F456403

General Info

Members Datasets Scaffolds Average Seq Length
505 238 1010 343

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0070789|Ga0466967_0070789_1222_2340
Length 372
Sequence MLVAGLWPPNAPGRPLARVAADPSSIGVNVRRALITGVTGQDGSYLAELLLGKGYEVHGLIRRASMFNTGRIDHLYRDPHDESARLYLHYGDLTDGARLVSLMREIDPDEVYNLGAQSHVRVSFDEPEYTGNTTALGAMRLLEAVRMSGVECRYYQASSSEMFGSEAPPQSETTPFYPRSPYGVAKVYAYWAARNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAAARIKAGLDDYVYLGNLDAERDWGYAPEFVEGMWRMLQADEPDDFVLATGSSMTVRDFLDASFSHLGLAWQDHVKFDERYLRPSEVDALRGDASKAEKVLGWKPKVDGQKLAQIMVEADLEALEHAGRPWIDKVVLSDWPATP

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 2.18
Rhizosphere 93.86
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0070789 3300045976 Bacteria 3120
2 Ga0065704_10074099 3300005289 Bacteria 6521
3 Ga0065704_10096841 3300005289 Bacteria 2422
4 Ga0065712_10073890 3300005290 Bacteria 4232
5 Ga0065715_10109939 3300005293 Bacteria 2645
6 Ga0065715_10188707 3300005293 Bacteria 1429
7 Ga0065707_10083075 3300005295 Bacteria 10603
8 Ga0065707_10083441 3300005295 Bacteria 9176
9 Ga0065707_10088234 3300005295 Bacteria 4728
10 Ga0065707_10099918 3300005295 Bacteria 2969
11 Ga0070683_100017063 3300005329 Bacteria 6408
12 Ga0070683_100110947 3300005329 Bacteria 2587
13 Ga0070690_100047234 3300005330 Bacteria 2739
14 Ga0068869_100008875 3300005334 Bacteria 6504
15 Ga0068869_100021295 3300005334 Bacteria 4459
16 Ga0068869_100034057 3300005334 Bacteria 3601
17 Ga0070682_100000123 3300005337 Bacteria 68616
18 Ga0070689_100037996 3300005340 Bacteria 3682
19 Ga0070689_100067906 3300005340 Bacteria 2780
20 Ga0070689_100092978 3300005340 Bacteria 2380
21 Ga0070689_100094348 3300005340 Bacteria 2362
22 Ga0070689_100097858 3300005340 Bacteria 2320
23 Ga0070669_100000544 3300005353 Bacteria 28111
24 Ga0070671_100053815 3300005355 Bacteria 3346
25 Ga0070688_100062435 3300005365 Bacteria 2358
26 Ga0070688_100105428 3300005365 Unclassified 1866
27 Ga0070667_100121922 3300005367 Bacteria 2268
28 Ga0070667_100236161 3300005367 Bacteria 1631
29 Ga0070705_100058587 3300005440 Bacteria 2277
30 Ga0070705_100064908 3300005440 Bacteria 2183
31 Ga0070708_100007541 3300005445 Bacteria 8710
32 Ga0070708_100014498 3300005445 Bacteria 6488
33 Ga0070708_100015055 3300005445 Bacteria 6381
34 Ga0070708_100015563 3300005445 Bacteria 6287
35 Ga0070708_100146062 3300005445 Bacteria 2197
36 Ga0070678_100032388 3300005456 Bacteria 3618
37 Ga0070662_100166995 3300005457 Bacteria 1725
38 Ga0070681_10002938 3300005458 Bacteria 15800
39 Ga0070681_10204887 3300005458 Bacteria 1890
40 Ga0068867_100080922 3300005459 Bacteria 2447
41 Ga0070685_10079067 3300005466 Bacteria 1967
42 Ga0070706_100000784 3300005467 Bacteria 35492
43 Ga0070706_100001479 3300005467 Bacteria 24663
44 Ga0070706_100002727 3300005467 Bacteria 17658
45 Ga0070706_100059192 3300005467 Bacteria 3535
46 Ga0070706_100074824 3300005467 Bacteria 3134
47 Ga0070706_100234858 3300005467 Bacteria 1712
48 Ga0070706_100399356 3300005467 Bacteria 1280
49 Ga0070707_100015744 3300005468 Bacteria 7099
50 Ga0070707_100016067 3300005468 Bacteria 7022
51 Ga0070707_100030686 3300005468 Bacteria 5119
52 Ga0070698_100003590 3300005471 Bacteria 17052
53 Ga0070698_100007126 3300005471 Bacteria 12109
54 Ga0070698_100015564 3300005471 Bacteria 8031
55 Ga0070698_100020782 3300005471 Bacteria 6880
56 Ga0070698_100028632 3300005471 Bacteria 5785
57 Ga0070698_100093499 3300005471 Bacteria 2986
58 Ga0070698_100278631 3300005471 Bacteria 1604
59 Ga0070699_100000667 3300005518 Bacteria 32069
60 Ga0070699_100002679 3300005518 Bacteria 15914
61 Ga0070699_100132859 3300005518 Bacteria 2195
62 Ga0070699_100260438 3300005518 Bacteria 1551
63 Ga0070699_100417437 3300005518 Bacteria 1214
64 Ga0070679_100108148 3300005530 Bacteria 2767
65 Ga0070684_100034584 3300005535 Bacteria 4321
66 Ga0070697_100000406 3300005536 Bacteria 33231
67 Ga0070697_100002369 3300005536 Bacteria 14497
68 Ga0070697_100003496 3300005536 Bacteria 12071
69 Ga0070697_100008918 3300005536 Bacteria 7835
70 Ga0070697_100042664 3300005536 Unclassified 3671
71 Ga0070697_100067241 3300005536 Bacteria 2931
72 Ga0070697_100220413 3300005536 Bacteria 1617
73 Ga0068853_100042949 3300005539 Bacteria 3867
74 Ga0070672_100110246 3300005543 Bacteria 2242
75 Ga0070686_100008320 3300005544 Bacteria 5810
76 Ga0070686_100045408 3300005544 Bacteria 2767
77 Ga0070686_100054890 3300005544 Bacteria 2550
78 Ga0070696_100049425 3300005546 Unclassified 2921
79 Ga0070696_100064970 3300005546 Bacteria 2557
80 Ga0070696_100132162 3300005546 Bacteria 1817
81 Ga0070696_100153080 3300005546 Bacteria 1694
82 Ga0070693_100002195 3300005547 Bacteria 8952
83 Ga0070665_100000996 3300005548 Bacteria 35909
84 Ga0070665_100155972 3300005548 Bacteria 2285
85 Ga0070704_100018229 3300005549 Bacteria 4483
86 Ga0070704_100031837 3300005549 Bacteria 3551
87 Ga0070704_100116684 3300005549 Bacteria 2042
88 Ga0068855_100074130 3300005563 Bacteria 3953
89 Ga0070664_100015607 3300005564 Bacteria 6215
90 Ga0070664_100016708 3300005564 Bacteria 6018
91 Ga0070664_100085741 3300005564 Bacteria 2720
92 Ga0070664_100177059 3300005564 Bacteria 1894
93 Ga0068856_100000160 3300005614 Bacteria 69926
94 Ga0070702_100040565 3300005615 Bacteria 2605
95 Ga0068852_100219087 3300005616 Bacteria 1809
