F456479

General Info

Members Datasets Scaffolds Average Seq Length
506 235 1012 137

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_11414362|Ga0070681_114143621
Length 139
Sequence MYTHQIEERVRYGETDRMGYLYYGNYAQYYEVGRVEALRNLGLRYKDMEDSGILMPVLDLVSTFVKPALYDQLLTIRTTVTTMPTVRMFFSYEIENEEKELINYGKTTLIFFDGNKRRPCRAPAYLLEKLLPYFENKMQ

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
211 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
233 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.93
Nodule 0
Rhizoplane 0.59
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 19.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_11414362 3300005458 Unclassified 619
2 JGI24740J21852_10007063 3300001979 Bacteria 4603
3 JGI25154J39366_1017064 3300002738 Bacteria 727
4 rootH1_10092153 3300003316 Bacteria 4275
5 rootH2_10003376 3300003320 Bacteria 4304
6 rootH2_10008932 3300003320 Bacteria 37271
7 rootH2_10020101 3300003320 Bacteria 5955
8 rootH2_10041861 3300003320 Bacteria 17793
9 rootH2_10198091 3300003320 Bacteria 2922
10 rootL2_10031008 3300003322 Bacteria 3017
11 rootL2_10244506 3300003322 Bacteria 2781
12 rootL2_10356615 3300003322 Bacteria 1800
13 rootH1_10035779 3300003323 Bacteria 4223
14 JGI25160J50197_1001100 3300003354 Bacteria 13814
15 Ga0070658_10002849 3300005327 Bacteria 14369
16 Ga0070676_10001904 3300005328 Bacteria 10604
17 Ga0070676_10460159 3300005328 Bacteria 896
18 Ga0070683_100006532 3300005329 Bacteria 9793
19 Ga0070690_100308722 3300005330 Bacteria 1136
20 Ga0070690_100322034 3300005330 Bacteria 1114
21 Ga0070690_100682264 3300005330 Bacteria 787
22 Ga0070670_100210781 3300005331 Unclassified 1689
23 Ga0070670_100480412 3300005331 Bacteria 1103
24 Ga0070670_100645837 3300005331 Bacteria 949
25 Ga0070670_100788857 3300005331 Bacteria 857
26 Ga0070670_100884307 3300005331 Bacteria 809
27 Ga0070677_10101659 3300005333 Bacteria 1268
28 Ga0068869_100079850 3300005334 Bacteria 2439
29 Ga0068869_100738860 3300005334 Bacteria 842
30 Ga0070666_10000028 3300005335 Bacteria 144796
31 Ga0070666_10000885 3300005335 Bacteria 18201
32 Ga0070666_10044926 3300005335 Bacteria 2961
33 Ga0070680_100002380 3300005336 Bacteria 13907
34 Ga0070680_100288952 3300005336 Bacteria 1389
35 Ga0070682_100007128 3300005337 Bacteria 6294
36 Ga0070682_100013688 3300005337 Unclassified 4674
37 Ga0070682_101823490 3300005337 Unclassified 531
38 Ga0068868_100000075 3300005338 Bacteria 58452
39 Ga0068868_100014908 3300005338 Bacteria 5739
40 Ga0068868_102333825 3300005338 Bacteria 510
41 Ga0070660_100153155 3300005339 Unclassified 1855
42 Ga0070689_100220951 3300005340 Bacteria 1554
43 Ga0070689_101085193 3300005340 Bacteria 715
44 Ga0070691_10009538 3300005341 Bacteria 4432
45 Ga0070691_10023899 3300005341 Bacteria 2839
46 Ga0070691_10549262 3300005341 Unclassified 675
47 Ga0070668_100000859 3300005347 Bacteria 21121
48 Ga0070675_100034074 3300005354 Bacteria 4131
49 Ga0070675_100160092 3300005354 Bacteria 1935
50 Ga0070675_101482557 3300005354 Unclassified 626
51 Ga0070675_101767967 3300005354 Unclassified 570
52 Ga0070671_100050909 3300005355 Bacteria 3445
53 Ga0070671_100679687 3300005355 Bacteria 892
54 Ga0070674_100113758 3300005356 Bacteria 1992
55 Ga0070673_100000448 3300005364 Bacteria 21839
56 Ga0070673_100006749 3300005364 Bacteria 7490
57 Ga0070688_100073351 3300005365 Bacteria 2195
58 Ga0070688_101576252 3300005365 Bacteria 536
59 Ga0070659_100009989 3300005366 Bacteria 6982
60 Ga0070667_100000482 3300005367 Bacteria 40557
61 Ga0070667_100200810 3300005367 Bacteria 1769
62 Ga0070667_100305837 3300005367 Bacteria 1432
63 Ga0070667_101796270 3300005367 Bacteria 577
64 Ga0070713_100492155 3300005436 Unclassified 1156
65 Ga0070700_101976788 3300005441 Bacteria 505
66 Ga0070663_100355385 3300005455 Bacteria 1187
67 Ga0070678_100015835 3300005456 Unclassified 4804
68 Ga0070678_100027799 3300005456 Bacteria 3846
69 Ga0070678_100832510 3300005456 Bacteria 840
70 Ga0070678_101511778 3300005456 Unclassified 629
71 Ga0070681_10037887 3300005458 Bacteria 4835
72 Ga0070681_10048304 3300005458 Bacteria 4253
73 Ga0070681_10152052 3300005458 Bacteria 2241
74 Ga0068867_100013182 3300005459 Bacteria 5855
75 Ga0068867_101504481 3300005459 Bacteria 627
76 Ga0068867_101605048 3300005459 Unclassified 608
77 Ga0070685_10032691 3300005466 Bacteria 2915
78 Ga0070679_100031244 3300005530 Bacteria 5260
79 Ga0070679_100032277 3300005530 Bacteria 5178
80 Ga0070684_100002043 3300005535 Bacteria 14865
81 Ga0070684_100103525 3300005535 Bacteria 2546
82 Ga0068853_100006239 3300005539 Bacteria 9446
83 Ga0068853_100006774 3300005539 Bacteria 9130
84 Ga0068853_100029608 3300005539 Bacteria 4618
85 Ga0068853_100050294 3300005539 Bacteria 3585
86 Ga0068853_100358567 3300005539 Unclassified 1358
87 Ga0070672_100000758 3300005543 Bacteria 19232
