F456485
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 506 | 236 | 1012 | 448 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100236540|Ga0070679_1002365401 |
| Length | 484 |
| Sequence | MPSVAERGTPRDSMSTVTPTPGSTPRPFHLLAKPTGAVCNLDCAYCFFLSKELLYPGSRFRMADELLETYLRQLIEAHGSEPEIAIAWQGGEPTLMGLDFFRRSVEIANSYLRPGQRAVYTIQTNGTLLDEEWAAFFREHSFLVGISIDGPRELHDAYRVDKGGKGSFDRVIRGLDCLRDGGVEWNVLTTVHAANGDHGRAVYRFLRDECGAQFIQFIPIIERDGGSAPPAEWTSWRDRPLYLQEGTATSERSVTASQYGRFLIDVFEEWVRHDVGEVYVQMFDVTLANWMGEPPGLCVHSETCGSALALEHTGDLYSCDHFVEPTYKLGNIKMTHMLDMISSPQQQRFGLDKRNTLPRFCLECDVRFVCHGGCPKDRFIETPDGEPGLNYLCDGFKAFFHHVAGPMRIMTELLEQGRAPSEIVAWYRAQDAKRGRNDVCTCGSGRKWKHCHGTETIPPMIWPRAGFSSRTRPPSESRGSETGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 106 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 107 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 108 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 114 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 121 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 124 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 126 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 127 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 128 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 134 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 142 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 143 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 144 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 145 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 236 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.47 |
| Rhizosphere | 89.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070679_100236540 | 3300005530 | Bacteria | 1785 |
| 2 | JGI24751J29686_10000364 | 3300002459 | Bacteria | 15588 |
| 3 | Ga0070670_100005638 | 3300005331 | Bacteria | 10563 |
| 4 | Ga0070670_100049054 | 3300005331 | Bacteria | 3632 |
| 5 | Ga0070666_10037103 | 3300005335 | Bacteria | 3239 |
| 6 | Ga0068868_100013366 | 3300005338 | Bacteria | 6020 |
| 7 | Ga0070660_100004332 | 3300005339 | Bacteria | 9801 |
| 8 | Ga0070689_100003696 | 3300005340 | Bacteria | 10222 |
| 9 | Ga0070687_100042305 | 3300005343 | Bacteria | 2308 |
| 10 | Ga0070668_100022624 | 3300005347 | Bacteria | 4753 |
| 11 | Ga0070669_100049766 | 3300005353 | Bacteria | 3060 |
| 12 | Ga0070674_100010699 | 3300005356 | Bacteria | 5559 |
| 13 | Ga0070659_100034762 | 3300005366 | Bacteria | 3921 |
| 14 | Ga0070667_100020322 | 3300005367 | Bacteria | 5512 |
| 15 | Ga0070714_100023937 | 3300005435 | Bacteria | 5023 |
| 16 | Ga0070714_100157962 | 3300005435 | Bacteria | 2049 |
| 17 | Ga0070711_100023574 | 3300005439 | Bacteria | 4005 |
| 18 | Ga0070711_100065001 | 3300005439 | Bacteria | 2550 |
| 19 | Ga0070700_100004534 | 3300005441 | Bacteria | 7266 |
| 20 | Ga0070694_100080771 | 3300005444 | Bacteria | 2260 |
| 21 | Ga0070708_100005227 | 3300005445 | Bacteria | 10280 |
| 22 | Ga0070663_100003467 | 3300005455 | Bacteria | 9089 |
| 23 | Ga0070681_10069437 | 3300005458 | Bacteria | 3490 |
| 24 | Ga0068867_100003101 | 3300005459 | Bacteria | 11711 |
| 25 | Ga0070685_10008098 | 3300005466 | Bacteria | 5388 |