96 Ga0068859_100066493 3300005617 Bacteria 3640
97 Ga0068864_100003095 3300005618 Bacteria 13745
98 Ga0068864_100253820 3300005618 Bacteria 1634
99 Ga0068866_10051104 3300005718 Bacteria 2102
100 Ga0068863_100170342 3300005841 Bacteria 2088
101 Ga0068863_100204507 3300005841 Bacteria 1900
102 Ga0068863_100297749 3300005841 Bacteria 1564
103 Ga0068858_100029386 3300005842 Bacteria 5103
104 Ga0068858_100036628 3300005842 Bacteria 4548
105 Ga0068858_100447221 3300005842 Bacteria 1245
106 Ga0068860_100055395 3300005843 Bacteria 3770
107 Ga0068860_100432613 3300005843 Bacteria 1306
108 Ga0068862_100156575 3300005844 Bacteria 2031
109 Ga0081455_10002146 3300005937 Bacteria 23521
110 Ga0081540_1001119 3300005983 Bacteria 23729
111 Ga0081539_10000492 3300005985 Bacteria 83156
112 Ga0081539_10003410 3300005985 Bacteria 19594
113 Ga0070717_10054713 3300006028 Bacteria 3291
114 Ga0070717_10405594 3300006028 Bacteria 1225
115 Ga0070716_100064172 3300006173 Bacteria 2134
116 Ga0070712_100285770 3300006175 Bacteria 1330
117 Ga0075366_10016465 3300006195 Bacteria 4250
118 Ga0097621_100016162 3300006237 Bacteria 5635
119 Ga0097621_100092273 3300006237 Bacteria 2536
120 Ga0097621_100269004 3300006237 Bacteria 1497
121 Ga0068871_100039617 3300006358 Bacteria 3771
122 Ga0068871_100072069 3300006358 Bacteria 2844
123 Ga0075428_100002910 3300006844 Bacteria 18638
124 Ga0075428_100026856 3300006844 Bacteria 6374
125 Ga0075428_100033167 3300006844 Bacteria 5702
126 Ga0075428_100069430 3300006844 Bacteria 3852
127 Ga0075428_100115379 3300006844 Bacteria 2926
128 Ga0075428_100684796 3300006844 Bacteria 1092
129 Ga0075430_100003362 3300006846 Bacteria 13391
130 Ga0075430_100034660 3300006846 Bacteria 4285
131 Ga0075430_100066163 3300006846 Bacteria 3035
132 Ga0075431_100013003 3300006847 Bacteria 8405
133 Ga0075431_100072920 3300006847 Bacteria 3542
134 Ga0075431_100168185 3300006847 Bacteria 2253
135 Ga0075431_100207492 3300006847 Bacteria 2003
136 Ga0075433_10005536 3300006852 Bacteria 9915
137 Ga0075433_10030338 3300006852 Bacteria 4612
138 Ga0075433_10034647 3300006852 Bacteria 4338
139 Ga0075433_10251471 3300006852 Unclassified 1568
140 Ga0075434_100001928 3300006871 Bacteria 17990
141 Ga0075434_100002547 3300006871 Bacteria 16081
142 Ga0075434_100156482 3300006871 Bacteria 2298
143 Ga0075429_100000249 3300006880 Bacteria 37106
144 Ga0075429_100236294 3300006880 Bacteria 1601
145 Ga0075436_100007039 3300006914 Bacteria 7700
146 Ga0075436_100025523 3300006914 Bacteria 4068
147 Ga0097620_100066493 3300006931 Bacteria 3640
148 Ga0075435_100028881 3300007076 Bacteria 4351
149 Ga0075435_100132279 3300007076 Bacteria 2088
150 Ga0075435_100165949 3300007076 Bacteria 1862
151 Ga0075435_100278588 3300007076 Bacteria 1427
152 Ga0105240_10048964 3300009093 Bacteria 5338
153 Ga0111539_10033023 3300009094 Bacteria 6283
154 Ga0111539_10101081 3300009094 Bacteria 3385
155 Ga0111539_10180905 3300009094 Bacteria 2462
156 Ga0105245_10016138 3300009098 Bacteria 6508
157 Ga0114129_10006478 3300009147 Bacteria 16607
158 Ga0114129_10007007 3300009147 Bacteria 16047
159 Ga0114129_10018774 3300009147 Bacteria 9850
160 Ga0114129_10022653 3300009147 Bacteria 8909
161 Ga0114129_10026555 3300009147 Bacteria 8201
162 Ga0114129_10031645 3300009147 Bacteria 7478
163 Ga0114129_10039007 3300009147 Bacteria 6696
164 Ga0114129_10131976 3300009147 Bacteria 3429
165 Ga0114129_10176184 3300009147 Bacteria 2913
166 Ga0114129_10196701 3300009147 Bacteria 2733
167 Ga0114129_10363683 3300009147 Bacteria 1914
168 Ga0105243_10044780 3300009148 Bacteria 3474
169 Ga0105241_10024978 3300009174 Bacteria 4440
170 Ga0105241_10043229 3300009174 Bacteria 3412
171 Ga0105242_10028751 3300009176 Bacteria 4427
172 Ga0105242_10275446 3300009176 Bacteria 1526
173 Ga0105248_10004250 3300009177 Bacteria 15849
174 Ga0105237_10005589 3300009545 Bacteria 14172
175 Ga0105237_10110544 3300009545 Bacteria 2740
176 Ga0105238_10378186 3300009551 Bacteria 1407
177 Ga0105249_10058027 3300009553 Bacteria 3547
178 Ga0105249_10148162 3300009553 Bacteria 2257
179 Ga0105249_10359233 3300009553 Bacteria 1478
180 Ga0105249_10379771 3300009553 Bacteria 1439
181 Ga0105239_10065462 3300010375 Bacteria 3992
182 Ga0105239_10091534 3300010375 Bacteria 3356
183 Ga0157369_10115088 3300013105 Bacteria 2856
184 Ga0157378_10014624 3300013297 Bacteria 6870
185 Ga0157378_10049442 3300013297 Bacteria 3741
186 Ga0163162_10001497 3300013306 Bacteria 21760
187 Ga0163162_10025381 3300013306 Bacteria 5854
188 Ga0157372_10122265 3300013307 Bacteria 2991
189 Ga0157375_10000074 3300013308 Bacteria 103033
190 Ga0157375_10007563 3300013308 Bacteria 9499
191 Ga0157375_10054672 3300013308 Bacteria 3933
192 Ga0157375_10110155 3300013308 Bacteria 2850
193 Ga0157375_10321378 3300013308 Bacteria 1712
194 Ga0157375_10420141 3300013308 Bacteria 1503
195 Ga0163163_10000065 3300014325 Bacteria 115460
196 Ga0163163_10006651 3300014325 Bacteria 10128
197 Ga0163163_10049192 3300014325 Bacteria 4148
198 Ga0157380_10407819 3300014326 Bacteria 1292
199 Ga0157379_10061295 3300014968 Bacteria 3363
200 Ga0157376_10015771 3300014969 Bacteria 5718
201 Ga0157376_10487393 3300014969 Bacteria 1209
202 Ga0163161_10128052 3300017792 Bacteria 1913
203 Ga0213874_10002104 3300021377 Bacteria 4221
204 Ga0213876_10079982 3300021384 Unclassified 1727
