F456468

General Info

Members Datasets Scaffolds Average Seq Length
506 264 506 361

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100058236|Ga0070689_1000582363
Length 402
Sequence MVVGGVPPPTTPIRSRSSQACIRTPSDTSYGAMETTTIPPSAPPAARARPLAAVRRFAGRWGLIAALAALPVYYGIHDLTVGYQAGVVAGHTVIRHDLSNLGFNFAVGLSNGAIWALIAIGYTLVYGIIELINFAHGDVFMIGSFTAVGLYAVFGLTSATGGAWLIVGLLIIXXXTMLVTGSLNVLIERVAYRPLRNAPKLAPLITAVGFSFILQNVGLLWRGGSPQSVPDLINVQQTVFTIAGVPIQRGYILAFAVMIPLVFALGWFINSTHAGRAMRATAQDPEAARLMGINVNATISLTFLLGGMLAGAAGLVYALYQTNVWFFQGFKAGLIAFTAAVMGGIGNVRGAVLGGLIIGVIQALSDSRLGPQWTEAVVFGYLIAIMVLRPRGLLGEETREAG

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
167 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
168 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 2.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 5.53
Rhizosphere 88.34
Stem 0
Stem Tuber 0
Unclassified 3.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10003239 3300003659 Bacteria 3191
2 Ga0070658_10133567 3300005327 Bacteria 2069
3 Ga0070676_10042565 3300005328 Bacteria 2638
4 Ga0070683_100010185 3300005329 Bacteria 8072
5 Ga0070683_100030971 3300005329 Bacteria 4861
6 Ga0070683_100293721 3300005329 Bacteria 1546
7 Ga0070680_100001012 3300005336 Bacteria 20047
8 Ga0070680_100025464 3300005336 Bacteria 4729
9 Ga0070682_100023454 3300005337 Bacteria 3662
10 Ga0070682_100040364 3300005337 Bacteria 2871
11 Ga0070660_100011479 3300005339 Bacteria 6297
12 Ga0070689_100058236 3300005340 Bacteria 3000
13 Ga0070691_10084795 3300005341 Bacteria 1555
14 Ga0070687_100063891 3300005343 Bacteria 1954
15 Ga0070661_100016956 3300005344 Bacteria 5159
16 Ga0070692_10045103 3300005345 Bacteria 2273
17 Ga0070668_100016783 3300005347 Bacteria 5475
18 Ga0070674_100197929 3300005356 Bacteria 1550
19 Ga0070659_100008196 3300005366 Bacteria 7627
20 Ga0070659_100063885 3300005366 Bacteria 2913
21 Ga0070659_100181314 3300005366 Bacteria 1728
22 Ga0070709_10018784 3300005434 Bacteria 3989
23 Ga0070709_10092038 3300005434 Bacteria 2002
24 Ga0070714_100004074 3300005435 Bacteria 10982
25 Ga0070714_100008251 3300005435 Bacteria 8122
26 Ga0070714_100070174 3300005435 Bacteria 3028
27 Ga0070714_100089187 3300005435 Bacteria 2699
28 Ga0070714_100141362 3300005435 Bacteria 2161
29 Ga0070713_100005937 3300005436 Bacteria 8394
30 Ga0070713_100024252 3300005436 Bacteria 4722
31 Ga0070713_100040809 3300005436 Bacteria 3776
32 Ga0070710_10009379 3300005437 Bacteria 4786
33 Ga0070701_10070416 3300005438 Bacteria 1868
34 Ga0070700_100019411 3300005441 Bacteria 3922
35 Ga0070708_100002798 3300005445 Bacteria 13552
36 Ga0070708_100200243 3300005445 Bacteria 1869
37 Ga0070663_100020319 3300005455 Bacteria 4395
38 Ga0070663_100174535 3300005455 Bacteria 1663
39 Ga0070662_100000228 3300005457 Bacteria 33120
40 Ga0070681_10011211 3300005458 Bacteria 8867
41 Ga0070681_10064957 3300005458 Bacteria 3619
42 Ga0070681_10160010 3300005458 Bacteria 2175
43 Ga0070706_100180928 3300005467 Bacteria 1968
44 Ga0070707_100112617 3300005468 Bacteria 2639
45 Ga0070707_100177163 3300005468 Bacteria 2078
46 Ga0070707_100346662 3300005468 Bacteria 1443
47 Ga0070698_100097572 3300005471 Bacteria 2914
48 Ga0070698_100120037 3300005471 Bacteria 2589
49 Ga0070698_100122302 3300005471 Bacteria 2561
50 Ga0070679_100000204 3300005530 Bacteria 48597
51 Ga0070679_100013725 3300005530 Bacteria 7760
52 Ga0070679_100013919 3300005530 Bacteria 7708
53 Ga0070679_100098580 3300005530 Bacteria 2910
54 Ga0070679_100165844 3300005530 Bacteria 2182
55 Ga0070684_100085771 3300005535 Bacteria 2793
56 Ga0070684_100157237 3300005535 Bacteria 2061
57 Ga0070672_100040589 3300005543 Bacteria 3571
58 Ga0070695_100108426 3300005545 Bacteria 1880
59 Ga0070693_100021561 3300005547 Bacteria 3413
60 Ga0068857_100110053 3300005577 Bacteria 2475
61 Ga0068857_100137859 3300005577 Bacteria 2204
62 Ga0068857_100160722 3300005577 Bacteria 2038
63 Ga0068854_100082810 3300005578 Bacteria 2372
64 Ga0068856_100029322 3300005614 Bacteria 5375
65 Ga0068856_100054919 3300005614 Bacteria 3930
66 Ga0070702_100033604 3300005615 Bacteria 2821
67 Ga0068852_100014836 3300005616 Bacteria 6020
68 Ga0068852_100175957 3300005616 Bacteria 2009
69 Ga0068864_100040082 3300005618 Bacteria 4006
70 Ga0068864_100222287 3300005618 Bacteria 1743
71 Ga0068861_100031418 3300005719 Bacteria 3901
72 Ga0068861_100058303 3300005719 Bacteria 2952
73 Ga0068861_100177740 3300005719 Bacteria 1769
74 Ga0068863_100167143 3300005841 Bacteria 2109
75 Ga0081455_10014804 3300005937 Bacteria 7611
76 Ga0081538_10001779 3300005981 Bacteria 21748
77 Ga0081538_10007367 3300005981 Bacteria 9529
78 Ga0081540_1000872 3300005983 Bacteria 27288
79 Ga0070717_10023195 3300006028 Bacteria 4914
80 Ga0070717_10032204 3300006028 Bacteria 4223
81 Ga0070717_10156076 3300006028 Bacteria 1977
82 Ga0075365_10001060 3300006038 Bacteria 11881
83 Ga0075365_10004540 3300006038 Bacteria 7373
84 Ga0075365_10132845 3300006038 Bacteria 1723
85 Ga0075363_100015179 3300006048 Bacteria 3780
86 Ga0075363_100025093 3300006048 Bacteria 3036
87 Ga0075364_10005988 3300006051 Bacteria 7106
88 Ga0070715_10014617 3300006163 Bacteria 2910
89 Ga0070712_100000001 3300006175 Bacteria 343916
90 Ga0070712_100001756 3300006175 Bacteria 13263
91 Ga0075428_100238683 3300006844 Bacteria 1961
92 Ga0075431_100016931 3300006847 Bacteria 7401
93 Ga0075434_100013742 3300006871 Bacteria 7720
94 Ga0075434_100144129 3300006871 Bacteria 2402
95 Ga0075435_100016045 3300007076 Bacteria 5641
96 Ga0105240_10025691 3300009093 Bacteria 7737
97 Ga0105240_10050937 3300009093 Bacteria 5214
98 Ga0111539_10017818 3300009094 Bacteria 8794
99 Ga0111539_10403551 3300009094 Bacteria 1592
100 Ga0111539_10466848 3300009094 Bacteria 1470
101 Ga0105245_10003111 3300009098 Bacteria 14844
102 Ga0105245_10025746 3300009098 Bacteria 5173
103 Ga0105245_10089930 3300009098 Bacteria 2823
104 Ga0114129_10002456 3300009147 Bacteria 25728
105 Ga0114129_10456517 3300009147 Bacteria 1675
106 Ga0105243_10011559 3300009148 Bacteria 6679
107 Ga0105241_10148665 3300009174 Bacteria 1914
108 Ga0105242_10113979 3300009176 Bacteria 2309
109 Ga0105237_10023248 3300009545 Bacteria 6354
110 Ga0105237_10223611 3300009545 Bacteria 1883
111 Ga0105249_10001858 3300009553 Bacteria 18327
112 Ga0105249_10156287 3300009553 Bacteria 2200
113 Ga0099796_10002435 3300010159 Bacteria 4077
114 Ga0157342_1000736 3300012507 Bacteria 2164
115 Ga0157369_10004530 3300013105 Bacteria 16351
116 Ga0157369_10056674 3300013105 Bacteria 4228
117 Ga0157369_10106424 3300013105 Bacteria 2985
118 Ga0157369_10160004 3300013105 Bacteria 2377
119 Ga0157378_10038485 3300013297 Bacteria 4239
120 Ga0163162_10134839 3300013306 Bacteria 2579
121 Ga0157372_10027328 3300013307 Bacteria 6213
122 Ga0157372_10166233 3300013307 Bacteria 2551
123 Ga0157372_10516422 3300013307 Bacteria 1393
124 Ga0163161_10027879 3300017792 Bacteria 4007
125 Ga0206356_10098088 3300020070 Bacteria 4422
126 Ga0206356_10514390 3300020070 Bacteria 1807
127 Ga0206356_11054030 3300020070 Bacteria 1794
128 Ga0206351_10903194 3300020077 Bacteria 3504
129 Ga0206352_10017727 3300020078 Bacteria 2871
130 Ga0206354_10028139 3300020081 Bacteria 2920
131 Ga0206354_10761416 3300020081 Bacteria 2641
132 Ga0206353_10012049 3300020082 Bacteria 3972