| 26 | Ga0070706_100003826 | 3300005467 | Bacteria | 14708 |
| 27 | Ga0070706_100032132 | 3300005467 | Bacteria | 4841 |
| 28 | Ga0070706_100108676 | 3300005467 | Bacteria | 2581 |
| 29 | Ga0070707_100029782 | 3300005468 | Bacteria | 5195 |
| 30 | Ga0070707_100060001 | 3300005468 | Bacteria | 3648 |
| 31 | Ga0070698_100011063 | 3300005471 | Bacteria | 9588 |
| 32 | Ga0070698_100020809 | 3300005471 | Bacteria | 6876 |
| 33 | Ga0070699_100072459 | 3300005518 | Bacteria | 2996 |
| 34 | Ga0070679_100023802 | 3300005530 | Bacteria | 6000 |
| 35 | Ga0070679_100124569 | 3300005530 | Bacteria | 2560 |
| 36 | Ga0068853_100009301 | 3300005539 | Bacteria | 7926 |
| 37 | Ga0070672_100093302 | 3300005543 | Bacteria | 2431 |
| 38 | Ga0070695_100118716 | 3300005545 | Bacteria | 1806 |
| 39 | Ga0070696_100008409 | 3300005546 | Bacteria | 6905 |
| 40 | Ga0070693_100011536 | 3300005547 | Bacteria | 4453 |
| 41 | Ga0070665_100006556 | 3300005548 | Bacteria | 11831 |
| 42 | Ga0070664_100073299 | 3300005564 | Bacteria | 2937 |
| 43 | Ga0070664_100172357 | 3300005564 | Bacteria | 1920 |
| 44 | Ga0068857_100011547 | 3300005577 | Bacteria | 7685 |
| 45 | Ga0068857_100066707 | 3300005577 | Bacteria | 3203 |
| 46 | Ga0068857_100169493 | 3300005577 | Bacteria | 1984 |
| 47 | Ga0068856_100016953 | 3300005614 | Bacteria | 7060 |
| 48 | Ga0068856_100062892 | 3300005614 | Bacteria | 3666 |
| 49 | Ga0068852_100096231 | 3300005616 | Bacteria | 2661 |
| 50 | Ga0068864_100002916 | 3300005618 | Bacteria | 14149 |
| 51 | Ga0068866_10009250 | 3300005718 | Bacteria | 4178 |
| 52 | Ga0068861_100045145 | 3300005719 | Bacteria | 3316 |
| 53 | Ga0068861_100129676 | 3300005719 | Bacteria | 2045 |
| 54 | Ga0068870_10007806 | 3300005840 | Bacteria | 4786 |
| 55 | Ga0068863_100006716 | 3300005841 | Bacteria | 11280 |
| 56 | Ga0068863_100068543 | 3300005841 | Bacteria | 3355 |
| 57 | Ga0068860_100051931 | 3300005843 | Bacteria | 3900 |
| 58 | Ga0081455_10002831 | 3300005937 | Bacteria | 20421 |
| 59 | Ga0081455_10027661 | 3300005937 | Bacteria | 5194 |
| 60 | Ga0070717_10008143 | 3300006028 | Bacteria | 7822 |
| 61 | Ga0070717_10053718 | 3300006028 | Bacteria | 3321 |
| 62 | Ga0070717_10058624 | 3300006028 | Bacteria | 3184 |
| 63 | Ga0070712_100014065 | 3300006175 | Bacteria | 5131 |
| 64 | Ga0070712_100028719 | 3300006175 | Bacteria | 3722 |
| 65 | Ga0070712_100062023 | 3300006175 | Bacteria | 2643 |
| 66 | Ga0097621_100015662 | 3300006237 | Bacteria | 5712 |
| 67 | Ga0097621_100166818 | 3300006237 | Bacteria | 1896 |
| 68 | Ga0068871_100002894 | 3300006358 | Bacteria | 11781 |
| 69 | Ga0068871_100168184 | 3300006358 | Bacteria | 1878 |
| 70 | Ga0075431_100210410 | 3300006847 | Bacteria | 1986 |
| 71 | Ga0075433_10103798 | 3300006852 | Bacteria | 2518 |
| 72 | Ga0075434_100124004 | 3300006871 | Bacteria | 2600 |
| 73 | Ga0068865_100002653 | 3300006881 | Bacteria | 10626 |
| 74 | Ga0075436_100005921 | 3300006914 | Bacteria | 8401 |
| 75 | Ga0111539_10022227 | 3300009094 | Bacteria | 7797 |
| 76 | Ga0111539_10065777 | 3300009094 | Bacteria | 4283 |
| 77 | Ga0105245_10102118 | 3300009098 | Bacteria | 2655 |
| 78 | Ga0105245_10119171 | 3300009098 | Bacteria | 2464 |
| 79 | Ga0114129_10080778 | 3300009147 | Bacteria | 4519 |