205 Ga0213875_10007266 3300021388 Bacteria 5738
206 Ga0209050_1000151 3300025298 Bacteria 162058
207 Ga0207653_10000246 3300025885 Bacteria 35190
208 Ga0207645_10009398 3300025907 Bacteria 6763
209 Ga0207705_10141347 3300025909 Bacteria 1798
210 Ga0207684_10000382 3300025910 Bacteria 59711
211 Ga0207684_10000904 3300025910 Bacteria 33748
212 Ga0207684_10003603 3300025910 Bacteria 15075
213 Ga0207684_10062882 3300025910 Bacteria 3151
214 Ga0207654_10012386 3300025911 Bacteria 4371
215 Ga0207707_10002880 3300025912 Bacteria 15360
216 Ga0207707_10355694 3300025912 Bacteria 1261
217 Ga0207695_10037615 3300025913 Bacteria 5220
218 Ga0207671_10021103 3300025914 Bacteria 4947
219 Ga0207657_10061915 3300025919 Bacteria 3205
220 Ga0207649_10025709 3300025920 Bacteria 3435
221 Ga0207652_10037009 3300025921 Bacteria 4128
222 Ga0207646_10012709 3300025922 Bacteria 8080
223 Ga0207646_10013226 3300025922 Bacteria 7896
224 Ga0207646_10121452 3300025922 Bacteria 2347
225 Ga0207646_10309379 3300025922 Bacteria 1427
226 Ga0207646_10465570 3300025922 Bacteria 1140
227 Ga0207681_10003365 3300025923 Bacteria 10011
228 Ga0207681_10024781 3300025923 Bacteria 3852
229 Ga0207650_10039069 3300025925 Bacteria 3468
230 Ga0207650_10229657 3300025925 Bacteria 1496
231 Ga0207687_10106360 3300025927 Bacteria 2074
232 Ga0207644_10038016 3300025931 Bacteria 3388
233 Ga0207706_10049669 3300025933 Bacteria 3706
234 Ga0207670_10003590 3300025936 Bacteria 8227
235 Ga0207670_10111311 3300025936 Bacteria 1974
236 Ga0207665_10130139 3300025939 Bacteria 1785
237 Ga0207691_10016365 3300025940 Bacteria 7039
238 Ga0207711_10006003 3300025941 Bacteria 10266
239 Ga0207689_10005962 3300025942 Bacteria 10782
240 Ga0207689_10090448 3300025942 Bacteria 2515
241 Ga0207661_10001791 3300025944 Bacteria 14680
242 Ga0207661_10138237 3300025944 Bacteria 2094
243 Ga0207661_10298877 3300025944 Bacteria 1443
244 Ga0207679_10074397 3300025945 Bacteria 2574
245 Ga0207679_10151586 3300025945 Bacteria 1888
246 Ga0207679_10317882 3300025945 Bacteria 1347
247 Ga0207667_10050631 3300025949 Bacteria 4381
248 Ga0207667_10112089 3300025949 Bacteria 2813
249 Ga0207651_10027683 3300025960 Bacteria 3564
250 Ga0207651_10279833 3300025960 Bacteria 1378
251 Ga0207651_10324804 3300025960 Bacteria 1287
252 Ga0207712_10197016 3300025961 Bacteria 1594
253 Ga0207712_10404953 3300025961 Bacteria 1147
254 Ga0207658_10149225 3300025986 Bacteria 1902
255 Ga0207677_10244141 3300026023 Bacteria 1455
256 Ga0207703_10002060 3300026035 Bacteria 17719
257 Ga0207678_10086005 3300026067 Bacteria 2687
258 Ga0207708_10045814 3300026075 Bacteria 3333
259 Ga0207708_10327612 3300026075 Bacteria 1251
260 Ga0207702_10009661 3300026078 Bacteria 8099
261 Ga0207641_10113405 3300026088 Bacteria 2407
262 Ga0207641_10166076 3300026088 Bacteria 2010
263 Ga0207641_10420767 3300026088 Bacteria 1286
264 Ga0207648_10242687 3300026089 Bacteria 1604
265 Ga0207676_10009187 3300026095 Bacteria 7038
266 Ga0207676_10119849 3300026095 Bacteria 2217
267 Ga0207683_10236099 3300026121 Bacteria 1667
268 Ga0207428_10137021 3300027907 Bacteria 1871
269 Ga0268266_10001219 3300028379 Bacteria 31613
270 Ga0268264_10073464 3300028381 Bacteria 2903
271 Ga0268264_10198298 3300028381 Bacteria 1835
272 Ga0265337_1000525 3300028556 Bacteria 20349
273 Ga0265337_1001800 3300028556 Bacteria 10308
274 Ga0265337_1002683 3300028556 Bacteria 7994
275 Ga0265337_1003256 3300028556 Bacteria 7093
276 Ga0265337_1004826 3300028556 Bacteria 5514
277 Ga0265337_1006286 3300028556 Bacteria 4603
278 Ga0265337_1024369 3300028556 Bacteria 1852
279 Ga0265337_1024980 3300028556 Bacteria 1822
280 Ga0265326_10000050 3300028558 Bacteria 68195
281 Ga0265326_10000213 3300028558 Bacteria 28422
282 Ga0265326_10000774 3300028558 Bacteria 11867
283 Ga0265326_10018137 3300028558 Bacteria 2027
284 Ga0265319_1017232 3300028563 Bacteria 2750
285 Ga0265334_10000206 3300028573 Bacteria 34123
286 Ga0265334_10005894 3300028573 Bacteria 5329
287 Ga0265334_10033805 3300028573 Bacteria 2032
288 Ga0265334_10057623 3300028573 Bacteria 1472
289 Ga0265318_10008640 3300028577 Bacteria 4517
290 Ga0265322_10000083 3300028654 Bacteria 44679
291 Ga0265322_10000778 3300028654 Bacteria 11446
292 Ga0265322_10003243 3300028654 Bacteria 4934
293 Ga0265322_10007611 3300028654 Bacteria 3157
294 Ga0265336_10000020 3300028666 Bacteria 213480
295 Ga0265336_10001389 3300028666 Bacteria 11163
296 Ga0265336_10001669 3300028666 Bacteria 9814
297 Ga0265336_10002056 3300028666 Bacteria 8568
298 Ga0265336_10040319 3300028666 Bacteria 1429
299 Ga0265338_10000009 3300028800 Bacteria 448611
300 Ga0265338_10000093 3300028800 Bacteria 168444
301 Ga0265338_10000528 3300028800 Bacteria 67191
302 Ga0265338_10000574 3300028800 Bacteria 64844
303 Ga0265338_10000979 3300028800 Bacteria 48106
304 Ga0265338_10002671 3300028800 Bacteria 26214
305 Ga0265338_10002849 3300028800 Bacteria 25270
306 Ga0265338_10003712 3300028800 Bacteria 21241
307 Ga0265338_10008420 3300028800 Bacteria 12525
308 Ga0265338_10019970 3300028800 Bacteria 7073
309 Ga0265338_10028914 3300028800 Bacteria 5514
310 Ga0265338_10028915 3300028800 Bacteria 5514
311 Ga0265338_10065579 3300028800 Bacteria 3148
312 Ga0265338_10169970 3300028800 Bacteria 1673
313 Ga0265324_10000436 3300029957 Bacteria 29666