133 Ga0213873_10008871 3300021358 Bacteria 2070
134 Ga0213874_10011007 3300021377 Bacteria 2279
135 Ga0213875_10000351 3300021388 Bacteria 43186
136 Ga0213875_10005819 3300021388 Bacteria 6558
137 Ga0213875_10007675 3300021388 Bacteria 5558
138 Ga0224712_10001507 3300022467 Bacteria 5396
139 Ga0224712_10007929 3300022467 Bacteria 3114
140 Ga0207426_1018101 3300025302 Bacteria 2489
141 Ga0207692_10001183 3300025898 Bacteria 9671
142 Ga0207692_10022846 3300025898 Bacteria 2884
143 Ga0207692_10050903 3300025898 Bacteria 2097
144 Ga0207688_10019068 3300025901 Bacteria 3733
145 Ga0207688_10059029 3300025901 Bacteria 2160
146 Ga0207680_10088943 3300025903 Bacteria 1959
147 Ga0207647_10037122 3300025904 Bacteria 3091
148 Ga0207685_10000802 3300025905 Bacteria 5818
149 Ga0207699_10001387 3300025906 Bacteria 11518
150 Ga0207699_10003133 3300025906 Bacteria 7858
151 Ga0207699_10064357 3300025906 Bacteria 2218
152 Ga0207699_10068206 3300025906 Bacteria 2165
153 Ga0207699_10148725 3300025906 Bacteria 1547
154 Ga0207645_10179657 3300025907 Bacteria 1388
155 Ga0207643_10106827 3300025908 Bacteria 1646
156 Ga0207684_10043549 3300025910 Bacteria 3806
157 Ga0207707_10002802 3300025912 Bacteria 15551
158 Ga0207707_10025335 3300025912 Bacteria 5188
159 Ga0207707_10046201 3300025912 Bacteria 3792
160 Ga0207695_10079591 3300025913 Bacteria 3321
161 Ga0207671_10033201 3300025914 Bacteria 3840
162 Ga0207693_10000002 3300025915 Bacteria 304011
163 Ga0207693_10002518 3300025915 Bacteria 15926
164 Ga0207693_10007864 3300025915 Bacteria 8755
165 Ga0207663_10004052 3300025916 Bacteria 7264
166 Ga0207663_10018908 3300025916 Bacteria 3870
167 Ga0207663_10057237 3300025916 Bacteria 2455
168 Ga0207663_10100875 3300025916 Bacteria 1938
169 Ga0207660_10007260 3300025917 Bacteria 7170
170 Ga0207662_10018465 3300025918 Bacteria 3958
171 Ga0207662_10027736 3300025918 Bacteria 3270
172 Ga0207657_10015109 3300025919 Bacteria 7499
173 Ga0207657_10015334 3300025919 Bacteria 7427
174 Ga0207649_10035646 3300025920 Bacteria 2991
175 Ga0207652_10002601 3300025921 Bacteria 15145
176 Ga0207652_10011258 3300025921 Bacteria 7207
177 Ga0207652_10051347 3300025921 Bacteria 3535
178 Ga0207652_10066588 3300025921 Bacteria 3122
179 Ga0207646_10186207 3300025922 Bacteria 1875
180 Ga0207687_10022259 3300025927 Bacteria 4216
181 Ga0207700_10004837 3300025928 Bacteria 7997
182 Ga0207700_10007366 3300025928 Bacteria 6722
183 Ga0207700_10024965 3300025928 Bacteria 4143
184 Ga0207700_10036834 3300025928 Bacteria 3537
185 Ga0207700_10037108 3300025928 Bacteria 3526
186 Ga0207664_10002719 3300025929 Bacteria 11734
187 Ga0207664_10070971 3300025929 Bacteria 2804
188 Ga0207664_10088745 3300025929 Bacteria 2531
189 Ga0207664_10121032 3300025929 Bacteria 2190
190 Ga0207644_10195658 3300025931 Bacteria 1592
191 Ga0207690_10008512 3300025932 Bacteria 6085
192 Ga0207706_10001621 3300025933 Bacteria 22314
193 Ga0207706_10079823 3300025933 Bacteria 2877
194 Ga0207706_10091659 3300025933 Bacteria 2672
195 Ga0207709_10066352 3300025935 Bacteria 2273
196 Ga0207704_10223401 3300025938 Bacteria 1395
197 Ga0207665_10003575 3300025939 Bacteria 10391
198 Ga0207665_10006671 3300025939 Bacteria 7659
199 Ga0207691_10076316 3300025940 Bacteria 3020
200 Ga0207691_10190992 3300025940 Bacteria 1786
201 Ga0207689_10016519 3300025942 Bacteria 6247
202 Ga0207661_10000787 3300025944 Bacteria 20667
203 Ga0207661_10008782 3300025944 Bacteria 7229
204 Ga0207661_10119893 3300025944 Bacteria 2238
205 Ga0207679_10175746 3300025945 Bacteria 1767
206 Ga0207712_10014419 3300025961 Bacteria 5085
207 Ga0207668_10048889 3300025972 Bacteria 2904
208 Ga0207640_10114648 3300025981 Bacteria 1918
209 Ga0207703_10102603 3300026035 Bacteria 2427
210 Ga0207678_10004203 3300026067 Bacteria 12924
211 Ga0207678_10008864 3300026067 Bacteria 8858
212 Ga0207678_10036643 3300026067 Bacteria 4270
213 Ga0207708_10006995 3300026075 Bacteria 8342
214 Ga0207708_10023527 3300026075 Bacteria 4659
215 Ga0207708_10024967 3300026075 Bacteria 4521
216 Ga0207702_10088103 3300026078 Bacteria 2711
217 Ga0207702_10125076 3300026078 Bacteria 2307
218 Ga0207702_10255429 3300026078 Bacteria 1648
219 Ga0207702_10328816 3300026078 Bacteria 1457
220 Ga0207702_10337048 3300026078 Bacteria 1440
221 Ga0207702_10400660 3300026078 Bacteria 1323
222 Ga0207641_10085525 3300026088 Bacteria 2748
223 Ga0207676_10057453 3300026095 Bacteria 3064
224 Ga0207674_10034077 3300026116 Bacteria 5325
225 Ga0207674_10099330 3300026116 Bacteria 2893
226 Ga0207674_10154632 3300026116 Bacteria 2249
227 Ga0207675_100007181 3300026118 Bacteria 10525
228 Ga0207675_100008981 3300026118 Bacteria 9380
229 Ga0207675_100011096 3300026118 Bacteria 8443
230 Ga0207683_10029221 3300026121 Bacteria 4772
231 Ga0207698_10033802 3300026142 Bacteria 3720
232 Ga0207698_10103941 3300026142 Bacteria 2362
233 Ga0207428_10016678 3300027907 Bacteria 6317
234 Ga0268265_10116965 3300028380 Bacteria 2189
235 Ga0307508_10164789 3300031616 Bacteria 1820
236 Ga0307405_10041928 3300031731 Bacteria 2783
237 Ga0307413_10078028 3300031824 Bacteria 2111
238 Ga0307413_10097955 3300031824 Bacteria 1929
239 Ga0307410_10042149 3300031852 Bacteria 3015
240 Ga0307410_10062122 3300031852 Bacteria 2558
241 Ga0307406_10007513 3300031901 Bacteria 6048
242 Ga0307406_10013066 3300031901 Bacteria 4747
243 Ga0307407_10004330 3300031903 Bacteria 6004
244 Ga0307407_10188487 3300031903 Bacteria 1373
245 Ga0307412_10117036 3300031911 Bacteria 1913
246 Ga0307409_100003640 3300031995 Bacteria 8429
247 Ga0307409_100004546 3300031995 Bacteria 7819
248 Ga0307409_100134605 3300031995 Bacteria 2118
249 Ga0307409_100211206 3300031995 Bacteria 1744
250 Ga0307416_100001828 3300032002 Bacteria 11847
251 Ga0307416_100002053 3300032002 Bacteria 11339
252 Ga0307416_100074567 3300032002 Bacteria 2835
253 Ga0307416_100187314 3300032002 Bacteria 1947
254 Ga0307416_100416402 3300032002 Bacteria 1386
255 Ga0307411_10021305 3300032005 Bacteria 3789
256 Ga0307411_10026964 3300032005 Bacteria 3468
257 Ga0307411_10269456 3300032005 Bacteria 1349
258 Ga0307415_100005893 3300032126 Bacteria 6554
259 Ga0307415_100007499 3300032126 Bacteria 5970
260 Ga0307415_100049782 3300032126 Bacteria 2835
261 Ga0373926_0000198 3300035083 Bacteria 13902
262 Ga0373926_0008031 3300035083 Bacteria 3516
263 Ga0373934_0006728 3300035086 Bacteria 4271
264 Ga0373934_0008451 3300035086 Bacteria 3838
265 Ga0373934_0070117 3300035086 Bacteria 1401
266 Ga0373923_0001993 3300035111 Bacteria 6134
267 Ga0373923_0065950 3300035111 Bacteria 1546
268 Ga0373936_0000937 3300035113 Bacteria 10412
269 Ga0373936_0027952 3300035113 Bacteria 2214
270 Ga0373936_0034544 3300035113 Bacteria 2009
271 Ga0373945_0001521 3300035116 Bacteria 7088
272 Ga0373945_0002562 3300035116 Bacteria 5687
273 Ga0373954_0038205 3300035118 Bacteria 2232
274 Ga0373957_0001502 3300035120 Bacteria 6329
275 Ga0373960_0044967 3300035121 Bacteria 1291
276 Ga0373943_0002798 3300035170 Bacteria 7929
277 Ga0373955_0005607 3300035172 Bacteria 5646
278 Ga0373955_0092066 3300035172 Bacteria 1729
279 Ga0373935_0000645 3300035692 Bacteria 18377
280 Ga0373935_0004740 3300035692 Bacteria 7999
281 Ga0373935_0045559 3300035692 Bacteria 2767
282 Ga0373927_0014547 3300035695 Bacteria 5206
283 Ga0373927_0022327 3300035695 Bacteria 4145