88 Ga0070672_100098509 3300005543 Bacteria 2368
89 Ga0070672_100183801 3300005543 Unclassified 1743
90 Ga0070672_100284397 3300005543 Bacteria 1399
91 Ga0070672_100392161 3300005543 Bacteria 1189
92 Ga0070672_101002778 3300005543 Bacteria 740
93 Ga0070693_100013591 3300005547 Unclassified 4151
94 Ga0070665_100000001 3300005548 Bacteria 1083363
95 Ga0070665_100002163 3300005548 Bacteria 21925
96 Ga0070665_100782773 3300005548 Bacteria 967
97 Ga0068855_100000089 3300005563 Bacteria 110845
98 Ga0068855_100047714 3300005563 Bacteria 5059
99 Ga0068855_100050054 3300005563 Bacteria 4925
100 Ga0068855_100138482 3300005563 Unclassified 2776
101 Ga0068855_100266374 3300005563 Bacteria 1907
102 Ga0068855_100349208 3300005563 Bacteria 1630
103 Ga0070664_100023115 3300005564 Bacteria 5132
104 Ga0070664_100057753 3300005564 Bacteria 3299
105 Ga0070664_100708467 3300005564 Bacteria 938
106 Ga0068857_100010174 3300005577 Bacteria 8177
107 Ga0068857_100259917 3300005577 Unclassified 1593
108 Ga0068854_100013828 3300005578 Bacteria 5308
109 Ga0068854_100037722 3300005578 Unclassified 3394
110 Ga0068854_100054903 3300005578 Bacteria 2867
111 Ga0068854_100213830 3300005578 Bacteria 1522
112 Ga0068854_100417952 3300005578 Bacteria 1113
113 Ga0068854_100587028 3300005578 Unclassified 949
114 Ga0068856_100008851 3300005614 Bacteria 9797
115 Ga0068856_100076515 3300005614 Bacteria 3316
116 Ga0068856_100079385 3300005614 Bacteria 3254
117 Ga0068856_100315928 3300005614 Bacteria 1579
118 Ga0068852_100000488 3300005616 Bacteria 25890
119 Ga0068852_100018236 3300005616 Bacteria 5527
120 Ga0068852_100097578 3300005616 Bacteria 2644
121 Ga0068852_100306250 3300005616 Bacteria 1539
122 Ga0068852_100381467 3300005616 Bacteria 1383
123 Ga0068852_100508344 3300005616 Bacteria 1201
124 Ga0068852_101220022 3300005616 Bacteria 773
125 Ga0068852_101305214 3300005616 Unclassified 747
126 Ga0068852_101509686 3300005616 Bacteria 694
127 Ga0068852_101712624 3300005616 Unclassified 651
128 Ga0068859_100000012 3300005617 Bacteria 300376
129 Ga0068859_100027733 3300005617 Bacteria 5680
130 Ga0068859_100487586 3300005617 Bacteria 1328
131 Ga0068859_102364348 3300005617 Unclassified 586
132 Ga0068864_100034417 3300005618 Bacteria 4309
133 Ga0068864_100119280 3300005618 Bacteria 2357
134 Ga0068864_100400092 3300005618 Unclassified 1305
135 Ga0068864_100567040 3300005618 Bacteria 1099
136 Ga0068864_100620449 3300005618 Bacteria 1051
137 Ga0068866_10397269 3300005718 Bacteria 888
138 Ga0068861_100005861 3300005719 Bacteria 8349
139 Ga0068861_100330046 3300005719 Unclassified 1331
140 Ga0068851_10001706 3300005834 Bacteria 9614
141 Ga0068851_10009442 3300005834 Bacteria 4537
142 Ga0068851_10030811 3300005834 Bacteria 2662
143 Ga0068863_100001512 3300005841 Bacteria 22973
144 Ga0068863_100002125 3300005841 Bacteria 19657
145 Ga0068863_100012779 3300005841 Bacteria 8096
146 Ga0068863_100678348 3300005841 Bacteria 1023
147 Ga0068863_101313033 3300005841 Bacteria 730
148 Ga0068858_100001413 3300005842 Bacteria 24658
149 Ga0068858_100088249 3300005842 Bacteria 2885
150 Ga0068858_100456777 3300005842 Bacteria 1231
151 Ga0068860_100002836 3300005843 Bacteria 18019
152 Ga0068860_100012660 3300005843 Bacteria 8298
153 Ga0068860_100080155 3300005843 Unclassified 3105
154 Ga0068860_100081331 3300005843 Bacteria 3081
155 Ga0068860_100155985 3300005843 Bacteria 2200
156 Ga0068862_100986915 3300005844 Bacteria 832
157 Ga0081540_1029496 3300005983 Bacteria 3054
158 Ga0081539_10000337 3300005985 Bacteria 103868
159 Ga0070715_10429160 3300006163 Unclassified 741
160 Ga0075366_10070147 3300006195 Bacteria 2087
161 Ga0075366_10250892 3300006195 Bacteria 1079
162 Ga0075366_10336226 3300006195 Bacteria 926
163 Ga0097621_100003845 3300006237 Bacteria 10402
164 Ga0097621_100004135 3300006237 Bacteria 10062
165 Ga0097621_100037246 3300006237 Bacteria 3895
166 Ga0097621_100320116 3300006237 Bacteria 1374
167 Ga0097621_100490020 3300006237 Unclassified 1112
168 Ga0068871_100000981 3300006358 Bacteria 19104
169 Ga0068871_100008715 3300006358 Bacteria 7295
170 Ga0068871_100060621 3300006358 Unclassified 3087
171 Ga0068871_100072892 3300006358 Bacteria 2830
172 Ga0068871_100287925 3300006358 Unclassified 1439
173 Ga0068871_100319534 3300006358 Unclassified 1367
174 Ga0068871_100735237 3300006358 Bacteria 906
175 Ga0068865_100000413 3300006881 Bacteria 23842
176 Ga0068865_100112252 3300006881 Bacteria 2013
177 Ga0097620_100000012 3300006931 Bacteria 300376
178 Ga0097620_100027729 3300006931 Bacteria 5680
179 Ga0097620_100487562 3300006931 Bacteria 1328
180 Ga0097620_102364883 3300006931 Unclassified 586
181 Ga0105240_10003016 3300009093 Bacteria 26478
182 Ga0105240_10005940 3300009093 Bacteria 18085
183 Ga0105240_10025898 3300009093 Bacteria 7702