314 Ga0265324_10005190 3300029957 Bacteria 5679
315 Ga0265324_10011994 3300029957 Bacteria 3285
316 Ga0265324_10051249 3300029957 Bacteria 1418
317 Ga0265330_10007449 3300031235 Bacteria 5332
318 Ga0265332_10012174 3300031238 Bacteria 3817
319 Ga0265328_10022709 3300031239 Bacteria 2384
320 Ga0265328_10033447 3300031239 Bacteria 1906
321 Ga0265320_10003577 3300031240 Bacteria 10393
322 Ga0265320_10017221 3300031240 Bacteria 4019
323 Ga0265320_10020962 3300031240 Bacteria 3527
324 Ga0265325_10008281 3300031241 Bacteria 6141
325 Ga0265325_10011085 3300031241 Archaea 5187
326 Ga0265325_10012605 3300031241 Bacteria 4829
327 Ga0265325_10026800 3300031241 Bacteria 3119
328 Ga0265325_10063185 3300031241 Bacteria 1874
329 Ga0265329_10000403 3300031242 Bacteria 22578
330 Ga0265329_10002542 3300031242 Bacteria 8235
331 Ga0265340_10011006 3300031247 Bacteria 4824
332 Ga0265339_10004563 3300031249 Bacteria 9429
333 Ga0265339_10005202 3300031249 Bacteria 8705
334 Ga0265339_10009113 3300031249 Bacteria 6269
335 Ga0265339_10009193 3300031249 Bacteria 6235
336 Ga0265339_10073000 3300031249 Bacteria 1825
337 Ga0265339_10076969 3300031249 Bacteria 1768
338 Ga0265331_10023103 3300031250 Bacteria 3164
339 Ga0265327_10009958 3300031251 Bacteria 6770
340 Ga0265316_10000518 3300031344 Bacteria 43510
341 Ga0265316_10045392 3300031344 Bacteria 3489
342 Ga0265316_10060811 3300031344 Bacteria 2935
343 Ga0265316_10132973 3300031344 Bacteria 1873
344 Ga0307513_10198369 3300031456 Bacteria 1851
345 Ga0307513_10281041 3300031456 Bacteria 1442
346 Ga0307408_100022361 3300031548 Bacteria 4296
347 Ga0307408_100036540 3300031548 Bacteria 3454
348 Ga0265313_10001093 3300031595 Bacteria 26113
349 Ga0265313_10097413 3300031595 Bacteria 1310
350 Ga0265314_10000210 3300031711 Bacteria 86377
351 Ga0265314_10006767 3300031711 Bacteria 10058
352 Ga0265314_10023230 3300031711 Bacteria 4733
353 Ga0265342_10005282 3300031712 Bacteria 9898
354 Ga0316578_10010146 3300031728 Bacteria 4876
355 Ga0307405_10065260 3300031731 Bacteria 2317
356 Ga0316577_10027094 3300031733 Bacteria 3195
357 Ga0316577_10164249 3300031733 Bacteria 1253
358 Ga0307413_10114167 3300031824 Bacteria 1815
359 Ga0307410_10031849 3300031852 Bacteria 3388
360 Ga0307416_100228525 3300032002 Bacteria 1791
361 Ga0307416_100232082 3300032002 Bacteria 1780
362 Ga0307414_10010562 3300032004 Bacteria 5367
363 Ga0307411_10115320 3300032005 Bacteria 1932
364 Ga0373943_0119757 3300035170 Bacteria 1398
365 Ga0316574_0025872 3300035398 Bacteria 3526
366 Ga0316582_0009206 3300036647 Bacteria 5348
367 Ga0316584_0020888 3300036712 Bacteria 4754
368 Ga0316584_0036566 3300036712 Bacteria 3645
369 Ga0373925_0043614 3300037068 Bacteria 3330
370 Ga0373925_0324221 3300037068 Bacteria 1247
371 Ga0436364_1227686 3300037853 Bacteria 6080
372 Ga0436364_1427966 3300037853 Bacteria 1313
373 Ga0436365_0085279 3300039437 Bacteria 2171
374 Ga0436365_0279620 3300039437 Bacteria 6001
375 Ga0436365_1284809 3300039437 Bacteria 5198
376 Ga0436365_1486090 3300039437 Bacteria 4026
377 Ga0436365_1760044 3300039437 Bacteria 5312
378 Ga0436363_0594532 3300039450 Bacteria 10991
379 Ga0436363_0915897 3300039450 Bacteria 9583
380 Ga0439434_0003574 3300042435 Bacteria 4541
381 Ga0451577_0006654 3300042876 Bacteria 11474
382 Ga0451577_0039462 3300042876 Bacteria 4243
383 Ga0451577_0139632 3300042876 Bacteria 2177
384 Ga0451577_0318614 3300042876 Bacteria 1410
385 Ga0453683_0000218 3300044673 Bacteria 76321
386 Ga0466963_0160132 3300044694 Bacteria 1566
387 Ga0453684_0000010 3300044712 Bacteria 1133422
388 Ga0453684_0000255 3300044712 Bacteria 229708
389 Ga0453684_0004079 3300044712 Bacteria 31722
390 Ga0453684_0004653 3300044712 Bacteria 28510
391 Ga0453684_0004840 3300044712 Bacteria 27638
392 Ga0453684_0012916 3300044712 Bacteria 13680
393 Ga0453684_0042964 3300044712 Bacteria 6083
394 Ga0453684_0050400 3300044712 Bacteria 5477
395 Ga0453684_0274505 3300044712 Bacteria 1925
396 Ga0453684_0350560 3300044712 Bacteria 1665
397 Ga0453684_0363629 3300044712 Bacteria 1628
398 Ga0453684_0467829 3300044712 Bacteria 1401
399 Ga0453684_0472477 3300044712 Bacteria 1392
400 Ga0451576_0030898 3300045051 Bacteria 5715
401 Ga0451576_0072064 3300045051 Unclassified 3596
402 Ga0451576_0151719 3300045051 Bacteria 2417
403 Ga0451576_0182365 3300045051 Bacteria 2192
404 Ga0451576_0329146 3300045051 Bacteria 1599
405 Ga0451576_0440236 3300045051 Bacteria 1368
406 Ga0466967_0039835 3300045976 Bacteria 4042
407 Ga0466967_0046670 3300045976 Bacteria 3773
408 Ga0466967_0503199 3300045976 Bacteria 1189
409 Ga0495592_0000052 3300046454 Bacteria 109203
410 Ga0495580_0019109 3300046472 Bacteria 5094
411 Ga0495662_0061788 3300046476 Bacteria 1810
412 Ga0495664_0079672 3300046477 Bacteria 1963
413 Ga0495618_0004336 3300046514 Bacteria 8728
414 Ga0495628_0000601 3300046516 Bacteria 33068
415 Ga0495630_0000024 3300046517 Bacteria 155139
416 Ga0495666_0065389 3300046526 Bacteria 1735
417 Ga0495652_0132055 3300046529 Bacteria 1975
418 Ga0495665_0114704 3300046531 Bacteria 1412
419 Ga0495640_0038996 3300046533 Bacteria 3337
420 Ga0495586_0000006 3300046535 Bacteria 168866
421 Ga0495586_0003544 3300046535 Bacteria 8365
422 Ga0495586_0018895 3300046535 Unclassified 3668
423 Ga0495645_0029162 3300046543 Bacteria 4012
424 Ga0495633_0050414 3300046558 Bacteria 1963