284 Ga0373927_0119826 3300035695 Bacteria 1717
285 Ga0373933_0004617 3300035724 Bacteria 7540
286 Ga0373933_0014236 3300035724 Bacteria 4419
287 Ga0373933_0036462 3300035724 Bacteria 2878
288 Ga0373947_0000005 3300035725 Bacteria 225129
289 Ga0373947_0002640 3300035725 Bacteria 10769
290 Ga0373937_0009768 3300036401 Bacteria 8366
291 Ga0373937_0055658 3300036401 Bacteria 3632
292 Ga0373937_0062410 3300036401 Bacteria 3426
293 Ga0372808_000533 3300036459 Bacteria 3104
294 Ga0373925_0000014 3300037068 Bacteria 180414
295 Ga0395899_0143101 3300037312 Bacteria 1700
296 Ga0395900_0009169 3300037418 Bacteria 10140
297 Ga0395900_0045921 3300037418 Bacteria 4499
298 Ga0395900_0072916 3300037418 Bacteria 3529
299 Ga0395898_0004970 3300037466 Bacteria 14429
300 Ga0395898_0040869 3300037466 Bacteria 4583
301 Ga0395898_0055981 3300037466 Bacteria 3846
302 Ga0395898_0203060 3300037466 Bacteria 1892
303 Ga0395898_0228458 3300037466 Bacteria 1775
304 Ga0395898_0280509 3300037466 Bacteria 1589
305 Ga0395905_0033975 3300037471 Bacteria 4790
306 Ga0395905_0041707 3300037471 Bacteria 4307
307 Ga0436364_0023304 3300037853 Bacteria 14882
308 Ga0436364_0245080 3300037853 Bacteria 5817
309 Ga0436364_0318735 3300037853 Bacteria 4003
310 Ga0436364_0937866 3300037853 Bacteria 2795
311 Ga0436364_1166496 3300037853 Bacteria 2709
312 Ga0436364_1306431 3300037853 Bacteria 12282
313 Ga0395901_0015033 3300038443 Bacteria 7870
314 Ga0395901_0080017 3300038443 Bacteria 3411
315 Ga0395901_0516804 3300038443 Bacteria 1214
316 Ga0436365_0133077 3300039437 Bacteria 13963
317 Ga0436365_0528198 3300039437 Bacteria 3332
318 Ga0436363_0498368 3300039450 Bacteria 4675
319 Ga0436363_0655734 3300039450 Bacteria 1275
320 Ga0436362_1055473 3300039453 Bacteria 1326
321 Ga0436362_1083637 3300039453 Bacteria 1755
322 Ga0439450_032902 3300042008 Bacteria 1173
323 Ga0439463_024817 3300042016 Bacteria 1503
324 Ga0450917_001737 3300042120 Bacteria 1551
325 Ga0466969_0017486 3300044656 Bacteria 3742
326 Ga0466972_0089884 3300044658 Bacteria 1457
327 Ga0466966_0017454 3300044684 Bacteria 4742
328 Ga0466966_0046822 3300044684 Bacteria 2760
329 Ga0466961_0031274 3300044693 Bacteria 3422
330 Ga0466961_0168706 3300044693 Bacteria 1362
331 Ga0466963_0011018 3300044694 Bacteria 5496
332 Ga0466963_0034291 3300044694 Bacteria 3302
333 Ga0466963_0059115 3300044694 Bacteria 2558
334 Ga0466963_0211460 3300044694 Bacteria 1357
335 Ga0466971_0032083 3300044719 Bacteria 2354
336 Ga0466968_0018885 3300044735 Bacteria 2769
337 Ga0466957_0054287 3300044842 Bacteria 2445
338 Ga0466960_0038636 3300044901 Bacteria 2246
339 Ga0466959_0002187 3300045049 Bacteria 12432
340 Ga0466959_0018691 3300045049 Bacteria 5090
341 Ga0466959_0025232 3300045049 Bacteria 4404
342 Ga0466959_0184593 3300045049 Bacteria 1458
343 Ga0466958_0000409 3300045836 Bacteria 17656
344 Ga0466958_0006068 3300045836 Bacteria 6549
345 Ga0466958_0014786 3300045836 Bacteria 4460
346 Ga0466958_0071046 3300045836 Bacteria 2131
347 Ga0466967_0005625 3300045976 Bacteria 8718
348 Ga0466967_0009195 3300045976 Bacteria 7315
349 Ga0466967_0021539 3300045976 Bacteria 5240
350 Ga0466967_0022736 3300045976 Bacteria 5124
351 Ga0466967_0064783 3300045976 Bacteria 3251
352 Ga0466967_0068449 3300045976 Bacteria 3170
353 Ga0466967_0139580 3300045976 Bacteria 2256
354 Ga0466967_0188747 3300045976 Bacteria 1947
355 Ga0466967_0190647 3300045976 Bacteria 1937
356 Ga0466967_0251200 3300045976 Bacteria 1689
357 Ga0495592_0006745 3300046454 Bacteria 8562
358 Ga0495592_0053829 3300046454 Bacteria 2983
359 Ga0495603_0002037 3300046455 Bacteria 11897
360 Ga0495629_0013207 3300046459 Bacteria 5963
361 Ga0495641_0039610 3300046461 Bacteria 2197
362 Ga0495641_0086869 3300046461 Bacteria 1399
363 Ga0495651_0005538 3300046462 Bacteria 9629
364 Ga0495651_0019918 3300046462 Bacteria 5203
365 Ga0495653_0001842 3300046463 Bacteria 16737
366 Ga0495653_0012758 3300046463 Bacteria 6861
367 Ga0495653_0027769 3300046463 Bacteria 4529
368 Ga0495650_0000012 3300046471 Bacteria 613144
369 Ga0495580_0020768 3300046472 Bacteria 4854
370 Ga0495582_0013369 3300046473 Bacteria 4518
371 Ga0495582_0147009 3300046473 Bacteria 1337
372 Ga0495639_0006736 3300046475 Bacteria 4941
373 Ga0495662_0015787 3300046476 Bacteria 3665
374 Ga0495662_0072273 3300046476 Bacteria 1672
375 Ga0495664_0000438 3300046477 Bacteria 20456
376 Ga0495664_0015428 3300046477 Bacteria 4342
377 Ga0495664_0166864 3300046477 Bacteria 1336
378 Ga0495594_0083325 3300046499 Bacteria 1788
379 Ga0495596_0070261 3300046500 Bacteria 1361
380 Ga0495608_0025589 3300046511 Bacteria 4028
381 Ga0495608_0052434 3300046511 Bacteria 2700
382 Ga0495608_0080040 3300046511 Bacteria 2124
383 Ga0495608_0164366 3300046511 Bacteria 1410
384 Ga0495618_0017904 3300046514 Bacteria 4346
385 Ga0495618_0039052 3300046514 Bacteria 2984
386 Ga0495628_0027320 3300046516 Bacteria 4645
387 Ga0495628_0096325 3300046516 Bacteria 2286
388 Ga0495630_0176871 3300046517 Bacteria 1627
389 Ga0495666_0002957 3300046526 Bacteria 8515
390 Ga0495652_0028368 3300046529 Bacteria 4925
391 Ga0495652_0071138 3300046529 Bacteria 2905
392 Ga0495665_0006292 3300046531 Bacteria 6407
393 Ga0495665_0015679 3300046531 Bacteria 4079
394 Ga0495665_0047641 3300046531 Bacteria 2273
395 Ga0495586_0010046 3300046535 Bacteria 5038
396 Ga0495587_0004272 3300046536 Bacteria 9437
397 Ga0495587_0030525 3300046536 Bacteria 3268
398 Ga0495645_0012453 3300046543 Bacteria 5994
399 Ga0495667_0008480 3300046559 Bacteria 6975
400 Ga0495667_0010259 3300046559 Bacteria 6336
401 Ga0495667_0012155 3300046559 Bacteria 5833
402 Ga0495667_0034219 3300046559 Bacteria 3397
403 Ga0495656_0010431 3300046615 Bacteria 3379
404 Ga0495634_0119732 3300046642 Bacteria 1686
405 Ga0495635_0003852 3300046663 Bacteria 10419
406 Ga0495635_0013353 3300046663 Bacteria 5749
407 Ga0495635_0022251 3300046663 Bacteria 4414
408 Ga0495635_0044574 3300046663 Bacteria 3060
409 Ga0495588_0008575 3300046674 Bacteria 4696
410 Ga0495657_0015872 3300046675 Bacteria 5499
411 Ga0495657_0027115 3300046675 Bacteria 4047
412 Ga0495599_0023430 3300046678 Bacteria 3860
413 Ga0495599_0092398 3300046678 Bacteria 1888
414 Ga0495623_0019689 3300046679 Bacteria 4362
415 Ga0495647_0076349 3300046681 Bacteria 1350
416 Ga0495658_0063144 3300046683 Bacteria 2130
417 Ga0495613_0009122 3300046689 Bacteria 7355
418 Ga0495600_0003881 3300046809 Bacteria 8871
419 Ga0495581_0184179 3300047315 Bacteria 1221
420 Ga0495604_0003452 3300047317 Bacteria 12601
421 Ga0495604_0007445 3300047317 Bacteria 8670
422 Ga0495604_0023642 3300047317 Bacteria 4904
423 Ga0495674_0000971 3300047319 Bacteria 27478
424 Ga0495674_0018374 3300047319 Bacteria 6508
425 Ga0495676_0028866 3300047321 Bacteria 4731
426 Ga0495680_0005871 3300047322 Bacteria 11485
427 Ga0495680_0016546 3300047322 Bacteria 6331
428 Ga0495680_0016629 3300047322 Bacteria 6312
429 Ga0495680_0035749 3300047322 Bacteria 3997
430 Ga0495680_0157937 3300047322 Bacteria 1648
431 Ga0495675_0002317 3300047444 Bacteria 11377
432 Ga0495684_0001272 3300047471 Bacteria 20300
433 Ga0495684_0008339 3300047471 Bacteria 8032
434 Ga0495684_0028032 3300047471 Bacteria 4325
435 Ga0495684_0048069 3300047471 Bacteria 3262
436 Ga0495593_0016205 3300047673 Bacteria 4206