184 Ga0105240_10035594 3300009093 Bacteria 6414
185 Ga0105240_10079750 3300009093 Unclassified 4028
186 Ga0105240_10105967 3300009093 Bacteria 3411
187 Ga0105240_10246368 3300009093 Unclassified 2069
188 Ga0105245_10063832 3300009098 Bacteria 3327
189 Ga0105245_10592713 3300009098 Unclassified 1134
190 Ga0105241_10000619 3300009174 Bacteria 26737
191 Ga0105241_10003218 3300009174 Bacteria 12152
192 Ga0105241_10577895 3300009174 Bacteria 1012
193 Ga0105241_10583492 3300009174 Bacteria 1008
194 Ga0105248_10165075 3300009177 Bacteria 2497
195 Ga0105237_10002854 3300009545 Bacteria 21014
196 Ga0105237_10004335 3300009545 Bacteria 16445
197 Ga0105237_10008089 3300009545 Bacteria 11432
198 Ga0105237_10016648 3300009545 Bacteria 7636
199 Ga0105237_10044083 3300009545 Bacteria 4492
200 Ga0105237_10226734 3300009545 Bacteria 1869
201 Ga0105237_10348034 3300009545 Unclassified 1486
202 Ga0105237_10368992 3300009545 Archaea 1440
203 Ga0105237_10478580 3300009545 Bacteria 1251
204 Ga0105238_10004631 3300009551 Bacteria 13617
205 Ga0105238_10192895 3300009551 Bacteria 2013
206 Ga0105238_10277545 3300009551 Unclassified 1657
207 Ga0105249_10726768 3300009553 Bacteria 1054
208 Ga0105239_10000905 3300010375 Bacteria 42180
209 Ga0105239_10002298 3300010375 Bacteria 24404
210 Ga0105239_10004164 3300010375 Bacteria 17372
211 Ga0105239_10005517 3300010375 Bacteria 14819
212 Ga0105239_10128588 3300010375 Bacteria 2816
213 Ga0105239_10193214 3300010375 Unclassified 2279
214 Ga0105239_10214043 3300010375 Bacteria 2160
215 Ga0105239_10299388 3300010375 Unclassified 1811
216 Ga0105239_10395022 3300010375 Bacteria 1565
217 Ga0105239_11536912 3300010375 Unclassified 769
218 Ga0157373_10076517 3300013100 Bacteria 2361
219 Ga0157371_10081651 3300013102 Bacteria 2289
220 Ga0157371_10311278 3300013102 Bacteria 1141
221 Ga0157371_10371068 3300013102 Bacteria 1044
222 Ga0157370_10010896 3300013104 Bacteria 9549
223 Ga0157370_10195689 3300013104 Bacteria 1876
224 Ga0157370_10645765 3300013104 Bacteria 967
225 Ga0157370_10883211 3300013104 Bacteria 812
226 Ga0157369_10008242 3300013105 Bacteria 11946
227 Ga0157369_10042894 3300013105 Bacteria 4934
228 Ga0157369_10086327 3300013105 Unclassified 3351
229 Ga0157374_10000001 3300013296 Bacteria 1077351
230 Ga0157374_10002589 3300013296 Bacteria 15240
231 Ga0157374_10005519 3300013296 Bacteria 10633
232 Ga0157374_10018369 3300013296 Bacteria 6169
233 Ga0157374_10093356 3300013296 Bacteria 2873
234 Ga0157374_10137592 3300013296 Bacteria 2369
235 Ga0157378_10006348 3300013297 Bacteria 10343
236 Ga0157378_10128879 3300013297 Bacteria 2340
237 Ga0157378_10260104 3300013297 Bacteria 1665
238 Ga0157378_10602014 3300013297 Bacteria 1110
239 Ga0163162_10000377 3300013306 Bacteria 40533
240 Ga0163162_10000448 3300013306 Bacteria 38173
241 Ga0163162_10000634 3300013306 Bacteria 32545
242 Ga0163162_10001972 3300013306 Bacteria 19287
243 Ga0163162_10031603 3300013306 Bacteria 5252
244 Ga0163162_10269152 3300013306 Bacteria 1835
245 Ga0157372_10001344 3300013307 Bacteria 26596
246 Ga0157372_10002881 3300013307 Bacteria 18600
247 Ga0157372_10032732 3300013307 Bacteria 5704
248 Ga0157372_10095147 3300013307 Bacteria 3393
249 Ga0157372_10131249 3300013307 Bacteria 2882
250 Ga0157372_10140939 3300013307 Unclassified 2777
251 Ga0157372_10277296 3300013307 Bacteria 1949
252 Ga0157372_10572666 3300013307 Unclassified 1316
253 Ga0157372_10842445 3300013307 Bacteria 1065
254 Ga0157375_10000989 3300013308 Bacteria 24572
255 Ga0157375_10335179 3300013308 Bacteria 1678
256 Ga0157375_10392828 3300013308 Bacteria 1554
257 Ga0157375_12202165 3300013308 Unclassified 657
258 Ga0163163_10000752 3300014325 Bacteria 27543
259 Ga0163163_10647837 3300014325 Bacteria 1120
260 Ga0163163_12190509 3300014325 Unclassified 612
261 Ga0157380_10001033 3300014326 Bacteria 17764
262 Ga0157379_10000440 3300014968 Bacteria 33697
263 Ga0157379_10031736 3300014968 Bacteria 4706
264 Ga0157379_10169285 3300014968 Bacteria 1972
265 Ga0157379_10516026 3300014968 Bacteria 1109
266 Ga0157376_10000381 3300014969 Bacteria 28821
267 Ga0157376_10001182 3300014969 Bacteria 17205
268 Ga0157376_10002491 3300014969 Bacteria 12466
269 Ga0157376_10205195 3300014969 Bacteria 1816
270 Ga0157376_10309716 3300014969 Bacteria 1498
271 Ga0157376_10386594 3300014969 Unclassified 1349
272 Ga0157376_10532740 3300014969 Bacteria 1160
273 Ga0157376_10554247 3300014969 Unclassified 1138
274 Ga0213876_10015475 3300021384 Bacteria 4036
275 Ga0209646_1001770 3300025246 Bacteria 5417
276 Ga0207426_1000023 3300025302 Bacteria 545465
277 Ga0207656_10151806 3300025321 Bacteria 1097
278 Ga0207682_10254445 3300025893 Bacteria 818
279 Ga0207680_10080059 3300025903 Bacteria 2050
280 Ga0207654_10046381 3300025911 Bacteria 2478
281 Ga0207654_10543089 3300025911 Bacteria 825