425 Ga0495646_0132721 3300046680 Bacteria 1401
426 Ga0495658_0010511 3300046683 Bacteria 4631
427 Ga0495658_0100924 3300046683 Bacteria 1722
428 Ga0495581_0077048 3300047315 Bacteria 1929
429 Ga0495636_0018516 3300047318 Bacteria 2795
430 Ga0495674_0000441 3300047319 Bacteria 37316
431 Ga0496104_0068153 3300048907 Bacteria 3381
432 Ga0496105_0088707 3300048908 Bacteria 2555
433 Ga0496107_0009183 3300048910 Bacteria 6855
434 Ga0496108_0108733 3300048911 Bacteria 2368
435 Ga0496109_0050166 3300048912 Bacteria 3801
436 Ga0496110_0054363 3300048913 Bacteria 3522
437 Ga0496112_0053459 3300048915 Bacteria 3967
438 Ga0496112_0133932 3300048915 Bacteria 2449
439 Ga0496112_0216697 3300048915 Bacteria 1871
440 Ga0496114_0007100 3300048917 Bacteria 8835
441 Ga0496114_0009460 3300048917 Bacteria 7736
442 Ga0496124_0022670 3300048927 Bacteria 5750
443 Ga0501038_0017740 3300049574 Bacteria 6433
444 Ga0501040_0137868 3300049576 Bacteria 1718
445 Ga0501042_0228869 3300049578 Bacteria 1341
446 Ga0501047_0000682 3300049581 Bacteria 35393
447 Ga0501067_0010705 3300049583 Bacteria 5073
448 Ga0501068_0000004 3300049584 Bacteria 81627
449 Ga0501069_0024733 3300049585 Bacteria 3277
450 Ga0501069_0188696 3300049585 Bacteria 1192
451 Ga0501070_0019188 3300049586 Bacteria 5734
452 Ga0501070_0054167 3300049586 Bacteria 3326
453 Ga0501072_0000002 3300049588 Bacteria 319523
454 Ga0501073_0000440 3300049589 Bacteria 28688
455 Ga0501074_0004803 3300049590 Bacteria 9689
456 Ga0501074_0029024 3300049590 Bacteria 4007
457 Ga0501076_0085622 3300049592 Bacteria 2533
458 Ga0501077_0001070 3300049593 Bacteria 16498
459 Ga0501080_0045621 3300049742 Bacteria 4080
460 Ga0501080_0181797 3300049742 Bacteria 1934
461 Ga0501081_0074241 3300049743 Bacteria 2373
462 Ga0501081_0115749 3300049743 Bacteria 1906
463 Ga0501083_0044952 3300049744 Bacteria 2989
464 Ga0501083_0054699 3300049744 Bacteria 2678
465 Ga0501035_0122866 3300049822 Bacteria 2268
466 nmdc:mga0k408_199_c1 3300050493 Bacteria 31769
467 nmdc:mga0k408_297_c1 3300050493 Bacteria 26903
468 nmdc:mga06z11_4303_c1 3300050494 Bacteria 5596
469 nmdc:mga05p37_122244_c1 3300050507 Bacteria 3197
470 nmdc:mga05p37_151478_c1 3300050507 Bacteria 2836
471 nmdc:mga05p37_16577_c1 3300050507 Bacteria 8876
472 nmdc:mga05p37_201739_c1 3300050507 Bacteria 2408
473 nmdc:mga05p37_2071_c1 3300050507 Bacteria 15533
474 nmdc:mga05p37_26675_c1 3300050507 Bacteria 7026
475 nmdc:mga05p37_27395_c1 3300050507 Bacteria 6937
476 nmdc:mga05p37_296933_c1 3300050507 Bacteria 1921
477 nmdc:mga05p37_32376_c1 3300050507 Bacteria 6393
478 nmdc:mga05p37_450955_c1 3300050507 Bacteria 1489
479 nmdc:mga05p37_4917_c1 3300050507 Bacteria 15652
480 nmdc:mga09592_10754_c1 3300050508 Bacteria 7440
481 nmdc:mga09592_5260_c1 3300050508 Bacteria 10515
482 nmdc:mga0qj67_293035_c1 3300050509 Bacteria 1319
483 nmdc:mga0qj67_43182_c1 3300050509 Bacteria 3550
484 nmdc:mga0qj67_4862_c1 3300050509 Bacteria 9769
485 nmdc:mga06r32_104074_c1 3300050510 Bacteria 2788
486 nmdc:mga06r32_14050_c1 3300050510 Bacteria 7261
487 nmdc:mga06r32_301924_c1 3300050510 Bacteria 1587
488 nmdc:mga08y16_53586_c1 3300050511 Bacteria 4217
489 nmdc:mga0n895_216995_c1 3300050512 Bacteria 1942
490 nmdc:mga0n895_243032_c1 3300050512 Bacteria 1827
491 nmdc:mga0n895_28553_c1 3300050512 Bacteria 5308
492 nmdc:mga0n895_340426_c1 3300050512 Bacteria 1519
493 nmdc:mga0n895_4426_c1 3300050512 Bacteria 11543
494 nmdc:mga0rr50_62141_c1 3300050513 Bacteria 2816
495 nmdc:mga08x19_20297_c1 3300050514 Bacteria 4091
496 nmdc:mga08x19_2350_c1 3300050514 Bacteria 11481
497 nmdc:mga0a205_15920_c1 3300050515 Bacteria 7035
498 nmdc:mga0a205_2226_c1 3300050515 Bacteria 16238
499 nmdc:mga0a205_410932_c1 3300050515 Bacteria 1216
500 nmdc:mga0a205_41095_c1 3300050515 Bacteria 4453
501 nmdc:mga0a205_75431_c1 3300050515 Bacteria 3258
502 Ga0501084_0000024 3300054114 Bacteria 137282
503 Ga0590075_017341 3300059424 Bacteria 1774
504 Ga0501082_0000035 3300060353 Bacteria 96746
505 Ga0530510_0268603 3300061734 Bacteria 1273
506 Ga0466967_0070789
507 Ga0065704_10074099
508 Ga0065704_10096841
509 Ga0065712_10073890
510 Ga0065715_10109939
511 Ga0065715_10188707
512 Ga0065707_10083075
513 Ga0065707_10083441
514 Ga0065707_10088234
515 Ga0065707_10099918
516 Ga0070683_100017063
517 Ga0070683_100110947
518 Ga0070690_100047234
519 Ga0068869_100008875
520 Ga0068869_100021295
521 Ga0068869_100034057
522 Ga0070682_100000123
523 Ga0070689_100037996
524 Ga0070689_100067906
525 Ga0070689_100092978
526 Ga0070689_100094348
527 Ga0070689_100097858
528 Ga0070669_100000544
529 Ga0070671_100053815
530 Ga0070688_100062435
531 Ga0070688_100105428
532 Ga0070667_100121922
533 Ga0070667_100236161
534 Ga0070705_100058587
535 Ga0070705_100064908
536 Ga0070708_100007541
537 Ga0070708_100014498
538 Ga0070708_100015055
539 Ga0070708_100015563
540 Ga0070708_100146062
541 Ga0070678_100032388
542 Ga0070662_100166995
543 Ga0070681_10002938
544 Ga0070681_10204887
545 Ga0068867_100080922
546 Ga0070685_10079067
547 Ga0070706_100000784
548 Ga0070706_100001479
549 Ga0070706_100002727
550 Ga0070706_100059192
551 Ga0070706_100074824
552 Ga0070706_100234858
553 Ga0070706_100399356
554 Ga0070707_100015744
555 Ga0070707_100016067
556 Ga0070707_100030686
557 Ga0070698_100003590
558 Ga0070698_100007126
559 Ga0070698_100015564