437 Ga0495593_0120047 3300047673 Bacteria 1338
438 Ga0495602_0014526 3300048088 Bacteria 7990
439 Ga0495602_0031671 3300048088 Bacteria 4995
440 Ga0496101_0007968 3300048904 Bacteria 6903
441 Ga0496102_0007601 3300048905 Bacteria 9261
442 Ga0496104_0013851 3300048907 Bacteria 7275
443 Ga0496104_0031700 3300048907 Bacteria 4917
444 Ga0496104_0217101 3300048907 Bacteria 1824
445 Ga0496105_0017380 3300048908 Bacteria 5765
446 Ga0496105_0114618 3300048908 Bacteria 2223
447 Ga0496105_0206483 3300048908 Bacteria 1602
448 Ga0496106_0001712 3300048909 Bacteria 16367
449 Ga0496107_0003028 3300048910 Bacteria 11140
450 Ga0496108_0090950 3300048911 Bacteria 2594
451 Ga0496108_0187190 3300048911 Bacteria 1793
452 Ga0496108_0244849 3300048911 Bacteria 1560
453 Ga0496109_0049123 3300048912 Bacteria 3840
454 Ga0496109_0068100 3300048912 Bacteria 3262
455 Ga0496110_0195906 3300048913 Bacteria 1835
456 Ga0496111_0116022 3300048914 Bacteria 1974
457 Ga0496112_0000001 3300048915 Bacteria 1346031
458 Ga0496112_0037937 3300048915 Bacteria 4705
459 Ga0496112_0358260 3300048915 Bacteria 1401
460 Ga0496113_0037208 3300048916 Bacteria 3569
461 Ga0496113_0072003 3300048916 Bacteria 2630
462 Ga0496114_0057702 3300048917 Bacteria 3241
463 Ga0496114_0185495 3300048917 Bacteria 1818
464 Ga0496114_0411016 3300048917 Bacteria 1198
465 Ga0496115_0003526 3300048918 Bacteria 11246
466 Ga0496115_0006449 3300048918 Bacteria 8600
467 Ga0496115_0012668 3300048918 Bacteria 6355
468 Ga0496119_0116872 3300048922 Bacteria 1471
469 Ga0496121_0058225 3300048924 Bacteria 3196
470 Ga0496126_0040856 3300048929 Bacteria 4297
471 Ga0501037_0077695 3300049573 Bacteria 2409
472 Ga0501039_0027576 3300049575 Bacteria 4367
473 Ga0501039_0072100 3300049575 Bacteria 2684
474 Ga0501040_0029446 3300049576 Bacteria 3706
475 Ga0501040_0323708 3300049576 Bacteria 1103
476 Ga0501048_0179800 3300049582 Bacteria 1499
477 Ga0501071_0041249 3300049587 Bacteria 3305
478 Ga0501071_0126951 3300049587 Bacteria 1894
479 Ga0501072_0136363 3300049588 Bacteria 1956
480 Ga0501072_0315532 3300049588 Bacteria 1242
481 Ga0501074_0087296 3300049590 Bacteria 2234
482 Ga0501077_0022464 3300049593 Bacteria 3996
483 Ga0501079_0054435 3300049741 Bacteria 3086
484 Ga0501081_0027753 3300049743 Bacteria 3817
485 Ga0501266_006425 3300049763 Bacteria 1462
486 Ga0501044_0194544 3300049823 Bacteria 1989
487 Ga0501045_0018587 3300049824 Bacteria 4945
488 Ga0501045_0075191 3300049824 Bacteria 2488
489 nmdc:mga0yw44_12107_c1 3300050492 Bacteria 4483
490 nmdc:mga0yw44_26652_c1 3300050492 Bacteria 3304
491 nmdc:mga0yw44_561_c1 3300050492 Bacteria 13429
492 nmdc:mga0yw44_564_c1 3300050492 Bacteria 10112
493 nmdc:mga05p37_30118_c1 3300050507 Bacteria 6622
494 nmdc:mga05p37_515997_c1 3300050507 Bacteria 1368
495 nmdc:mga05p37_603543_c1 3300050507 Bacteria 1238
496 nmdc:mga09592_85778_c1 3300050508 Bacteria 2686
497 nmdc:mga08y16_219310_c1 3300050511 Bacteria 1969
498 nmdc:mga08y16_43555_c1 3300050511 Bacteria 4704
499 nmdc:mga08y16_8138_c1 3300050511 Bacteria 10969
500 nmdc:mga0rr50_12634_c1 3300050513 Bacteria 5467
501 Ga0500568_0062023 3300053139 Bacteria 1445
502 Ga0501084_0100834 3300054114 Bacteria 2424
503 Ga0466962_0007902 3300061719 Bacteria 5100
504 Ga0466962_0011312 3300061719 Bacteria 4297
505 Ga0530510_0063223 3300061734 Bacteria 2680
506 Ga0530510_0101813 3300061734 Bacteria 2100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10106827 Ga0207643_101068272 319
2 3300046471 Ga0495650_0000012 Ga0495650_0000012_538008_539078 321
3 3300005530 Ga0070679_100098580 Ga0070679_1000985802 325
4 3300005535 Ga0070684_100085771 Ga0070684_1000857713 325
5 3300025912 Ga0207707_10046201 Ga0207707_100462013 325
6 3300025944 Ga0207661_10008782 Ga0207661_100087823 325
7 3300045976 Ga0466967_0064783 Ga0466967_0064783_1927_2991 325
8 3300039453 Ga0436362_1055473 Ga0436362_1055473_73_1110 328
9 3300044719 Ga0466971_0032083 Ga0466971_0032083_303_1361 328
10 3300013307 Ga0157372_10166233 Ga0157372_101662332 330
11 3300005436 Ga0070713_100005937 Ga0070713_1000059374 331
12 3300005937 Ga0081455_10014804 Ga0081455_100148046 331
13 3300006048 Ga0075363_100025093 Ga0075363_1000250933 331
14 3300045976 Ga0466967_0251200 Ga0466967_0251200_513_1577 333
15 3300046511 Ga0495608_0080040 Ga0495608_0080040_493_1494 333
16 3300061734 Ga0530510_0063223 Ga0530510_0063223_437_1507 333
17 3300031903 Ga0307407_10188487 Ga0307407_101884872 334
18 3300005719 Ga0068861_100177740 Ga0068861_1001777402 335
19 3300045976 Ga0466967_0188747 Ga0466967_0188747_374_1432 335
20 3300048907 Ga0496104_0031700 Ga0496104_0031700_3775_4857 335
21 3300048911 Ga0496108_0244849 Ga0496108_0244849_79_1161 335
22 3300048913 Ga0496110_0195906 Ga0496110_0195906_538_1620 335
23 3300048917 Ga0496114_0185495 Ga0496114_0185495_135_1217 335
24 3300005356 Ga0070674_100197929 Ga0070674_1001979292 336
25 3300025904 Ga0207647_10037122 Ga0207647_100371223 336
26 3300039453 Ga0436362_1083637 Ga0436362_1083637_579_1634 336
27 3300044735 Ga0466968_0018885 Ga0466968_0018885_206_1279 336
28 3300048904 Ga0496101_0007968 Ga0496101_0007968_2638_3648 336
29 3300048905 Ga0496102_0007601 Ga0496102_0007601_5106_6116 336
30 3300048909 Ga0496106_0001712 Ga0496106_0001712_5610_6620 336
31 3300048910 Ga0496107_0003028 Ga0496107_0003028_1838_2848 336
32 3300048912 Ga0496109_0049123 Ga0496109_0049123_259_1269 336
33 3300048917 Ga0496114_0057702 Ga0496114_0057702_1424_2434 336
34 3300048918 Ga0496115_0012668 Ga0496115_0012668_3317_4327 336
35 3300053139 Ga0500568_0062023 Ga0500568_0062023_55_1110 336
36 3300005366 Ga0070659_100181314 Ga0070659_1001813142 337
37 3300039437 Ga0436365_0133077 Ga0436365_0133077_3853_4911 337
38 3300039450 Ga0436363_0498368 Ga0436363_0498368_1909_2967 337
39 3300044694 Ga0466963_0211460 Ga0466963_0211460_89_1159 337
40 3300045976 Ga0466967_0005625 Ga0466967_0005625_760_1815 337
41 3300009093 Ga0105240_10050937 Ga0105240_100509372 338
42 3300009174 Ga0105241_10148665 Ga0105241_101486652 338
43 3300042008 Ga0439450_032902 Ga0439450_032902_58_1140 338
44 3300042016 Ga0439463_024817 Ga0439463_024817_399_1481 338
45 3300042120 Ga0450917_001737 Ga0450917_001737_97_1179 338
46 3300045976 Ga0466967_0009195 Ga0466967_0009195_68_1126 338
47 3300048907 Ga0496104_0217101 Ga0496104_0217101_189_1205 338
48 3300005981 Ga0081538_10007367 Ga0081538_100073673 340
49 3300049576 Ga0501040_0323708 Ga0501040_0323708_30_1052 340
50 3300006038 Ga0075365_10132845 Ga0075365_101328452 342
51 3300005329 Ga0070683_100293721 Ga0070683_1002937212 343
52 3300025302 Ga0207426_1018101 Ga0207426_10181012 343
53 3300037466 Ga0395898_0055981 Ga0395898_0055981_473_1534 343
54 3300038443 Ga0395901_0080017 Ga0395901_0080017_300_1361 343
55 3300044684 Ga0466966_0017454 Ga0466966_0017454_2533_3600 343
56 3300045049 Ga0466959_0018691 Ga0466959_0018691_2987_4054 343
57 3300045836 Ga0466958_0006068 Ga0466958_0006068_2220_3287 343
58 3300048924 Ga0496121_0058225 Ga0496121_0058225_1695_2750 343
59 3300049575 Ga0501039_0027576 Ga0501039_0027576_3189_4244 343
60 3300061719 Ga0466962_0007902 Ga0466962_0007902_2319_3386 343
61 3300005471 Ga0070698_100097572 Ga0070698_1000975722 344
62 3300044694 Ga0466963_0034291 Ga0466963_0034291_1040_2098 344
63 3300005445 Ga0070708_100002798 Ga0070708_1000027985 345
