070704_1000186992	323
465	3300005616	Ga0068852_100208545	Ga0068852_1002085452	323
466	3300005617	Ga0068859_100074211	Ga0068859_1000742112	323
467	3300005618	Ga0068864_100147127	Ga0068864_1001471272	323
468	3300005719	Ga0068861_100078151	Ga0068861_1000781512	323
469	3300005841	Ga0068863_100144144	Ga0068863_1001441445	323
470	3300006931	Ga0097620_100074208	Ga0097620_1000742086	323
471	3300009174	Ga0105241_10106002	Ga0105241_101060022	323
472	3300009545	Ga0105237_10151402	Ga0105237_101514022	323
473	3300010375	Ga0105239_10233308	Ga0105239_102333082	323
474	3300013296	Ga0157374_10056969	Ga0157374_100569694	323
475	3300013297	Ga0157378_10121381	Ga0157378_101213813	323
476	3300013307	Ga0157372_10102763	Ga0157372_101027635	323
477	3300014745	Ga0157377_10021816	Ga0157377_100218165	323
478	3300014969	Ga0157376_10117121	Ga0157376_101171213	323
479	3300025901	Ga0207688_10002205	Ga0207688_100022058	323
480	3300025905	Ga0207685_10001224	Ga0207685_100012244	323
481	3300025908	Ga0207643_10168818	Ga0207643_101688181	323
482	3300025915	Ga0207693_10315808	Ga0207693_103158081	323
483	3300025923	Ga0207681_10073880	Ga0207681_100738804	323
484	3300025924	Ga0207694_10247925	Ga0207694_102479252	323
485	3300025933	Ga0207706_10064162	Ga0207706_100641624	323
486	3300025939	Ga0207665_10014082	Ga0207665_100140825	323
487	3300025942	Ga0207689_10017761	Ga0207689_100177612	323
488	3300025972	Ga0207668_10140336	Ga0207668_101403361	323
489	3300026067	Ga0207678_10081078	Ga0207678_100810783	323
490	3300026075	Ga0207708_10176756	Ga0207708_101767562	323
491	3300026088	Ga0207641_10152883	Ga0207641_101528831	323
492	3300026089	Ga0207648_10012935	Ga0207648_100129353	323
493	3300026095	Ga0207676_10117837	Ga0207676_101178373	323
494	3300026118	Ga0207675_100067689	Ga0207675_1000676892	323
495	3300026121	Ga0207683_10095086	Ga0207683_100950863	323
496	3300035088	Ga0373940_0022849	Ga0373940_0022849_413_1441	323
497	3300035112	Ga0373932_0037330	Ga0373932_0037330_277_1305	323
498	3300048903	Ga0496100_0033877	Ga0496100_0033877_142_1170	323
499	3300048907	Ga0496104_0164551	Ga0496104_0164551_191_1219	323
500	3300048908	Ga0496105_0218897	Ga0496105_0218897_499_1527	323
501	3300048910	Ga0496107_0141270	Ga0496107_0141270_225_1253	323
502	3300048911	Ga0496108_0000204	Ga0496108_0000204_41829_42857	323
503	3300048912	Ga0496109_0021272	Ga0496109_0021272_1298_2326	323
504	3300048913	Ga0496110_0101275	Ga0496110_0101275_623_1651	323
505	3300048915	Ga0496112_0017777	Ga0496112_0017777_1944_2972	323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

20

253

0.87 PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

106

286

0.83 PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

15

261

0.82 PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

33

285

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6ddn-assembly2.cif.gz_B	the sulfate-binding protein subi from mycobacterium tuberculosis h37rv	0.974	24	307
6ddn-assembly2.cif.gz_B	the sulfate-binding protein subi from mycobacterium tuberculosis h37rv	0.9607	24	307
1sbp-assembly1.cif.gz_A	1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding	0.9124	25	316
5um2-assembly1.cif.gz_A	functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri	0.9007	25	322
1sbp-assembly1.cif.gz_A	1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding	0.862	25	316

ID	Description	Score	Start	End	Superfamily
af_P71744_144_341_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9815	111	307	3.40.190.10
af_P71744_144_341_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9718	111	307	3.40.190.10
6ddnB02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9616	111	307	3.40.190.10
6ddnB02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9551	111	307	3.40.190.10
af_Q2FVX4_42_108_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9512	25	91	3.40.190.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2S8LZI9-F1-model_v4	deleted	0.9861	99	322
AF-A0A378X1U7-F1-model_v4	Sulfate-binding protein	0.9839	71	322	GO:0042597 GO:1902358
AF-A0A2S9F793-F1-model_v4	Sulfate ABC transporter substrate-binding protein	0.9799	24	322	GO:0042597 GO:1902358
AF-A0A2S8LZI9-F1-model_v4	deleted	0.9772	99	322
AF-X8AQA1-F1-model_v4	Bacterial extracellular solute-binding family protein	0.9709	183	322	GO:0042597 GO:1902358

Feature Viewer

pLDDT	pTM	Quality
90.93	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F456402

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

20

253

0.87

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

106

286

0.83

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

15

261

0.82

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

33

285

0.77

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map