282 Ga0207654_10550543 3300025911 Bacteria 819
283 Ga0207707_10013305 3300025912 Bacteria 7172
284 Ga0207707_10025996 3300025912 Bacteria 5119
285 Ga0207707_10234688 3300025912 Bacteria 1596
286 Ga0207707_10667624 3300025912 Unclassified 875
287 Ga0207695_10000071 3300025913 Bacteria 315568
288 Ga0207695_10000084 3300025913 Bacteria 282392
289 Ga0207695_10002195 3300025913 Bacteria 29420
290 Ga0207695_10006026 3300025913 Bacteria 15840
291 Ga0207695_10008205 3300025913 Bacteria 13116
292 Ga0207695_10015773 3300025913 Bacteria 8877
293 Ga0207695_10024694 3300025913 Bacteria 6752
294 Ga0207671_10067982 3300025914 Bacteria 2654
295 Ga0207671_10193844 3300025914 Bacteria 1585
296 Ga0207671_10494546 3300025914 Bacteria 975
297 Ga0207671_11047444 3300025914 Unclassified 642
298 Ga0207660_10013039 3300025917 Bacteria 5443
299 Ga0207657_10005086 3300025919 Bacteria 13782
300 Ga0207657_10298334 3300025919 Unclassified 1277
301 Ga0207652_10008417 3300025921 Bacteria 8302
302 Ga0207681_10573754 3300025923 Bacteria 930
303 Ga0207694_10193818 3300025924 Bacteria 1652
304 Ga0207650_10078318 3300025925 Unclassified 2501
305 Ga0207650_10206710 3300025925 Unclassified 1575
306 Ga0207659_10045229 3300025926 Bacteria 3102
307 Ga0207700_10637190 3300025928 Unclassified 950
308 Ga0207644_10087315 3300025931 Bacteria 2318
309 Ga0207644_10438269 3300025931 Bacteria 1072
310 Ga0207644_10662468 3300025931 Bacteria 869
311 Ga0207690_10475549 3300025932 Bacteria 1008
312 Ga0207706_10015444 3300025933 Bacteria 6898
313 Ga0207686_10338277 3300025934 Bacteria 1130
314 Ga0207670_10957940 3300025936 Bacteria 719
315 Ga0207669_11424522 3300025937 Bacteria 590
316 Ga0207704_10041366 3300025938 Bacteria 2702
317 Ga0207691_10045364 3300025940 Unclassified 4041
318 Ga0207691_10216771 3300025940 Bacteria 1661
319 Ga0207691_10335631 3300025940 Bacteria 1294
320 Ga0207691_11753945 3300025940 Bacteria 501
321 Ga0207689_10370668 3300025942 Bacteria 1191
322 Ga0207689_10870660 3300025942 Bacteria 760
323 Ga0207661_10011018 3300025944 Bacteria 6534
324 Ga0207667_10000177 3300025949 Bacteria 92852
325 Ga0207667_10017709 3300025949 Bacteria 8014
326 Ga0207667_10022196 3300025949 Bacteria 7019
327 Ga0207667_10055650 3300025949 Bacteria 4158
328 Ga0207667_10113006 3300025949 Unclassified 2800
329 Ga0207651_10056467 3300025960 Bacteria 2702
330 Ga0207651_11397716 3300025960 Unclassified 630
331 Ga0207640_10029200 3300025981 Unclassified 3382
332 Ga0207640_10064004 3300025981 Bacteria 2447
333 Ga0207640_10186571 3300025981 Bacteria 1560
334 Ga0207640_10240389 3300025981 Bacteria 1399
335 Ga0207658_10603337 3300025986 Unclassified 986
336 Ga0207677_10012864 3300026023 Bacteria 4831
337 Ga0207677_10019483 3300026023 Bacteria 4098
338 Ga0207703_10437898 3300026035 Bacteria 1219
339 Ga0207703_11930225 3300026035 Unclassified 567
340 Ga0207639_10088106 3300026041 Bacteria 2476
341 Ga0207639_10115315 3300026041 Unclassified 2197
342 Ga0207639_10460275 3300026041 Bacteria 1156
343 Ga0207639_10548962 3300026041 Bacteria 1061
344 Ga0207639_11964304 3300026041 Unclassified 546
345 Ga0207702_10029222 3300026078 Bacteria 4586
346 Ga0207702_10280242 3300026078 Bacteria 1576
347 Ga0207641_10071422 3300026088 Bacteria 2986
348 Ga0207641_10124919 3300026088 Bacteria 2302
349 Ga0207641_11910643 3300026088 Unclassified 595
350 Ga0207648_10224805 3300026089 Bacteria 1669
351 Ga0207648_10939299 3300026089 Unclassified 809
352 Ga0207676_10299788 3300026095 Unclassified 1467
353 Ga0207676_10970159 3300026095 Unclassified 836
354 Ga0207674_10284681 3300026116 Unclassified 1601
355 Ga0207675_100256482 3300026118 Bacteria 1694
356 Ga0207683_10031758 3300026121 Unclassified 4585
357 Ga0207683_10339901 3300026121 Bacteria 1377
358 Ga0207698_10032709 3300026142 Bacteria 3771
359 Ga0207698_10228028 3300026142 Bacteria 1689
360 Ga0207698_10261487 3300026142 Bacteria 1590
361 Ga0207698_11566532 3300026142 Unclassified 674
362 Ga0268266_10000038 3300028379 Bacteria 325729
363 Ga0268264_10000167 3300028381 Bacteria 146190
364 Ga0268264_10011712 3300028381 Bacteria 7232
365 Ga0268264_10025631 3300028381 Bacteria 4817
366 Ga0268264_10271863 3300028381 Bacteria 1583
367 Ga0268264_11942754 3300028381 Bacteria 598
368 Ga0307515_10000039 3300028794 Bacteria 323229
369 Ga0307515_10548216 3300028794 Bacteria 766
370 Ga0265338_10246535 3300028800 Bacteria 1320
371 Ga0265324_10048398 3300029957 Bacteria 1462
372 Ga0307511_10003621 3300030521 Bacteria 15822
373 Ga0265327_10306130 3300031251 Unclassified 699
374 Ga0307513_10312479 3300031456 Bacteria 1333
375 Ga0307513_10365218 3300031456 Bacteria 1187
376 Ga0307509_10151057 3300031507 Bacteria 2238
377 Ga0307508_10266851 3300031616 Bacteria 1306
378 Ga0307516_10095407 3300031730 Unclassified 2797
379 Ga0307507_10193150 3300033179 Bacteria 1426