64 3300005468 Ga0070707_100112617 Ga0070707_1001126172 345
65 3300005471 Ga0070698_100120037 Ga0070698_1001200371 345
66 3300037312 Ga0395899_0143101 Ga0395899_0143101_533_1594 345
67 3300037418 Ga0395900_0072916 Ga0395900_0072916_1361_2422 345
68 3300037471 Ga0395905_0033975 Ga0395905_0033975_2622_3683 345
69 3300038443 Ga0395901_0015033 Ga0395901_0015033_5769_6830 345
70 3300045049 Ga0466959_0184593 Ga0466959_0184593_149_1261 345
71 3300005336 Ga0070680_100025464 Ga0070680_1000254642 346
72 3300025898 Ga0207692_10050903 Ga0207692_100509032 346
73 3300025906 Ga0207699_10148725 Ga0207699_101487252 346
74 3300025916 Ga0207663_10057237 Ga0207663_100572372 346
75 3300031824 Ga0307413_10078028 Ga0307413_100780282 346
76 3300031903 Ga0307407_10004330 Ga0307407_100043305 346
77 3300032002 Ga0307416_100074567 Ga0307416_1000745672 346
78 3300032005 Ga0307411_10021305 Ga0307411_100213053 346
79 3300032005 Ga0307411_10269456 Ga0307411_102694561 346
80 3300037466 Ga0395898_0280509 Ga0395898_0280509_10_1074 346
81 3300044693 Ga0466961_0168706 Ga0466961_0168706_70_1146 346
82 3300036401 Ga0373937_0055658 Ga0373937_0055658_690_1781 347
83 3300044694 Ga0466963_0059115 Ga0466963_0059115_1136_2200 347
84 3300048915 Ga0496112_0000001 Ga0496112_0000001_945238_946329 347
85 3300006175 Ga0070712_100000001 Ga0070712_10000000142 348
86 3300025915 Ga0207693_10000002 Ga0207693_1000000240 348
87 3300044658 Ga0466972_0089884 Ga0466972_0089884_64_1137 348
88 3300037853 Ga0436364_1166496 Ga0436364_1166496_1441_2490 349
89 3300005981 Ga0081538_10001779 Ga0081538_1000177917 350
90 3300006844 Ga0075428_100238683 Ga0075428_1002386832 350
91 3300006847 Ga0075431_100016931 Ga0075431_1000169314 350
92 3300009094 Ga0111539_10403551 Ga0111539_104035511 350
93 3300031731 Ga0307405_10041928 Ga0307405_100419282 350
94 3300031824 Ga0307413_10097955 Ga0307413_100979552 350
95 3300031852 Ga0307410_10042149 Ga0307410_100421493 350
96 3300031901 Ga0307406_10007513 Ga0307406_100075138 350
97 3300031911 Ga0307412_10117036 Ga0307412_101170362 350
98 3300031995 Ga0307409_100003640 Ga0307409_10000364010 350
99 3300032002 Ga0307416_100001828 Ga0307416_10000182811 350
100 3300032126 Ga0307415_100007499 Ga0307415_1000074998 350
101 3300035083 Ga0373926_0000198 Ga0373926_0000198_7835_8944 350
102 3300035692 Ga0373935_0000645 Ga0373935_0000645_17196_18305 350
103 3300035725 Ga0373947_0000005 Ga0373947_0000005_188496_189605 350
104 3300037418 Ga0395900_0009169 Ga0395900_0009169_2721_3833 350
105 3300037466 Ga0395898_0004970 Ga0395898_0004970_12847_13959 350
106 3300050511 nmdc:mga08y16_219310_c1 nmdc:mga08y16_219310_c1_371_1432 350
107 3300005341 Ga0070691_10084795 Ga0070691_100847952 351
108 3300005535 Ga0070684_100157237 Ga0070684_1001572372 351
109 3300005543 Ga0070672_100040589 Ga0070672_1000405892 351
110 3300009098 Ga0105245_10089930 Ga0105245_100899302 351
111 3300025940 Ga0207691_10076316 Ga0207691_100763162 351
112 3300026078 Ga0207702_10125076 Ga0207702_101250762 351
113 3300026078 Ga0207702_10255429 Ga0207702_102554292 351
114 3300026118 Ga0207675_100008981 Ga0207675_1000089814 351
115 3300038443 Ga0395901_0516804 Ga0395901_0516804_41_1099 351
116 3300044901 Ga0466960_0038636 Ga0466960_0038636_299_1363 351
117 3300005329 Ga0070683_100010185 Ga0070683_1000101853 352
118 3300005336 Ga0070680_100001012 Ga0070680_10000101216 352
119 3300005337 Ga0070682_100023454 Ga0070682_1000234542 352
120 3300005339 Ga0070660_100011479 Ga0070660_1000114793 352
121 3300005344 Ga0070661_100016956 Ga0070661_1000169563 352
122 3300005345 Ga0070692_10045103 Ga0070692_100451032 352
123 3300005347 Ga0070668_100016783 Ga0070668_1000167836 352
124 3300005366 Ga0070659_100008196 Ga0070659_1000081969 352
125 3300005366 Ga0070659_100063885 Ga0070659_1000638852 352
126 3300005441 Ga0070700_100019411 Ga0070700_1000194111 352
127 3300005457 Ga0070662_100000228 Ga0070662_10000022812 352
128 3300005458 Ga0070681_10064957 Ga0070681_100649573 352
129 3300005530 Ga0070679_100000204 Ga0070679_10000020418 352
130 3300005530 Ga0070679_100013919 Ga0070679_1000139193 352
131 3300005577 Ga0068857_100110053 Ga0068857_1001100532 352
132 3300005577 Ga0068857_100137859 Ga0068857_1001378592 352
133 3300005614 Ga0068856_100029322 Ga0068856_1000293229 352
134 3300005616 Ga0068852_100014836 Ga0068852_1000148362 352
135 3300005719 Ga0068861_100031418 Ga0068861_1000314184 352
136 3300006048 Ga0075363_100015179 Ga0075363_1000151792 352
137 3300009093 Ga0105240_10025691 Ga0105240_100256919 352
138 3300009098 Ga0105245_10003111 Ga0105245_1000311113 352
139 3300009147 Ga0114129_10456517 Ga0114129_104565172 352
140 3300009545 Ga0105237_10023248 Ga0105237_100232487 352
141 3300009553 Ga0105249_10001858 Ga0105249_1000185817 352
142 3300013105 Ga0157369_10004530 Ga0157369_100045303 352
143 3300013306 Ga0163162_10134839 Ga0163162_101348392 352
144 3300013307 Ga0157372_10027328 Ga0157372_100273285 352
145 3300017792 Ga0163161_10027879 Ga0163161_100278793 352
146 3300020070 Ga0206356_10514390 Ga0206356_105143902 352
147 3300020081 Ga0206354_10028139 Ga0206354_100281391 352
148 3300020082 Ga0206353_10012049 Ga0206353_100120492 352
149 3300021388 Ga0213875_10005819 Ga0213875_100058194 352
150 3300022467 Ga0224712_10007929 Ga0224712_100079292 352
151 3300025907 Ga0207645_10179657 Ga0207645_101796571 352
152 3300025912 Ga0207707_10025335 Ga0207707_100253356 352
153 3300025913 Ga0207695_10079591 Ga0207695_100795912 352
154 3300025914 Ga0207671_10033201 Ga0207671_100332012 352
155 3300025917 Ga0207660_10007260 Ga0207660_100072603 352
156 3300025919 Ga0207657_10015334 Ga0207657_100153346 352
157 3300025920 Ga0207649_10035646 Ga0207649_100356462 352
158 3300025921 Ga0207652_10011258 Ga0207652_100112583 352
159 3300025921 Ga0207652_10051347 Ga0207652_100513473 352
160 3300025927 Ga0207687_10022259 Ga0207687_100222592 352
161 3300025932 Ga0207690_10008512 Ga0207690_100085125 352
162 3300025933 Ga0207706_10001621 Ga0207706_1000162118 352
163 3300025933 Ga0207706_10091659 Ga0207706_100916592 352
164 3300025944 Ga0207661_10000787 Ga0207661_1000078716 352
165 3300025961 Ga0207712_10014419 Ga0207712_100144194 352
166 3300025972 Ga0207668_10048889 Ga0207668_100488892 352
167 3300025981 Ga0207640_10114648 Ga0207640_101146481 352
168 3300026067 Ga0207678_10036643 Ga0207678_100366434 352
169 3300026075 Ga0207708_10006995 Ga0207708_100069955 352
170 3300026075 Ga0207708_10024967 Ga0207708_100249674 352
171 3300026116 Ga0207674_10099330 Ga0207674_100993302 352
172 3300026116 Ga0207674_10154632 Ga0207674_101546322 352
173 3300026118 Ga0207675_100007181 Ga0207675_1000071819 352
174 3300026142 Ga0207698_10033802 Ga0207698_100338022 352
175 3300031616 Ga0307508_10164789 Ga0307508_101647892 352
176 3300031995 Ga0307409_100211206 Ga0307409_1002112062 352
177 3300032002 Ga0307416_100416402 Ga0307416_1004164022 352
178 3300037466 Ga0395898_0203060 Ga0395898_0203060_345_1412 352
179 3300037853 Ga0436364_0023304 Ga0436364_0023304_12771_13880 352
180 3300037853 Ga0436364_0318735 Ga0436364_0318735_1807_2865 352
181 3300044656 Ga0466969_0017486 Ga0466969_0017486_1440_2552 352
182 3300044842 Ga0466957_0054287 Ga0466957_0054287_915_1973 352
183 3300045976 Ga0466967_0021539 Ga0466967_0021539_2531_3598 352
184 3300045976 Ga0466967_0068449 Ga0466967_0068449_1098_2171 352