| 80 | Ga0105241_10066948 | 3300009174 | Bacteria | 2779 |
| 81 | Ga0105242_10005638 | 3300009176 | Bacteria | 9663 |
| 82 | Ga0105238_10031025 | 3300009551 | Bacteria | 5441 |
| 83 | Ga0105238_10034622 | 3300009551 | Bacteria | 5138 |
| 84 | Ga0105249_10001299 | 3300009553 | Bacteria | 21875 |
| 85 | Ga0105249_10011422 | 3300009553 | Bacteria | 7800 |
| 86 | Ga0105239_10003000 | 3300010375 | Bacteria | 21043 |
| 87 | Ga0105239_10019317 | 3300010375 | Bacteria | 7526 |
| 88 | Ga0105239_10112522 | 3300010375 | Bacteria | 3018 |
| 89 | Ga0105239_10158771 | 3300010375 | Bacteria | 2526 |
| 90 | Ga0105246_10000631 | 3300011119 | Bacteria | 19645 |
| 91 | Ga0105246_10049441 | 3300011119 | Bacteria | 2880 |
| 92 | Ga0157374_10016268 | 3300013296 | Bacteria | 6536 |
| 93 | Ga0157374_10100719 | 3300013296 | Bacteria | 2769 |
| 94 | Ga0163162_10007913 | 3300013306 | Bacteria | 10360 |
| 95 | Ga0163162_10029741 | 3300013306 | Bacteria | 5407 |
| 96 | Ga0157372_10033187 | 3300013307 | Bacteria | 5668 |
| 97 | Ga0157372_10096340 | 3300013307 | Bacteria | 3372 |
| 98 | Ga0163163_10007633 | 3300014325 | Bacteria | 9553 |
| 99 | Ga0157380_10010051 | 3300014326 | Bacteria | 6792 |
| 100 | Ga0157377_10075031 | 3300014745 | Bacteria | 1963 |
| 101 | Ga0157376_10011956 | 3300014969 | Bacteria | 6420 |
| 102 | Ga0163161_10127250 | 3300017792 | Bacteria | 1919 |
| 103 | Ga0207692_10001200 | 3300025898 | Bacteria | 9613 |
| 104 | Ga0207642_10004739 | 3300025899 | Bacteria | 4391 |
| 105 | Ga0207643_10007440 | 3300025908 | Bacteria | 5876 |
| 106 | Ga0207684_10000574 | 3300025910 | Bacteria | 44726 |
| 107 | Ga0207684_10085667 | 3300025910 | Bacteria | 2683 |
| 108 | Ga0207693_10000838 | 3300025915 | Bacteria | 27394 |
| 109 | Ga0207693_10001310 | 3300025915 | Bacteria | 22068 |
| 110 | Ga0207693_10005354 | 3300025915 | Bacteria | 10723 |
| 111 | Ga0207693_10032508 | 3300025915 | Bacteria | 4117 |
| 112 | Ga0207693_10075471 | 3300025915 | Bacteria | 2640 |
| 113 | Ga0207663_10005861 | 3300025916 | Bacteria | 6231 |
| 114 | Ga0207663_10139109 | 3300025916 | Bacteria | 1689 |
| 115 | Ga0207662_10034213 | 3300025918 | Bacteria | 2965 |
| 116 | Ga0207657_10005294 | 3300025919 | Bacteria | 13516 |
| 117 | Ga0207652_10022216 | 3300025921 | Bacteria | 5244 |
| 118 | Ga0207652_10049071 | 3300025921 | Bacteria | 3611 |
| 119 | Ga0207646_10206638 | 3300025922 | Bacteria | 1773 |
| 120 | Ga0207650_10000584 | 3300025925 | Bacteria | 29312 |
| 121 | Ga0207687_10005957 | 3300025927 | Bacteria | 8065 |
| 122 | Ga0207687_10016123 | 3300025927 | Bacteria | 4905 |
| 123 | Ga0207664_10003430 | 3300025929 | Bacteria | 10567 |
| 124 | Ga0207664_10266684 | 3300025929 | Bacteria | 1499 |
| 125 | Ga0207644_10008068 | 3300025931 | Bacteria | 6890 |
| 126 | Ga0207644_10012108 | 3300025931 | Bacteria | 5722 |
| 127 | Ga0207686_10150567 | 3300025934 | Bacteria | 1619 |
| 128 | Ga0207704_10002075 | 3300025938 | Bacteria | 8972 |
| 129 | Ga0207665_10003181 | 3300025939 | Bacteria | 10994 |
| 130 | Ga0207691_10012873 | 3300025940 | Bacteria | 8008 |
| 131 | Ga0207712_10008962 | 3300025961 | Bacteria | 6327 |
| 132 | Ga0207712_10009630 | 3300025961 | Bacteria | 6120 |