560 Ga0070698_100020782
561 Ga0070698_100028632
562 Ga0070698_100093499
563 Ga0070698_100278631
564 Ga0070699_100000667
565 Ga0070699_100002679
566 Ga0070699_100132859
567 Ga0070699_100260438
568 Ga0070699_100417437
569 Ga0070679_100108148
570 Ga0070684_100034584
571 Ga0070697_100000406
572 Ga0070697_100002369
573 Ga0070697_100003496
574 Ga0070697_100008918
575 Ga0070697_100042664
576 Ga0070697_100067241
577 Ga0070697_100220413
578 Ga0068853_100042949
579 Ga0070672_100110246
580 Ga0070686_100008320
581 Ga0070686_100045408
582 Ga0070686_100054890
583 Ga0070696_100049425
584 Ga0070696_100064970
585 Ga0070696_100132162
586 Ga0070696_100153080
587 Ga0070693_100002195
588 Ga0070665_100000996
589 Ga0070665_100155972
590 Ga0070704_100018229
591 Ga0070704_100031837
592 Ga0070704_100116684
593 Ga0068855_100074130
594 Ga0070664_100015607
595 Ga0070664_100016708
596 Ga0070664_100085741
597 Ga0070664_100177059
598 Ga0068856_100000160
599 Ga0070702_100040565
600 Ga0068852_100219087
601 Ga0068859_100066493
602 Ga0068864_100003095
603 Ga0068864_100253820
604 Ga0068866_10051104
605 Ga0068863_100170342
606 Ga0068863_100204507
607 Ga0068863_100297749
608 Ga0068858_100029386
609 Ga0068858_100036628
610 Ga0068858_100447221
611 Ga0068860_100055395
612 Ga0068860_100432613
613 Ga0068862_100156575
614 Ga0081455_10002146
615 Ga0081540_1001119
616 Ga0081539_10000492
617 Ga0081539_10003410
618 Ga0070717_10054713
619 Ga0070717_10405594
620 Ga0070716_100064172
621 Ga0070712_100285770
622 Ga0075366_10016465
623 Ga0097621_100016162
624 Ga0097621_100092273
625 Ga0097621_100269004
626 Ga0068871_100039617
627 Ga0068871_100072069
628 Ga0075428_100002910
629 Ga0075428_100026856
630 Ga0075428_100033167
631 Ga0075428_100069430
632 Ga0075428_100115379
633 Ga0075428_100684796
634 Ga0075430_100003362
635 Ga0075430_100034660
636 Ga0075430_100066163
637 Ga0075431_100013003
638 Ga0075431_100072920
639 Ga0075431_100168185
640 Ga0075431_100207492
641 Ga0075433_10005536
642 Ga0075433_10030338
643 Ga0075433_10034647
644 Ga0075433_10251471
645 Ga0075434_100001928
646 Ga0075434_100002547
647 Ga0075434_100156482
648 Ga0075429_100000249
649 Ga0075429_100236294
650 Ga0075436_100007039
651 Ga0075436_100025523
652 Ga0097620_100066493
653 Ga0075435_100028881
654 Ga0075435_100132279
655 Ga0075435_100165949
656 Ga0075435_100278588
657 Ga0105240_10048964
658 Ga0111539_10033023
659 Ga0111539_10101081
660 Ga0111539_10180905
661 Ga0105245_10016138
662 Ga0114129_10006478
663 Ga0114129_10007007
664 Ga0114129_10018774
665 Ga0114129_10022653
666 Ga0114129_10026555
667 Ga0114129_10031645
668 Ga0114129_10039007
669 Ga0114129_10131976
670 Ga0114129_10176184
671 Ga0114129_10196701
672 Ga0114129_10363683
673 Ga0105243_10044780
674 Ga0105241_10024978
675 Ga0105241_10043229
676 Ga0105242_10028751
677 Ga0105242_10275446
678 Ga0105248_10004250
679 Ga0105237_10005589
680 Ga0105237_10110544
681 Ga0105238_10378186
682 Ga0105249_10058027
683 Ga0105249_10148162
684 Ga0105249_10359233
685 Ga0105249_10379771
686 Ga0105239_10065462
687 Ga0105239_10091534
688 Ga0157369_10115088
689 Ga0157378_10014624
690 Ga0157378_10049442
691 Ga0163162_10001497
692 Ga0163162_10025381
693 Ga0157372_10122265
694 Ga0157375_10000074
695 Ga0157375_10007563
696 Ga0157375_10054672
697 Ga0157375_10110155
698 Ga0157375_10321378
699 Ga0157375_10420141
700 Ga0163163_10000065
701 Ga0163163_10006651
702 Ga0163163_10049192
703 Ga0157380_10407819
704 Ga0157379_10061295
705 Ga0157376_10015771
706 Ga0157376_10487393
707 Ga0163161_10128052
708 Ga0213874_10002104
709 Ga0213876_10079982
710 Ga0213875_10007266
711 Ga0209050_1000151
712 Ga0207653_10000246
713 Ga0207645_10009398
714 Ga0207705_10141347
715 Ga0207684_10000382
716 Ga0207684_10000904
717 Ga0207684_10003603
718 Ga0207684_10062882
719 Ga0207654_10012386
720 Ga0207707_10002880
721 Ga0207707_10355694
722 Ga0207695_10037615
723 Ga0207671_10021103
724 Ga0207657_10061915
725 Ga0207649_10025709
726 Ga0207652_10037009
727 Ga0207646_10012709
728 Ga0207646_10013226
729 Ga0207646_10121452
730 Ga0207646_10309379
731 Ga0207646_10465570
732 Ga0207681_10003365
733 Ga0207681_10024781
734 Ga0207650_10039069
735 Ga0207650_10229657
736 Ga0207687_10106360
737 Ga0207644_10038016
738 Ga0207706_10049669
739 Ga0207670_10003590
740 Ga0207670_10111311
741 Ga0207665_10130139
742 Ga0207691_10016365
743 Ga0207711_10006003
744 Ga0207689_10005962
745 Ga0207689_10090448
746 Ga0207661_10001791
747 Ga0207661_10138237
748 Ga0207661_10298877
749 Ga0207679_10074397
750 Ga0207679_10151586
751 Ga0207679_10317882
752 Ga0207667_10050631
753 Ga0207667_10112089
754 Ga0207651_10027683
755 Ga0207651_10279833
756 Ga0207651_10324804
757 Ga0207712_10197016
758 Ga0207712_10404953
759 Ga0207658_10149225
760 Ga0207677_10244141
761 Ga0207703_10002060
762 Ga0207678_10086005
763 Ga0207708_10045814
764 Ga0207708_10327612
765 Ga0207702_10009661
766 Ga0207641_10113405
767 Ga0207641_10166076
768 Ga0207641_10420767
769 Ga0207648_10242687
770 Ga0207676_10009187
771 Ga0207676_10119849
772 Ga0207683_10236099
773 Ga0207428_10137021
774 Ga0268266_10001219
775 Ga0268264_10073464
776 Ga0268264_10198298
777 Ga0265337_1000525
778 Ga0265337_1001800
779 Ga0265337_1002683
780 Ga0265337_1003256
781 Ga0265337_1004826
782 Ga0265337_1006286
783 Ga0265337_1024369
784 Ga0265337_1024980
785 Ga0265326_10000050