185 3300045976 Ga0466967_0139580 Ga0466967_0139580_641_1705 352
186 3300046500 Ga0495596_0070261 Ga0495596_0070261_64_1131 352
187 3300046615 Ga0495656_0010431 Ga0495656_0010431_758_1825 352
188 3300048911 Ga0496108_0090950 Ga0496108_0090950_1454_2518 352
189 3300048912 Ga0496109_0068100 Ga0496109_0068100_938_2002 352
190 3300049587 Ga0501071_0126951 Ga0501071_0126951_796_1857 352
191 3300050507 nmdc:mga05p37_603543_c1 nmdc:mga05p37_603543_c1_119_1186 352
192 3300061719 Ga0466962_0011312 Ga0466962_0011312_973_2040 352
193 3300005578 Ga0068854_100082810 Ga0068854_1000828102 353
194 3300005618 Ga0068864_100222287 Ga0068864_1002222871 353
195 3300009094 Ga0111539_10466848 Ga0111539_104668482 353
196 3300009098 Ga0105245_10025746 Ga0105245_100257462 353
197 3300009148 Ga0105243_10011559 Ga0105243_100115595 353
198 3300009176 Ga0105242_10113979 Ga0105242_101139792 353
199 3300025901 Ga0207688_10059029 Ga0207688_100590292 353
200 3300025918 Ga0207662_10027736 Ga0207662_100277363 353
201 3300025935 Ga0207709_10066352 Ga0207709_100663522 353
202 3300026142 Ga0207698_10103941 Ga0207698_101039412 353
203 3300031995 Ga0307409_100134605 Ga0307409_1001346052 353
204 3300032002 Ga0307416_100187314 Ga0307416_1001873142 353
205 3300032126 Ga0307415_100049782 Ga0307415_1000497822 353
206 3300047471 Ga0495684_0048069 Ga0495684_0048069_211_1326 353
207 3300048914 Ga0496111_0116022 Ga0496111_0116022_790_1860 353
208 3300049573 Ga0501037_0077695 Ga0501037_0077695_713_1777 353
209 3300049575 Ga0501039_0072100 Ga0501039_0072100_1565_2629 353
210 3300049576 Ga0501040_0029446 Ga0501040_0029446_542_1606 353
211 3300049582 Ga0501048_0179800 Ga0501048_0179800_143_1207 353
212 3300049587 Ga0501071_0041249 Ga0501071_0041249_400_1464 353
213 3300049588 Ga0501072_0136363 Ga0501072_0136363_279_1343 353
214 3300049588 Ga0501072_0315532 Ga0501072_0315532_12_1076 353
215 3300049590 Ga0501074_0087296 Ga0501074_0087296_763_1827 353
216 3300049593 Ga0501077_0022464 Ga0501077_0022464_1882_2946 353
217 3300049741 Ga0501079_0054435 Ga0501079_0054435_881_1945 353
218 3300049743 Ga0501081_0027753 Ga0501081_0027753_2067_3131 353
219 3300049823 Ga0501044_0194544 Ga0501044_0194544_778_1842 353
220 3300049824 Ga0501045_0018587 Ga0501045_0018587_2783_3847 353
221 3300049824 Ga0501045_0075191 Ga0501045_0075191_1195_2259 353
222 3300050507 nmdc:mga05p37_515997_c1 nmdc:mga05p37_515997_c1_35_1099 353
223 3300050508 nmdc:mga09592_85778_c1 nmdc:mga09592_85778_c1_541_1605 353
224 3300050511 nmdc:mga08y16_8138_c1 nmdc:mga08y16_8138_c1_7571_8635 353
225 3300054114 Ga0501084_0100834 Ga0501084_0100834_1179_2243 353
226 3300061734 Ga0530510_0101813 Ga0530510_0101813_508_1572 353
227 3300050492 nmdc:mga0yw44_26652_c1 nmdc:mga0yw44_26652_c1_1513_2592 354
228 3300005434 Ga0070709_10018784 Ga0070709_100187844 355
229 3300025928 Ga0207700_10007366 Ga0207700_100073662 355
230 3300026078 Ga0207702_10337048 Ga0207702_103370482 355
231 3300045976 Ga0466967_0022736 Ga0466967_0022736_3455_4561 355
232 3300005337 Ga0070682_100040364 Ga0070682_1000403642 356
233 3300005458 Ga0070681_10160010 Ga0070681_101600102 356
234 3300013105 Ga0157369_10160004 Ga0157369_101600042 356
235 3300020070 Ga0206356_11054030 Ga0206356_110540302 356
236 3300021377 Ga0213874_10011007 Ga0213874_100110072 356
237 3300037466 Ga0395898_0228458 Ga0395898_0228458_52_1122 356
238 3300044693 Ga0466961_0031274 Ga0466961_0031274_258_1364 356
239 3300046678 Ga0495599_0092398 Ga0495599_0092398_191_1306 356
240 3300005434 Ga0070709_10092038 Ga0070709_100920382 357
241 3300025906 Ga0207699_10003133 Ga0207699_100031339 357
242 3300025939 Ga0207665_10003575 Ga0207665_100035755 357
243 3300035086 Ga0373934_0008451 Ga0373934_0008451_576_1649 357
244 3300035086 Ga0373934_0070117 Ga0373934_0070117_27_1142 357
245 3300035113 Ga0373936_0034544 Ga0373936_0034544_655_1770 357
246 3300035118 Ga0373954_0038205 Ga0373954_0038205_1059_2132 357
247 3300035724 Ga0373933_0014236 Ga0373933_0014236_3044_4117 357
248 3300035724 Ga0373933_0036462 Ga0373933_0036462_1187_2260 357
249 3300036401 Ga0373937_0062410 Ga0373937_0062410_1696_2811 357
250 3300046462 Ga0495651_0019918 Ga0495651_0019918_3108_4181 357
251 3300046529 Ga0495652_0028368 Ga0495652_0028368_1050_2123 357
252 3300046536 Ga0495587_0030525 Ga0495587_0030525_1911_2984 357
253 3300046559 Ga0495667_0012155 Ga0495667_0012155_114_1187 357
254 3300046663 Ga0495635_0044574 Ga0495635_0044574_119_1192 357
255 3300047317 Ga0495604_0023642 Ga0495604_0023642_3040_4113 357
256 3300047322 Ga0495680_0016546 Ga0495680_0016546_1130_2203 357
257 3300047322 Ga0495680_0016629 Ga0495680_0016629_2122_3195 357
258 3300047673 Ga0495593_0016205 Ga0495593_0016205_3106_4179 357
259 3300048088 Ga0495602_0031671 Ga0495602_0031671_2681_3754 357
260 3300048922 Ga0496119_0116872 Ga0496119_0116872_327_1406 357
261 3300005435 Ga0070714_100008251 Ga0070714_1000082517 358
262 3300006038 Ga0075365_10004540 Ga0075365_100045409 358
263 3300025898 Ga0207692_10001183 Ga0207692_100011836 358
264 3300025905 Ga0207685_10000802 Ga0207685_100008022 358
265 3300025906 Ga0207699_10001387 Ga0207699_100013877 358
266 3300025916 Ga0207663_10004052 Ga0207663_100040526 358
267 3300025928 Ga0207700_10004837 Ga0207700_100048374 358
268 3300048918 Ga0496115_0006449 Ga0496115_0006449_4978_6069 358
269 3300050492 nmdc:mga0yw44_561_c1 nmdc:mga0yw44_561_c1_8416_9528 358
270 3300005327 Ga0070658_10133567 Ga0070658_101335672 359
271 3300005329 Ga0070683_100030971 Ga0070683_1000309716 359
272 3300005455 Ga0070663_100020319 Ga0070663_1000203194 359
273 3300005458 Ga0070681_10011211 Ga0070681_100112113 359
274 3300005530 Ga0070679_100013725 Ga0070679_1000137254 359
275 3300013105 Ga0157369_10106424 Ga0157369_101064242 359
276 3300020070 Ga0206356_10098088 Ga0206356_100980882 359
277 3300020077 Ga0206351_10903194 Ga0206351_109031942 359
278 3300020078 Ga0206352_10017727 Ga0206352_100177272 359
279 3300022467 Ga0224712_10001507 Ga0224712_100015073 359
280 3300025912 Ga0207707_10002802 Ga0207707_100028025 359
281 3300025921 Ga0207652_10002601 Ga0207652_100026019 359
282 3300025944 Ga0207661_10119893 Ga0207661_101198932 359
283 3300026078 Ga0207702_10328816 Ga0207702_103288162 359
284 3300005435 Ga0070714_100089187 Ga0070714_1000891872 360
285 3300005435 Ga0070714_100141362 Ga0070714_1001413622 360
286 3300005437 Ga0070710_10009379 Ga0070710_100093794 360
287 3300006028 Ga0070717_10156076 Ga0070717_101560762 360
288 3300006175 Ga0070712_100001756 Ga0070712_10000175611 360
289 3300021388 Ga0213875_10000351 Ga0213875_1000035136 360
290 3300021388 Ga0213875_10007675 Ga0213875_100076752 360
291 3300025906 Ga0207699_10064357 Ga0207699_100643571 360
292 3300025915 Ga0207693_10002518 Ga0207693_100025185 360
293 3300025928 Ga0207700_10037108 Ga0207700_100371082 360
294 3300031852 Ga0307410_10062122 Ga0307410_100621223 360
295 3300031901 Ga0307406_10013066 Ga0307406_100130664 360
296 3300031995 Ga0307409_100004546 Ga0307409_1000045463 360
297 3300032002 Ga0307416_100002053 Ga0307416_1000020537 360
298 3300032005 Ga0307411_10026964 Ga0307411_100269641 360
299 3300032126 Ga0307415_100005893 Ga0307415_1000058936 360
300 3300035083 Ga0373926_0008031 Ga0373926_0008031_1694_2806 360
301 3300035111 Ga0373923_0065950 Ga0373923_0065950_171_1283 360