| 133 | Ga0207712_10050917 | 3300025961 | Bacteria | 2894 |
| 134 | Ga0207668_10009922 | 3300025972 | Bacteria | 5725 |
| 135 | Ga0207668_10019694 | 3300025972 | Bacteria | 4271 |
| 136 | Ga0207677_10020568 | 3300026023 | Bacteria | 4010 |
| 137 | Ga0207639_10026471 | 3300026041 | Bacteria | 4215 |
| 138 | Ga0207708_10002999 | 3300026075 | Bacteria | 12436 |
| 139 | Ga0207702_10008917 | 3300026078 | Bacteria | 8456 |
| 140 | Ga0207641_10000605 | 3300026088 | Bacteria | 39451 |
| 141 | Ga0207641_10053352 | 3300026088 | Bacteria | 3427 |
| 142 | Ga0207648_10003424 | 3300026089 | Bacteria | 16646 |
| 143 | Ga0207676_10000835 | 3300026095 | Bacteria | 23994 |
| 144 | Ga0207674_10016400 | 3300026116 | Bacteria | 8110 |
| 145 | Ga0207674_10075917 | 3300026116 | Bacteria | 3370 |
| 146 | Ga0207674_10175136 | 3300026116 | Bacteria | 2098 |
| 147 | Ga0207675_100002157 | 3300026118 | Bacteria | 19547 |
| 148 | Ga0207683_10010846 | 3300026121 | Bacteria | 7772 |
| 149 | Ga0268266_10029385 | 3300028379 | Bacteria | 4673 |
| 150 | Ga0268264_10037886 | 3300028381 | Bacteria | 3977 |
| 151 | Ga0265338_10008682 | 3300028800 | Bacteria | 12293 |
| 152 | Ga0265760_10017369 | 3300031090 | Bacteria | 2066 |
| 153 | Ga0265327_10003153 | 3300031251 | Bacteria | 16178 |
| 154 | Ga0316579_10002295 | 3300031691 | Bacteria | 7216 |
| 155 | Ga0316576_10055700 | 3300031727 | Bacteria | 2886 |
| 156 | Ga0316578_10029120 | 3300031728 | Bacteria | 3132 |
| 157 | Ga0316577_10000051 | 3300031733 | Bacteria | 27441 |
| 158 | Ga0316577_10006523 | 3300031733 | Bacteria | 6167 |
| 159 | Ga0307409_100038798 | 3300031995 | Bacteria | 3526 |
| 160 | Ga0307409_100133242 | 3300031995 | Bacteria | 2127 |
| 161 | Ga0307416_100058644 | 3300032002 | Bacteria | 3123 |
| 162 | Ga0307411_10024824 | 3300032005 | Bacteria | 3580 |
| 163 | Ga0307415_100089871 | 3300032126 | Bacteria | 2220 |
| 164 | Ga0316583_10012157 | 3300032133 | Bacteria | 3106 |
| 165 | Ga0373928_0007609 | 3300035084 | Bacteria | 2092 |
| 166 | Ga0373934_0000003 | 3300035086 | Bacteria | 87823 |
| 167 | Ga0373934_0000828 | 3300035086 | Bacteria | 11173 |
| 168 | Ga0373949_0007397 | 3300035090 | Bacteria | 2404 |
| 169 | Ga0373953_0000347 | 3300035117 | Bacteria | 12507 |
| 170 | Ga0373954_0000186 | 3300035118 | Bacteria | 22463 |
| 171 | Ga0373954_0001600 | 3300035118 | Bacteria | 9236 |
| 172 | Ga0373954_0047125 | 3300035118 | Bacteria | 2016 |
| 173 | Ga0373956_0003515 | 3300035119 | Bacteria | 6307 |
| 174 | Ga0373957_0000360 | 3300035120 | Bacteria | 11609 |
| 175 | Ga0373957_0013441 | 3300035120 | Bacteria | 2777 |
| 176 | Ga0373943_0027078 | 3300035170 | Bacteria | 2691 |
| 177 | Ga0373946_0097762 | 3300035171 | Bacteria | 1311 |
| 178 | Ga0373955_0001691 | 3300035172 | Bacteria | 9435 |
| 179 | Ga0373955_0003150 | 3300035172 | Bacteria | 7215 |
| 180 | Ga0373955_0027468 | 3300035172 | Bacteria | 2943 |
| 181 | Ga0373942_0002609 | 3300035207 | Bacteria | 4342 |
| 182 | Ga0373962_0011030 | 3300035242 | Bacteria | 2260 |
| 183 | Ga0316574_0003343 | 3300035398 | Bacteria | 8257 |
| 184 | Ga0316574_0024538 | 3300035398 | Bacteria | 3610 |
| 185 | Ga0316574_0026177 | 3300035398 | Bacteria | 3507 |