380 Ga0307510_10000528 3300033180 Bacteria 38156
381 Ga0373944_0183128 3300035089 Unclassified 752
382 Ga0373943_0341932 3300035170 Bacteria 856
383 Ga0373935_0173590 3300035692 Bacteria 1476
384 Ga0373935_0583332 3300035692 Bacteria 817
385 Ga0373937_0074630 3300036401 Bacteria 3130
386 Ga0373937_1946524 3300036401 Bacteria 534
387 Ga0373925_0352005 3300037068 Unclassified 1196
388 Ga0373925_0814840 3300037068 Bacteria 770
389 Ga0395899_0285597 3300037312 Unclassified 1121
390 Ga0395901_0861103 3300038443 Bacteria 891
391 Ga0395901_0937462 3300038443 Unclassified 845
392 Ga0436365_1107423 3300039437 Bacteria 15965
393 Ga0436365_1715184 3300039437 Bacteria 1561
394 Ga0439439_0017796 3300041406 Bacteria 1751
395 Ga0451798_0192664 3300041458 Bacteria 521
396 Ga0451800_1552141 3300041459 Bacteria 683
397 Ga0451839_0520964 3300041496 Unclassified 617
398 Ga0451851_0290747 3300041507 Bacteria 601
399 Ga0451851_0544823 3300041507 Unclassified 1023
400 Ga0439449_0047559 3300042007 Bacteria 1588
401 Ga0439455_0230035 3300042012 Bacteria 540
402 Ga0439457_003645 3300042014 Bacteria 4163
403 Ga0439457_149347 3300042014 Bacteria 562
404 Ga0439462_0012746 3300042015 Bacteria 2150
405 Ga0451577_1352815 3300042876 Bacteria 632
406 Ga0466969_0000746 3300044656 Bacteria 17610
407 Ga0466972_0000004 3300044658 Bacteria 314413
408 Ga0466972_0000038 3300044658 Bacteria 135937
409 Ga0466972_0042946 3300044658 Bacteria 2196
410 Ga0466972_0281822 3300044658 Bacteria 777
411 Ga0466966_0001759 3300044684 Bacteria 14029
412 Ga0466964_0862073 3300044706 Unclassified 516
413 Ga0466971_0049048 3300044719 Unclassified 1899
414 Ga0466970_0001727 3300044765 Bacteria 10525
415 Ga0466970_0028363 3300044765 Unclassified 2940
416 Ga0466957_0001679 3300044842 Bacteria 11631
417 Ga0466957_0094917 3300044842 Bacteria 1873
418 Ga0466959_0000056 3300045049 Bacteria 78465
419 Ga0466959_0002096 3300045049 Bacteria 12611
420 Ga0495629_0055163 3300046459 Bacteria 2779
421 Ga0495638_0021712 3300046460 Bacteria 4223
422 Ga0495638_0190953 3300046460 Bacteria 1162
423 Ga0495662_0048235 3300046476 Bacteria 2056
424 Ga0495606_0083515 3300046507 Bacteria 1980
425 Ga0495628_0282321 3300046516 Bacteria 1233
426 Ga0495630_0127460 3300046517 Bacteria 1932
427 Ga0495632_0230178 3300046519 Bacteria 836
428 Ga0495648_0001092 3300046524 Bacteria 27599
429 Ga0495665_0088063 3300046531 Bacteria 1632
430 Ga0495633_0032150 3300046558 Bacteria 2537
431 Ga0495668_0002497 3300046616 Bacteria 15047
432 Ga0495634_0776850 3300046642 Unclassified 547
433 Ga0495611_0042739 3300046648 Bacteria 2024
434 Ga0495625_0260277 3300046660 Bacteria 1123
435 Ga0495635_0146062 3300046663 Bacteria 1610
436 Ga0495658_0021382 3300046683 Bacteria 3410
437 Ga0495658_0374843 3300046683 Bacteria 906
438 Ga0495613_0157097 3300046689 Bacteria 1620
439 Ga0495670_0113617 3300046691 Bacteria 1403
440 Ga0495649_0040228 3300046694 Bacteria 2561
441 Ga0495600_0149724 3300046809 Bacteria 1511
442 Ga0495604_0077659 3300047317 Bacteria 2495
443 Ga0495674_0030716 3300047319 Bacteria 4883
444 Ga0495674_0262514 3300047319 Bacteria 1419
445 Ga0495674_0461317 3300047319 Unclassified 1020
446 Ga0495674_1274188 3300047319 Unclassified 553
447 Ga0495684_0082936 3300047471 Bacteria 2432
448 Ga0495686_0000004 3300047472 Bacteria 869019
449 Ga0496105_0460551 3300048908 Bacteria 1003
450 Ga0496126_0811103 3300048929 Unclassified 717
451 Ga0501036_1274885 3300049572 Bacteria 598
452 Ga0501038_0562889 3300049574 Unclassified 866
453 Ga0501039_0487627 3300049575 Bacteria 968
454 Ga0501043_0507142 3300049579 Bacteria 901
455 Ga0501043_0571647 3300049579 Bacteria 838
456 Ga0501043_1034296 3300049579 Bacteria 583
457 Ga0501046_0337260 3300049580 Bacteria 1096
458 Ga0501047_0024102 3300049581 Bacteria 5845
459 Ga0501047_0032242 3300049581 Bacteria 5057
460 Ga0501047_0212024 3300049581 Bacteria 1795
461 Ga0501047_0606706 3300049581 Unclassified 916
462 Ga0501067_0080889 3300049583 Unclassified 1801
463 Ga0501069_0067667 3300049585 Unclassified 1998
464 Ga0501070_0111821 3300049586 Unclassified 2257
465 Ga0501071_0151180 3300049587 Unclassified 1732
466 Ga0501073_0060903 3300049589 Unclassified 2634
467 Ga0501074_0399064 3300049590 Bacteria 975
468 Ga0501219_000469 3300049703 Bacteria 6364
469 Ga0501080_0489801 3300049742 Unclassified 1099
470 Ga0501083_0075085 3300049744 Unclassified 2245
471 Ga0501241_130425 3300049758 Bacteria 566
472 Ga0501280_061553 3300049776 Unclassified 654
473 Ga0501044_0003293 3300049823 Bacteria 18191
474 Ga0501044_0020810 3300049823 Bacteria 7002
475 Ga0501044_0477872 3300049823 Bacteria 1150
476 Ga0501284_00029 3300050005 Bacteria 74818
477 nmdc:mga0k408_29233_c1 3300050493 Bacteria 3136
478 nmdc:mga05p37_4450_c1 3300050507 Bacteria 16377
479 nmdc:mga08y16_130270_c1 3300050511 Bacteria 2616