302 3300036401 Ga0373937_0009768 Ga0373937_0009768_1847_2929 360
303 3300037418 Ga0395900_0045921 Ga0395900_0045921_2793_3875 360
304 3300037466 Ga0395898_0040869 Ga0395898_0040869_1109_2191 360
305 3300037471 Ga0395905_0041707 Ga0395905_0041707_463_1545 360
306 3300037853 Ga0436364_1306431 Ga0436364_1306431_4317_5399 360
307 3300039437 Ga0436365_0528198 Ga0436365_0528198_883_1965 360
308 3300044694 Ga0466963_0011018 Ga0466963_0011018_3848_4933 360
309 3300045049 Ga0466959_0025232 Ga0466959_0025232_304_1389 360
310 3300045836 Ga0466958_0000409 Ga0466958_0000409_3039_4124 360
311 3300045976 Ga0466967_0190647 Ga0466967_0190647_770_1855 360
312 3300046454 Ga0495592_0006745 Ga0495592_0006745_3587_4669 360
313 3300046462 Ga0495651_0005538 Ga0495651_0005538_7213_8295 360
314 3300046463 Ga0495653_0012758 Ga0495653_0012758_1898_2980 360
315 3300046511 Ga0495608_0025589 Ga0495608_0025589_1783_2865 360
316 3300046516 Ga0495628_0027320 Ga0495628_0027320_2987_4069 360
317 3300046517 Ga0495630_0176871 Ga0495630_0176871_153_1235 360
318 3300046529 Ga0495652_0071138 Ga0495652_0071138_457_1539 360
319 3300046559 Ga0495667_0010259 Ga0495667_0010259_1849_2931 360
320 3300046663 Ga0495635_0022251 Ga0495635_0022251_738_1820 360
321 3300046675 Ga0495657_0015872 Ga0495657_0015872_1567_2649 360
322 3300046678 Ga0495599_0023430 Ga0495599_0023430_887_1969 360
323 3300046809 Ga0495600_0003881 Ga0495600_0003881_2515_3597 360
324 3300047317 Ga0495604_0003452 Ga0495604_0003452_3420_4502 360
325 3300047319 Ga0495674_0018374 Ga0495674_0018374_3366_4448 360
326 3300047322 Ga0495680_0035749 Ga0495680_0035749_1128_2210 360
327 3300047471 Ga0495684_0008339 Ga0495684_0008339_1669_2751 360
328 3300047673 Ga0495593_0120047 Ga0495593_0120047_155_1237 360
329 3300048088 Ga0495602_0014526 Ga0495602_0014526_2758_3840 360
330 3300048908 Ga0496105_0206483 Ga0496105_0206483_86_1168 360
331 3300048915 Ga0496112_0037937 Ga0496112_0037937_2822_3904 360
332 3300048915 Ga0496112_0358260 Ga0496112_0358260_194_1276 360
333 3300048916 Ga0496113_0037208 Ga0496113_0037208_2134_3216 360
334 3300049763 Ga0501266_006425 Ga0501266_006425_291_1400 360
335 3300050492 nmdc:mga0yw44_12107_c1 nmdc:mga0yw44_12107_c1_1960_3042 360
336 3300006871 Ga0075434_100144129 Ga0075434_1001441292 361
337 3300025910 Ga0207684_10043549 Ga0207684_100435492 361
338 3300035172 Ga0373955_0092066 Ga0373955_0092066_68_1180 361
339 3300035695 Ga0373927_0119826 Ga0373927_0119826_186_1298 361
340 3300046461 Ga0495641_0086869 Ga0495641_0086869_209_1321 361
341 3300046516 Ga0495628_0096325 Ga0495628_0096325_412_1524 361
342 3300046531 Ga0495665_0047641 Ga0495665_0047641_628_1740 361
343 3300046642 Ga0495634_0119732 Ga0495634_0119732_522_1634 361
344 3300046683 Ga0495658_0063144 Ga0495658_0063144_216_1328 361
345 3300047322 Ga0495680_0157937 Ga0495680_0157937_507_1619 361
346 3300048907 Ga0496104_0013851 Ga0496104_0013851_2242_3354 361
347 3300048908 Ga0496105_0017380 Ga0496105_0017380_1356_2468 361
348 3300048918 Ga0496115_0003526 Ga0496115_0003526_5813_6925 361
349 3300005455 Ga0070663_100174535 Ga0070663_1001745351 362
350 3300026067 Ga0207678_10008864 Ga0207678_100088645 362
351 3300044684 Ga0466966_0046822 Ga0466966_0046822_1584_2711 362
352 3300045049 Ga0466959_0002187 Ga0466959_0002187_396_1523 362
353 3300045836 Ga0466958_0014786 Ga0466958_0014786_2338_3465 362
354 3300005468 Ga0070707_100346662 Ga0070707_1003466621 363
355 3300010159 Ga0099796_10002435 Ga0099796_100024351 363
356 3300046461 Ga0495641_0039610 Ga0495641_0039610_220_1314 363
357 3300046473 Ga0495582_0147009 Ga0495582_0147009_183_1277 363
358 3300050492 nmdc:mga0yw44_564_c1 nmdc:mga0yw44_564_c1_5992_7086 363
359 3300036459 Ga0372808_000533 Ga0372808_000533_802_1941 364
360 3300037068 Ga0373925_0000014 Ga0373925_0000014_51933_53072 364
361 3300025901 Ga0207688_10019068 Ga0207688_100190682 365
362 3300009094 Ga0111539_10017818 Ga0111539_100178183 366
363 3300009147 Ga0114129_10002456 Ga0114129_1000245614 366
364 3300027907 Ga0207428_10016678 Ga0207428_100166782 366
365 3300028380 Ga0268265_10116965 Ga0268265_101169653 366
366 3300050507 nmdc:mga05p37_30118_c1 nmdc:mga05p37_30118_c1_727_1836 366
367 3300050511 nmdc:mga08y16_43555_c1 nmdc:mga08y16_43555_c1_521_1630 366
368 3300005435 Ga0070714_100004074 Ga0070714_1000040747 368
369 3300005436 Ga0070713_100024252 Ga0070713_1000242523 368
370 3300005445 Ga0070708_100200243 Ga0070708_1002002432 368
371 3300005467 Ga0070706_100180928 Ga0070706_1001809282 368
372 3300005468 Ga0070707_100177163 Ga0070707_1001771632 368
373 3300005471 Ga0070698_100122302 Ga0070698_1001223022 368
374 3300005614 Ga0068856_100054919 Ga0068856_1000549192 368
375 3300006028 Ga0070717_10032204 Ga0070717_100322042 368
376 3300006038 Ga0075365_10001060 Ga0075365_1000106011 368
377 3300006051 Ga0075364_10005988 Ga0075364_100059883 368
378 3300025915 Ga0207693_10007864 Ga0207693_100078643 368
379 3300025916 Ga0207663_10018908 Ga0207663_100189082 368
380 3300025922 Ga0207646_10186207 Ga0207646_101862071 368
381 3300025928 Ga0207700_10024965 Ga0207700_100249652 368
382 3300025928 Ga0207700_10036834 Ga0207700_100368344 368
383 3300025929 Ga0207664_10002719 Ga0207664_100027199 368
384 3300025929 Ga0207664_10070971 Ga0207664_100709712 368
385 3300025939 Ga0207665_10006671 Ga0207665_100066714 368
386 3300026078 Ga0207702_10400660 Ga0207702_104006602 368
387 3300035113 Ga0373936_0027952 Ga0373936_0027952_1011_2120 368
388 3300035116 Ga0373945_0002562 Ga0373945_0002562_674_1783 368
389 3300035692 Ga0373935_0045559 Ga0373935_0045559_1125_2234 368
390 3300035695 Ga0373927_0022327 Ga0373927_0022327_2122_3231 368
391 3300035725 Ga0373947_0002640 Ga0373947_0002640_2507_3616 368
392 3300039450 Ga0436363_0655734 Ga0436363_0655734_64_1173 368
393 3300046463 Ga0495653_0001842 Ga0495653_0001842_15600_16709 368
394 3300046473 Ga0495582_0013369 Ga0495582_0013369_2161_3270 368
395 3300046476 Ga0495662_0015787 Ga0495662_0015787_1179_2288 368
396 3300046477 Ga0495664_0000438 Ga0495664_0000438_73_1182 368
397 3300046514 Ga0495618_0039052 Ga0495618_0039052_1789_2898 368
398 3300046531 Ga0495665_0015679 Ga0495665_0015679_12_1121 368
399 3300046559 Ga0495667_0034219 Ga0495667_0034219_1900_3009 368
400 3300046663 Ga0495635_0003852 Ga0495635_0003852_3601_4710 368
401 3300047315 Ga0495581_0184179 Ga0495581_0184179_84_1193 368
402 3300047319 Ga0495674_0000971 Ga0495674_0000971_7441_8550 368
403 3300047322 Ga0495680_0005871 Ga0495680_0005871_2962_4071 368
404 3300047471 Ga0495684_0001272 Ga0495684_0001272_19113_20222 368
405 3300005435 Ga0070714_100070174 Ga0070714_1000701742 369
406 3300005436 Ga0070713_100040809 Ga0070713_1000408092 369
407 3300006028 Ga0070717_10023195 Ga0070717_100231956 369
408 3300013105 Ga0157369_10056674 Ga0157369_100566742 369
409 3300013307 Ga0157372_10516422 Ga0157372_105164222 369
410 3300020081 Ga0206354_10761416 Ga0206354_107614162 369
411 3300021358 Ga0213873_10008871 Ga0213873_100088712 369
412 3300025929 Ga0207664_10121032 Ga0207664_101210322 369
413 3300037853 Ga0436364_0245080 Ga0436364_0245080_1357_2466 369
414 3300037853 Ga0436364_0937866 Ga0436364_0937866_1154_2263 369
415 3300045836 Ga0466958_0071046 Ga0466958_0071046_876_1985 369
416 3300046477 Ga0495664_0166864 Ga0495664_0166864_27_1154 369