786 Ga0265326_10000213
787 Ga0265326_10000774
788 Ga0265326_10018137
789 Ga0265319_1017232
790 Ga0265334_10000206
791 Ga0265334_10005894
792 Ga0265334_10033805
793 Ga0265334_10057623
794 Ga0265318_10008640
795 Ga0265322_10000083
796 Ga0265322_10000778
797 Ga0265322_10003243
798 Ga0265322_10007611
799 Ga0265336_10000020
800 Ga0265336_10001389
801 Ga0265336_10001669
802 Ga0265336_10002056
803 Ga0265336_10040319
804 Ga0265338_10000009
805 Ga0265338_10000093
806 Ga0265338_10000528
807 Ga0265338_10000574
808 Ga0265338_10000979
809 Ga0265338_10002671
810 Ga0265338_10002849
811 Ga0265338_10003712
812 Ga0265338_10008420
813 Ga0265338_10019970
814 Ga0265338_10028914
815 Ga0265338_10028915
816 Ga0265338_10065579
817 Ga0265338_10169970
818 Ga0265324_10000436
819 Ga0265324_10005190
820 Ga0265324_10011994
821 Ga0265324_10051249
822 Ga0265330_10007449
823 Ga0265332_10012174
824 Ga0265328_10022709
825 Ga0265328_10033447
826 Ga0265320_10003577
827 Ga0265320_10017221
828 Ga0265320_10020962
829 Ga0265325_10008281
830 Ga0265325_10011085
831 Ga0265325_10012605
832 Ga0265325_10026800
833 Ga0265325_10063185
834 Ga0265329_10000403
835 Ga0265329_10002542
836 Ga0265340_10011006
837 Ga0265339_10004563
838 Ga0265339_10005202
839 Ga0265339_10009113
840 Ga0265339_10009193
841 Ga0265339_10073000
842 Ga0265339_10076969
843 Ga0265331_10023103
844 Ga0265327_10009958
845 Ga0265316_10000518
846 Ga0265316_10045392
847 Ga0265316_10060811
848 Ga0265316_10132973
849 Ga0307513_10198369
850 Ga0307513_10281041
851 Ga0307408_100022361
852 Ga0307408_100036540
853 Ga0265313_10001093
854 Ga0265313_10097413
855 Ga0265314_10000210
856 Ga0265314_10006767
857 Ga0265314_10023230
858 Ga0265342_10005282
859 Ga0316578_10010146
860 Ga0307405_10065260
861 Ga0316577_10027094
862 Ga0316577_10164249
863 Ga0307413_10114167
864 Ga0307410_10031849
865 Ga0307416_100228525
866 Ga0307416_100232082
867 Ga0307414_10010562
868 Ga0307411_10115320
869 Ga0373943_0119757
870 Ga0316574_0025872
871 Ga0316582_0009206
872 Ga0316584_0020888
873 Ga0316584_0036566
874 Ga0373925_0043614
875 Ga0373925_0324221
876 Ga0436364_1227686
877 Ga0436364_1427966
878 Ga0436365_0085279
879 Ga0436365_0279620
880 Ga0436365_1284809
881 Ga0436365_1486090
882 Ga0436365_1760044
883 Ga0436363_0594532
884 Ga0436363_0915897
885 Ga0439434_0003574
886 Ga0451577_0006654
887 Ga0451577_0039462
888 Ga0451577_0139632
889 Ga0451577_0318614
890 Ga0453683_0000218
891 Ga0466963_0160132
892 Ga0453684_0000010
893 Ga0453684_0000255
894 Ga0453684_0004079
895 Ga0453684_0004653
896 Ga0453684_0004840
897 Ga0453684_0012916
898 Ga0453684_0042964
899 Ga0453684_0050400
900 Ga0453684_0274505
901 Ga0453684_0350560
902 Ga0453684_0363629
903 Ga0453684_0467829
904 Ga0453684_0472477
905 Ga0451576_0030898
906 Ga0451576_0072064
907 Ga0451576_0151719
908 Ga0451576_0182365
909 Ga0451576_0329146
910 Ga0451576_0440236
911 Ga0466967_0039835
912 Ga0466967_0046670
913 Ga0466967_0503199
914 Ga0495592_0000052
915 Ga0495580_0019109
916 Ga0495662_0061788
917 Ga0495664_0079672
918 Ga0495618_0004336
919 Ga0495628_0000601
920 Ga0495630_0000024
921 Ga0495666_0065389
922 Ga0495652_0132055
923 Ga0495665_0114704
924 Ga0495640_0038996
925 Ga0495586_0000006
926 Ga0495586_0003544
927 Ga0495586_0018895
928 Ga0495645_0029162
929 Ga0495633_0050414
930 Ga0495646_0132721
931 Ga0495658_0010511
932 Ga0495658_0100924
933 Ga0495581_0077048
934 Ga0495636_0018516
935 Ga0495674_0000441
936 Ga0496104_0068153
937 Ga0496105_0088707
938 Ga0496107_0009183
939 Ga0496108_0108733
940 Ga0496109_0050166
941 Ga0496110_0054363
942 Ga0496112_0053459
943 Ga0496112_0133932
944 Ga0496112_0216697
945 Ga0496114_0007100
946 Ga0496114_0009460
947 Ga0496124_0022670
948 Ga0501038_0017740
949 Ga0501040_0137868
950 Ga0501042_0228869
951 Ga0501047_0000682
952 Ga0501067_0010705
953 Ga0501068_0000004
954 Ga0501069_0024733
955 Ga0501069_0188696
956 Ga0501070_0019188
957 Ga0501070_0054167
958 Ga0501072_0000002
959 Ga0501073_0000440
960 Ga0501074_0004803
961 Ga0501074_0029024
962 Ga0501076_0085622
963 Ga0501077_0001070
964 Ga0501080_0045621
965 Ga0501080_0181797
966 Ga0501081_0074241
967 Ga0501081_0115749
968 Ga0501083_0044952
969 Ga0501083_0054699
970 Ga0501035_0122866
971 nmdc:mga0k408_199_c1
972 nmdc:mga0k408_297_c1
973 nmdc:mga06z11_4303_c1
974 nmdc:mga05p37_122244_c1
975 nmdc:mga05p37_151478_c1
976 nmdc:mga05p37_16577_c1
977 nmdc:mga05p37_201739_c1
978 nmdc:mga05p37_2071_c1
979 nmdc:mga05p37_26675_c1
980 nmdc:mga05p37_27395_c1
981 nmdc:mga05p37_296933_c1
982 nmdc:mga05p37_32376_c1
983 nmdc:mga05p37_450955_c1
984 nmdc:mga05p37_4917_c1
985 nmdc:mga09592_10754_c1
986 nmdc:mga09592_5260_c1
987 nmdc:mga0qj67_293035_c1
988 nmdc:mga0qj67_43182_c1
989 nmdc:mga0qj67_4862_c1
990 nmdc:mga06r32_104074_c1
991 nmdc:mga06r32_14050_c1
992 nmdc:mga06r32_301924_c1
993 nmdc:mga08y16_53586_c1
994 nmdc:mga0n895_216995_c1
995 nmdc:mga0n895_243032_c1
996 nmdc:mga0n895_28553_c1
997 nmdc:mga0n895_340426_c1
998 nmdc:mga0n895_4426_c1
999 nmdc:mga0rr50_62141_c1
1000 nmdc:mga08x19_20297_c1
1001 nmdc:mga08x19_2350_c1
1002 nmdc:mga0a205_15920_c1
1003 nmdc:mga0a205_2226_c1
1004 nmdc:mga0a205_410932_c1
1005 nmdc:mga0a205_41095_c1
1006 nmdc:mga0a205_75431_c1
1007 Ga0501084_0000024
1008 Ga0590075_017341
1009 Ga0501082_0000035
1010 Ga0530510_0268603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