480 nmdc:mga08y16_368132_c1 3300050511 Bacteria 1474
481 Ga0500578_0019869 3300053086 Bacteria 4316
482 Ga0500646_0070535 3300053090 Bacteria 1047
483 Ga0500646_0088034 3300053090 Unclassified 957
484 Ga0500647_0145543 3300053091 Bacteria 1109
485 Ga0500583_0000047 3300053092 Bacteria 78958
486 Ga0500583_0024358 3300053092 Bacteria 2566
487 Ga0500583_0116992 3300053092 Unclassified 1317
488 Ga0500651_0327372 3300053093 Bacteria 874
489 Ga0500650_0397273 3300053098 Bacteria 597
490 Ga0500556_0305456 3300053104 Bacteria 621
491 Ga0500557_197618 3300053105 Unclassified 648
492 Ga0500642_0351008 3300053130 Unclassified 654
493 Ga0500658_0226274 3300053134 Bacteria 858
494 Ga0500658_0429518 3300053134 Bacteria 603
495 Ga0500559_0357263 3300053136 Bacteria 683
496 Ga0500559_0482294 3300053136 Bacteria 571
497 Ga0500568_0129303 3300053139 Bacteria 939
498 Ga0500573_0441182 3300053140 Unclassified 604
499 Ga0500604_0022496 3300053151 Unclassified 1790
500 Ga0500622_0002825 3300053156 Bacteria 12178
501 Ga0500622_0130827 3300053156 Bacteria 1206
502 Ga0500639_129917 3300053163 Bacteria 1195
503 Ga0500637_0142902 3300053178 Bacteria 1385
504 Ga0500637_0516504 3300053178 Bacteria 588
505 Ga0501082_0117161 3300060353 Unclassified 2307
506 Ga0466962_0075362 3300061719 Bacteria 1612
507 Ga0070681_11414362
508 JGI24740J21852_10007063
509 JGI25154J39366_1017064
510 rootH1_10092153
511 rootH2_10003376
512 rootH2_10008932
513 rootH2_10020101
514 rootH2_10041861
515 rootH2_10198091
516 rootL2_10031008
517 rootL2_10244506
518 rootL2_10356615
519 rootH1_10035779
520 JGI25160J50197_1001100
521 Ga0070658_10002849
522 Ga0070676_10001904
523 Ga0070676_10460159
524 Ga0070683_100006532
525 Ga0070690_100308722
526 Ga0070690_100322034
527 Ga0070690_100682264
528 Ga0070670_100210781
529 Ga0070670_100480412
530 Ga0070670_100645837
531 Ga0070670_100788857
532 Ga0070670_100884307
533 Ga0070677_10101659
534 Ga0068869_100079850
535 Ga0068869_100738860
536 Ga0070666_10000028
537 Ga0070666_10000885
538 Ga0070666_10044926
539 Ga0070680_100002380
540 Ga0070680_100288952
541 Ga0070682_100007128
542 Ga0070682_100013688
543 Ga0070682_101823490
544 Ga0068868_100000075
545 Ga0068868_100014908
546 Ga0068868_102333825
547 Ga0070660_100153155
548 Ga0070689_100220951
549 Ga0070689_101085193
550 Ga0070691_10009538
551 Ga0070691_10023899
552 Ga0070691_10549262
553 Ga0070668_100000859
554 Ga0070675_100034074
555 Ga0070675_100160092
556 Ga0070675_101482557
557 Ga0070675_101767967
558 Ga0070671_100050909
559 Ga0070671_100679687
560 Ga0070674_100113758
561 Ga0070673_100000448
562 Ga0070673_100006749
563 Ga0070688_100073351
564 Ga0070688_101576252
565 Ga0070659_100009989
566 Ga0070667_100000482
567 Ga0070667_100200810
568 Ga0070667_100305837
569 Ga0070667_101796270
570 Ga0070713_100492155
571 Ga0070700_101976788
572 Ga0070663_100355385
573 Ga0070678_100015835
574 Ga0070678_100027799
575 Ga0070678_100832510
576 Ga0070678_101511778
577 Ga0070681_10037887
578 Ga0070681_10048304
579 Ga0070681_10152052
580 Ga0068867_100013182
581 Ga0068867_101504481
582 Ga0068867_101605048
583 Ga0070685_10032691
584 Ga0070679_100031244
585 Ga0070679_100032277
586 Ga0070684_100002043
587 Ga0070684_100103525
588 Ga0068853_100006239
589 Ga0068853_100006774
590 Ga0068853_100029608
591 Ga0068853_100050294
592 Ga0068853_100358567
593 Ga0070672_100000758
594 Ga0070672_100098509
595 Ga0070672_100183801
596 Ga0070672_100284397
597 Ga0070672_100392161
598 Ga0070672_101002778
599 Ga0070693_100013591
600 Ga0070665_100000001
601 Ga0070665_100002163
602 Ga0070665_100782773
603 Ga0068855_100000089
604 Ga0068855_100047714
605 Ga0068855_100050054
606 Ga0068855_100138482
607 Ga0068855_100266374
608 Ga0068855_100349208
609 Ga0070664_100023115
610 Ga0070664_100057753
611 Ga0070664_100708467
612 Ga0068857_100010174
613 Ga0068857_100259917
614 Ga0068854_100013828
615 Ga0068854_100037722
616 Ga0068854_100054903
617 Ga0068854_100213830
618 Ga0068854_100417952
619 Ga0068854_100587028
620 Ga0068856_100008851
621 Ga0068856_100076515
622 Ga0068856_100079385
623 Ga0068856_100315928
624 Ga0068852_100000488
625 Ga0068852_100018236
626 Ga0068852_100097578
627 Ga0068852_100306250
628 Ga0068852_100381467
629 Ga0068852_100508344
630 Ga0068852_101220022
631 Ga0068852_101305214
632 Ga0068852_101509686
633 Ga0068852_101712624
634 Ga0068859_100000012
635 Ga0068859_100027733
636 Ga0068859_100487586
637 Ga0068859_102364348
638 Ga0068864_100034417
639 Ga0068864_100119280
640 Ga0068864_100400092
641 Ga0068864_100567040
642 Ga0068864_100620449
643 Ga0068866_10397269
644 Ga0068861_100005861
645 Ga0068861_100330046
646 Ga0068851_10001706
647 Ga0068851_10009442
648 Ga0068851_10030811
649 Ga0068863_100001512
650 Ga0068863_100002125
651 Ga0068863_100012779
652 Ga0068863_100678348
653 Ga0068863_101313033