417 3300048929 Ga0496126_0040856 Ga0496126_0040856_743_1882 369
418 3300003659 JGI25404J52841_10003239 JGI25404J52841_100032392 370
419 3300005328 Ga0070676_10042565 Ga0070676_100425652 370
420 3300005340 Ga0070689_100058236 Ga0070689_1000582363 370
421 3300005343 Ga0070687_100063891 Ga0070687_1000638912 370
422 3300005438 Ga0070701_10070416 Ga0070701_100704162 370
423 3300005530 Ga0070679_100165844 Ga0070679_1001658442 370
424 3300005545 Ga0070695_100108426 Ga0070695_1001084262 370
425 3300005547 Ga0070693_100021561 Ga0070693_1000215612 370
426 3300005577 Ga0068857_100160722 Ga0068857_1001607222 370
427 3300005615 Ga0070702_100033604 Ga0070702_1000336042 370
428 3300005616 Ga0068852_100175957 Ga0068852_1001759572 370
429 3300005618 Ga0068864_100040082 Ga0068864_1000400824 370
430 3300005719 Ga0068861_100058303 Ga0068861_1000583032 370
431 3300005841 Ga0068863_100167143 Ga0068863_1001671432 370
432 3300005983 Ga0081540_1000872 Ga0081540_100087215 370
433 3300006163 Ga0070715_10014617 Ga0070715_100146172 370
434 3300006871 Ga0075434_100013742 Ga0075434_1000137422 370
435 3300007076 Ga0075435_100016045 Ga0075435_1000160452 370
436 3300009545 Ga0105237_10223611 Ga0105237_102236112 370
437 3300009553 Ga0105249_10156287 Ga0105249_101562872 370
438 3300012507 Ga0157342_1000736 Ga0157342_10007362 370
439 3300013297 Ga0157378_10038485 Ga0157378_100384854 370
440 3300025898 Ga0207692_10022846 Ga0207692_100228462 370
441 3300025903 Ga0207680_10088943 Ga0207680_100889432 370
442 3300025906 Ga0207699_10068206 Ga0207699_100682062 370
443 3300025916 Ga0207663_10100875 Ga0207663_101008752 370
444 3300025918 Ga0207662_10018465 Ga0207662_100184652 370
445 3300025919 Ga0207657_10015109 Ga0207657_100151095 370
446 3300025921 Ga0207652_10066588 Ga0207652_100665882 370
447 3300025929 Ga0207664_10088745 Ga0207664_100887452 370
448 3300025931 Ga0207644_10195658 Ga0207644_101956582 370
449 3300025933 Ga0207706_10079823 Ga0207706_100798232 370
450 3300025938 Ga0207704_10223401 Ga0207704_102234012 370
451 3300025940 Ga0207691_10190992 Ga0207691_101909922 370
452 3300025942 Ga0207689_10016519 Ga0207689_100165197 370
453 3300025945 Ga0207679_10175746 Ga0207679_101757462 370
454 3300026035 Ga0207703_10102603 Ga0207703_101026032 370
455 3300026067 Ga0207678_10004203 Ga0207678_100042033 370
456 3300026075 Ga0207708_10023527 Ga0207708_100235272 370
457 3300026078 Ga0207702_10088103 Ga0207702_100881033 370
458 3300026088 Ga0207641_10085525 Ga0207641_100855253 370
459 3300026095 Ga0207676_10057453 Ga0207676_100574532 370
460 3300026116 Ga0207674_10034077 Ga0207674_100340775 370
461 3300026118 Ga0207675_100011096 Ga0207675_1000110965 370
462 3300026121 Ga0207683_10029221 Ga0207683_100292214 370
463 3300035086 Ga0373934_0006728 Ga0373934_0006728_3031_4155 370
464 3300035111 Ga0373923_0001993 Ga0373923_0001993_3450_4574 370
465 3300035113 Ga0373936_0000937 Ga0373936_0000937_3168_4292 370
466 3300035116 Ga0373945_0001521 Ga0373945_0001521_2068_3192 370
467 3300035120 Ga0373957_0001502 Ga0373957_0001502_5190_6314 370
468 3300035121 Ga0373960_0044967 Ga0373960_0044967_93_1205 370
469 3300035170 Ga0373943_0002798 Ga0373943_0002798_4197_5321 370
470 3300035172 Ga0373955_0005607 Ga0373955_0005607_35_1159 370
471 3300035692 Ga0373935_0004740 Ga0373935_0004740_3003_4127 370
472 3300035695 Ga0373927_0014547 Ga0373927_0014547_26_1150 370
473 3300035724 Ga0373933_0004617 Ga0373933_0004617_2160_3284 370
474 3300046454 Ga0495592_0053829 Ga0495592_0053829_469_1593 370
475 3300046455 Ga0495603_0002037 Ga0495603_0002037_7632_8756 370
476 3300046459 Ga0495629_0013207 Ga0495629_0013207_3449_4573 370
477 3300046463 Ga0495653_0027769 Ga0495653_0027769_375_1499 370
478 3300046472 Ga0495580_0020768 Ga0495580_0020768_66_1190 370
479 3300046475 Ga0495639_0006736 Ga0495639_0006736_3737_4861 370
480 3300046476 Ga0495662_0072273 Ga0495662_0072273_469_1593 370
481 3300046477 Ga0495664_0015428 Ga0495664_0015428_157_1281 370
482 3300046499 Ga0495594_0083325 Ga0495594_0083325_107_1231 370
483 3300046511 Ga0495608_0052434 Ga0495608_0052434_1248_2372 370
484 3300046511 Ga0495608_0164366 Ga0495608_0164366_257_1372 370
485 3300046514 Ga0495618_0017904 Ga0495618_0017904_3106_4230 370
486 3300046526 Ga0495666_0002957 Ga0495666_0002957_7314_8438 370
487 3300046531 Ga0495665_0006292 Ga0495665_0006292_5190_6314 370
488 3300046535 Ga0495586_0010046 Ga0495586_0010046_3830_4954 370
489 3300046536 Ga0495587_0004272 Ga0495587_0004272_4138_5262 370
490 3300046543 Ga0495645_0012453 Ga0495645_0012453_2245_3369 370
491 3300046559 Ga0495667_0008480 Ga0495667_0008480_112_1236 370
492 3300046663 Ga0495635_0013353 Ga0495635_0013353_1049_2173 370
493 3300046674 Ga0495588_0008575 Ga0495588_0008575_111_1235 370
494 3300046675 Ga0495657_0027115 Ga0495657_0027115_1391_2515 370
495 3300046679 Ga0495623_0019689 Ga0495623_0019689_3157_4281 370
496 3300046681 Ga0495647_0076349 Ga0495647_0076349_107_1231 370
497 3300046689 Ga0495613_0009122 Ga0495613_0009122_3002_4126 370
498 3300047317 Ga0495604_0007445 Ga0495604_0007445_110_1234 370
499 3300047321 Ga0495676_0028866 Ga0495676_0028866_46_1170 370
500 3300047444 Ga0495675_0002317 Ga0495675_0002317_7236_8360 370
501 3300047471 Ga0495684_0028032 Ga0495684_0028032_1954_3078 370
502 3300048908 Ga0496105_0114618 Ga0496105_0114618_437_1594 370
503 3300048911 Ga0496108_0187190 Ga0496108_0187190_593_1705 370
504 3300048916 Ga0496113_0072003 Ga0496113_0072003_1018_2172 370
505 3300048917 Ga0496114_0411016 Ga0496114_0411016_11_1123 370
506 3300050513 nmdc:mga0rr50_12634_c1 nmdc:mga0rr50_12634_c1_1799_2911 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

104

387

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5673 69 357
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5659 69 357
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.557 69 357
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5269 69 357
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5225 15 351
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9197 73 353 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9103 73 353 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8238 71 352 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8137 74 352 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8103 76 353 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3L7VXH0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9593 71 365 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015192
GO:0015808
GO:0042941
GO:1903806
AF-A0A3D0D4M2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9561 69 364 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015192
GO:0015808
GO:0042941
GO:1903806
AF-A0A2G4FY25-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9558 66 364 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015192
GO:0015808
GO:0042941
GO:1903806
AF-A0A1V8RS87-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.954 65 364 GO:0005886
GO:0006865
GO:0022857
AF-A0A7W0QKE1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9489 67 370 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015192
GO:0015808
GO:0042941
GO:1903806

Feature Viewer

pLDDT pTM Quality
87.92 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map