277

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

34

344

0.98

PF04321

RmlD_sub_bind

RmlD substrate binding domain

31

236

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n7h-assembly1.cif.gz_A-2 crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp 0.9752 1 328
1rpn-assembly3.cif.gz_C crystal structure of gdp-d-mannose 4,6-dehydratase in complexes with gdp and nadph 0.972 1 326
5uzh-assembly1.cif.gz_A crystal structure of a gdp-mannose dehydratase from naegleria fowleri 0.9718 1 325
1n7h-assembly1.cif.gz_B-2 crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp 0.9716 1 328
5in5-assembly1.cif.gz_B crystal structure of gdp-mannose 4,6 dehydratase in complex with natural inhibitor gdp-fucose 0.9714 2 328
ID Description Score Start End Superfamily
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9907 2 266 3.40.50.720
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.976 2 266 3.40.50.720
af_F1QPT3_45_368_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 25 320 3.40.50.720
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9525 190 303 3.90.25.10
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 1 147 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A146LA67-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) 0.9983 124 269 GO:0008446
GO:0042351
AF-A0A3C0G369-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.997 204 298 GO:0008446
GO:0042351
AF-A0A2V5T8D5-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9958 208 328 GO:0008446
GO:0042351
AF-A0A2G9YHF7-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.993 97 324 GO:0008446
GO:0042351
AF-A0A382CEB6-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9923 60 226 GO:0008446
GO:0042351

Map