654 Ga0068858_100001413
655 Ga0068858_100088249
656 Ga0068858_100456777
657 Ga0068860_100002836
658 Ga0068860_100012660
659 Ga0068860_100080155
660 Ga0068860_100081331
661 Ga0068860_100155985
662 Ga0068862_100986915
663 Ga0081540_1029496
664 Ga0081539_10000337
665 Ga0070715_10429160
666 Ga0075366_10070147
667 Ga0075366_10250892
668 Ga0075366_10336226
669 Ga0097621_100003845
670 Ga0097621_100004135
671 Ga0097621_100037246
672 Ga0097621_100320116
673 Ga0097621_100490020
674 Ga0068871_100000981
675 Ga0068871_100008715
676 Ga0068871_100060621
677 Ga0068871_100072892
678 Ga0068871_100287925
679 Ga0068871_100319534
680 Ga0068871_100735237
681 Ga0068865_100000413
682 Ga0068865_100112252
683 Ga0097620_100000012
684 Ga0097620_100027729
685 Ga0097620_100487562
686 Ga0097620_102364883
687 Ga0105240_10003016
688 Ga0105240_10005940
689 Ga0105240_10025898
690 Ga0105240_10035594
691 Ga0105240_10079750
692 Ga0105240_10105967
693 Ga0105240_10246368
694 Ga0105245_10063832
695 Ga0105245_10592713
696 Ga0105241_10000619
697 Ga0105241_10003218
698 Ga0105241_10577895
699 Ga0105241_10583492
700 Ga0105248_10165075
701 Ga0105237_10002854
702 Ga0105237_10004335
703 Ga0105237_10008089
704 Ga0105237_10016648
705 Ga0105237_10044083
706 Ga0105237_10226734
707 Ga0105237_10348034
708 Ga0105237_10368992
709 Ga0105237_10478580
710 Ga0105238_10004631
711 Ga0105238_10192895
712 Ga0105238_10277545
713 Ga0105249_10726768
714 Ga0105239_10000905
715 Ga0105239_10002298
716 Ga0105239_10004164
717 Ga0105239_10005517
718 Ga0105239_10128588
719 Ga0105239_10193214
720 Ga0105239_10214043
721 Ga0105239_10299388
722 Ga0105239_10395022
723 Ga0105239_11536912
724 Ga0157373_10076517
725 Ga0157371_10081651
726 Ga0157371_10311278
727 Ga0157371_10371068
728 Ga0157370_10010896
729 Ga0157370_10195689
730 Ga0157370_10645765
731 Ga0157370_10883211
732 Ga0157369_10008242
733 Ga0157369_10042894
734 Ga0157369_10086327
735 Ga0157374_10000001
736 Ga0157374_10002589
737 Ga0157374_10005519
738 Ga0157374_10018369
739 Ga0157374_10093356
740 Ga0157374_10137592
741 Ga0157378_10006348
742 Ga0157378_10128879
743 Ga0157378_10260104
744 Ga0157378_10602014
745 Ga0163162_10000377
746 Ga0163162_10000448
747 Ga0163162_10000634
748 Ga0163162_10001972
749 Ga0163162_10031603
750 Ga0163162_10269152
751 Ga0157372_10001344
752 Ga0157372_10002881
753 Ga0157372_10032732
754 Ga0157372_10095147
755 Ga0157372_10131249
756 Ga0157372_10140939
757 Ga0157372_10277296
758 Ga0157372_10572666
759 Ga0157372_10842445
760 Ga0157375_10000989
761 Ga0157375_10335179
762 Ga0157375_10392828
763 Ga0157375_12202165
764 Ga0163163_10000752
765 Ga0163163_10647837
766 Ga0163163_12190509
767 Ga0157380_10001033
768 Ga0157379_10000440
769 Ga0157379_10031736
770 Ga0157379_10169285
771 Ga0157379_10516026
772 Ga0157376_10000381
773 Ga0157376_10001182
774 Ga0157376_10002491
775 Ga0157376_10205195
776 Ga0157376_10309716
777 Ga0157376_10386594
778 Ga0157376_10532740
779 Ga0157376_10554247
780 Ga0213876_10015475
781 Ga0209646_1001770
782 Ga0207426_1000023
783 Ga0207656_10151806
784 Ga0207682_10254445
785 Ga0207680_10080059
786 Ga0207654_10046381
787 Ga0207654_10543089
788 Ga0207654_10550543
789 Ga0207707_10013305
790 Ga0207707_10025996
791 Ga0207707_10234688
792 Ga0207707_10667624
793 Ga0207695_10000071
794 Ga0207695_10000084
795 Ga0207695_10002195
796 Ga0207695_10006026
797 Ga0207695_10008205
798 Ga0207695_10015773
799 Ga0207695_10024694
800 Ga0207671_10067982
801 Ga0207671_10193844
802 Ga0207671_10494546
803 Ga0207671_11047444
804 Ga0207660_10013039
805 Ga0207657_10005086
806 Ga0207657_10298334
807 Ga0207652_10008417
808 Ga0207681_10573754
809 Ga0207694_10193818
810 Ga0207650_10078318
811 Ga0207650_10206710
812 Ga0207659_10045229
813 Ga0207700_10637190
814 Ga0207644_10087315
815 Ga0207644_10438269
816 Ga0207644_10662468
817 Ga0207690_10475549
818 Ga0207706_10015444
819 Ga0207686_10338277
820 Ga0207670_10957940
821 Ga0207669_11424522
822 Ga0207704_10041366
823 Ga0207691_10045364
824 Ga0207691_10216771
825 Ga0207691_10335631
826 Ga0207691_11753945
827 Ga0207689_10370668
828 Ga0207689_10870660
829 Ga0207661_10011018
830 Ga0207667_10000177
831 Ga0207667_10017709
832 Ga0207667_10022196
833 Ga0207667_10055650
834 Ga0207667_10113006
835 Ga0207651_10056467
836 Ga0207651_11397716
837 Ga0207640_10029200
838 Ga0207640_10064004
839 Ga0207640_10186571
840 Ga0207640_10240389
841 Ga0207658_10603337
842 Ga0207677_10012864
843 Ga0207677_10019483
844 Ga0207703_10437898
845 Ga0207703_11930225
846 Ga0207639_10088106
847 Ga0207639_10115315
848 Ga0207639_10460275
849 Ga0207639_10548962
850 Ga0207639_11964304
851 Ga0207702_10029222
852 Ga0207702_10280242
853 Ga0207641_10071422
854 Ga0207641_10124919
855 Ga0207641_11910643
856 Ga0207648_10224805
857 Ga0207648_10939299
858 Ga0207676_10299788
859 Ga0207676_10970159
860 Ga0207674_10284681
861 Ga0207675_100256482
862 Ga0207683_10031758
863 Ga0207683_10339901
864 Ga0207698_10032709
865 Ga0207698_10228028
866 Ga0207698_10261487
867 Ga0207698_11566532
868 Ga0268266_10000038
869 Ga0268264_10000167
870 Ga0268264_10011712
871 Ga0268264_10025631
872 Ga0268264_10271863
873 Ga0268264_11942754
874 Ga0307515_10000039
875 Ga0307515_10548216
876 Ga0265338_10246535
877 Ga0265324_10048398
878 Ga0307511_10003621
879 Ga0265327_10306130
880 Ga0307513_10312479
881 Ga0307513_10365218
882 Ga0307509_10151057
883 Ga0307508_10266851
884 Ga0307516_10095407
885 Ga0307507_10193150
886 Ga0307510_10000528
887 Ga0373944_0183128
888 Ga0373943_0341932
889 Ga0373935_0173590
890 Ga0373935_0583332
891 Ga0373937_0074630
892 Ga0373937_1946524
893 Ga0373925_0352005
894 Ga0373925_0814840
895 Ga0395899_0285597
896 Ga0395901_0861103
897 Ga0395901_0937462
898 Ga0436365_1107423
899 Ga0436365_1715184
900 Ga0439439_0017796
901 Ga0451798_0192664
902 Ga0451800_1552141
903 Ga0451839_0520964
904 Ga0451851_0290747
905 Ga0451851_0544823
906 Ga0439449_0047559
907 Ga0439455_0230035
908 Ga0439457_003645
909 Ga0439457_149347
910 Ga0439462_0012746
911 Ga0451577_1352815
912 Ga0466969_0000746
913 Ga0466972_0000004
914 Ga0466972_0000038
915 Ga0466972_0042946
916 Ga0466972_0281822
917 Ga0466966_0001759
918 Ga0466964_0862073
919 Ga0466971_0049048
920 Ga0466970_0001727
921 Ga0466970_0028363
922 Ga0466957_0001679
923 Ga0466957_0094917
924 Ga0466959_0000056
925 Ga0466959_0002096
926 Ga0495629_0055163
927 Ga0495638_0021712
928 Ga0495638_0190953
929 Ga0495662_0048235
930 Ga0495606_0083515
931 Ga0495628_0282321
932 Ga0495630_0127460
933 Ga0495632_0230178
934 Ga0495648_0001092
935 Ga0495665_0088063
936 Ga0495633_0032150
937 Ga0495668_0002497
938 Ga0495634_0776850
939 Ga0495611_0042739
940 Ga0495625_0260277
941 Ga0495635_0146062
942 Ga0495658_0021382
943 Ga0495658_0374843
944 Ga0495613_0157097
945 Ga0495670_0113617
946 Ga0495649_0040228
947 Ga0495600_0149724
948 Ga0495604_0077659
949 Ga0495674_0030716
950 Ga0495674_0262514
951 Ga0495674_0461317
952 Ga0495674_1274188
953 Ga0495684_0082936
954 Ga0495686_0000004
955 Ga0496105_0460551
956 Ga0496126_0811103
957 Ga0501036_1274885
958 Ga0501038_0562889
959 Ga0501039_0487627
960 Ga0501043_0507142
961 Ga0501043_0571647
962 Ga0501043_1034296
963 Ga0501046_0337260
964 Ga0501047_0024102
965 Ga0501047_0032242
966 Ga0501047_0212024
967 Ga0501047_0606706
968 Ga0501067_0080889
969 Ga0501069_0067667
970 Ga0501070_0111821
971 Ga0501071_0151180
972 Ga0501073_0060903
973 Ga0501074_0399064
974 Ga0501219_000469
975 Ga0501080_0489801
976 Ga0501083_0075085
977 Ga0501241_130425
978 Ga0501280_061553
979 Ga0501044_0003293
980 Ga0501044_0020810
981 Ga0501044_0477872
982 Ga0501284_00029
983 nmdc:mga0k408_29233_c1
984 nmdc:mga05p37_4450_c1
985 nmdc:mga08y16_130270_c1
986 nmdc:mga08y16_368132_c1
987 Ga0500578_0019869
988 Ga0500646_0070535
989 Ga0500646_0088034
990 Ga0500647_0145543
991 Ga0500583_0000047
992 Ga0500583_0024358
993 Ga0500583_0116992
994 Ga0500651_0327372
995 Ga0500650_0397273
996 Ga0500556_0305456
997 Ga0500557_197618
998 Ga0500642_0351008
999 Ga0500658_0226274
1000 Ga0500658_0429518
1001 Ga0500559_0357263
1002 Ga0500559_0482294
1003 Ga0500568_0129303
1004 Ga0500573_0441182
1005 Ga0500604_0022496
1006 Ga0500622_0002825
1007 Ga0500622_0130827
1008 Ga0500639_129917
1009 Ga0500637_0142902
1010 Ga0500637_0516504
1011 Ga0501082_0117161
1012 Ga0466962_0075362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

18

103

0.98

PF13279

4HBT_2

Thioesterase-like superfamily

10

130

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9453 4 130
1z54-assembly1.cif.gz_C crystal structure of a hypothetical protein tt1821 from thermus thermophilus 0.9382 4 133
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9371 4 131
2egi-assembly1.cif.gz_A crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9361 5 131
2egi-assembly1.cif.gz_G crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9352 4 126
ID Description Score Start End Superfamily
af_Q2FYS8_3_144_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9471 4 122 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9453 4 130 3.10.129.10
2egiG00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9352 4 126 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9319 2 133 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9292 3 135 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A5B8VJP1-F1-model_v4 Acyl-CoA thioesterase 0.9871 1 135 GO:0047617
AF-A0A1K1QTQ3-F1-model_v4 Acyl-CoA thioester hydrolase 0.9855 2 136 GO:0047617
AF-A0A1H3ZKB3-F1-model_v4 Acyl-CoA thioester hydrolase 0.9849 1 135 GO:0047617
AF-A0A1I4XML4-F1-model_v4 Acyl-CoA thioester hydrolase 0.9829 2 136 GO:0047617
AF-A0A317M6C6-F1-model_v4 Acyl-CoA thioester hydrolase 0.9825 2 136 GO:0047617

Map