| 186 | Ga0373924_0000135 | 3300035410 | Bacteria | 21359 |
| 187 | Ga0373924_0045887 | 3300035410 | Bacteria | 1798 |
| 188 | Ga0373931_0059903 | 3300035691 | Bacteria | 2048 |
| 189 | Ga0373935_0043976 | 3300035692 | Bacteria | 2813 |
| 190 | Ga0373933_0000003 | 3300035724 | Bacteria | 150420 |
| 191 | Ga0373933_0012320 | 3300035724 | Bacteria | 4723 |
| 192 | Ga0373933_0055783 | 3300035724 | Bacteria | 2371 |
| 193 | Ga0373947_0019135 | 3300035725 | Bacteria | 3947 |
| 194 | Ga0373947_0042665 | 3300035725 | Bacteria | 2708 |
| 195 | Ga0373937_0000016 | 3300036401 | Bacteria | 145523 |
| 196 | Ga0373937_0009055 | 3300036401 | Bacteria | 8640 |
| 197 | Ga0373937_0009428 | 3300036401 | Bacteria | 8486 |
| 198 | Ga0373937_0016613 | 3300036401 | Bacteria | 6539 |
| 199 | Ga0373937_0109247 | 3300036401 | Bacteria | 2572 |
| 200 | Ga0373937_0136967 | 3300036401 | Bacteria | 2289 |
| 201 | Ga0373937_0171231 | 3300036401 | Bacteria | 2037 |
| 202 | Ga0373937_0190388 | 3300036401 | Bacteria | 1928 |
| 203 | Ga0373937_0216730 | 3300036401 | Bacteria | 1801 |
| 204 | Ga0373937_0264958 | 3300036401 | Bacteria | 1621 |
| 205 | Ga0316582_0164843 | 3300036647 | Bacteria | 1502 |
| 206 | Ga0316584_0034031 | 3300036712 | Bacteria | 3776 |
| 207 | Ga0316584_0050796 | 3300036712 | Bacteria | 3100 |
| 208 | Ga0316584_0113591 | 3300036712 | Bacteria | 2026 |
| 209 | Ga0373925_0000092 | 3300037068 | Bacteria | 95847 |
| 210 | Ga0373925_0011131 | 3300037068 | Bacteria | 6524 |
| 211 | Ga0373925_0052636 | 3300037068 | Bacteria | 3042 |
| 212 | Ga0373925_0097664 | 3300037068 | Bacteria | 2253 |
| 213 | Ga0395899_0145981 | 3300037312 | Bacteria | 1680 |
| 214 | Ga0395900_0011765 | 3300037418 | Bacteria | 8948 |
| 215 | Ga0395905_0047503 | 3300037471 | Bacteria | 4023 |
| 216 | Ga0316581_0002876 | 3300037588 | Bacteria | 4213 |
| 217 | Ga0395901_0040568 | 3300038443 | Bacteria | 4822 |
| 218 | Ga0400484_12813 | 3300038725 | Bacteria | 1996 |
| 219 | Ga0436360_1253763 | 3300039438 | Bacteria | 8422 |
| 220 | Ga0436362_0998725 | 3300039453 | Bacteria | 3084 |
| 221 | Ga0439460_0009866 | 3300042461 | Bacteria | 2433 |
| 222 | Ga0495592_0000116 | 3300046454 | Bacteria | 70091 |
| 223 | Ga0495592_0005402 | 3300046454 | Bacteria | 9431 |
| 224 | Ga0495592_0064503 | 3300046454 | Bacteria | 2684 |
| 225 | Ga0495603_0025517 | 3300046455 | Bacteria | 3574 |
| 226 | Ga0495603_0169852 | 3300046455 | Unclassified | 1263 |
| 227 | Ga0495629_0004527 | 3300046459 | Bacteria | 10399 |
| 228 | Ga0495629_0010423 | 3300046459 | Bacteria | 6764 |
| 229 | Ga0495641_0056073 | 3300046461 | Bacteria | 1787 |
| 230 | Ga0495651_0000009 | 3300046462 | Bacteria | 150455 |
| 231 | Ga0495651_0000890 | 3300046462 | Bacteria | 23234 |
| 232 | Ga0495651_0002816 | 3300046462 | Bacteria | 13475 |
| 233 | Ga0495651_0012572 | 3300046462 | Bacteria | 6534 |
| 234 | Ga0495651_0015502 | 3300046462 | Bacteria | 5896 |
| 235 | Ga0495651_0098366 | 3300046462 | Bacteria | 2183 |
| 236 | Ga0495653_0001057 | 3300046463 | Bacteria | 21196 |
| 237 | Ga0495653_0007538 | 3300046463 | Bacteria | 8898 |
| 238 | Ga0495653_0017241 | 3300046463 | Bacteria | 5873 |
| 239 | Ga0495653_0018111 | 3300046463 | Bacteria | 5726 |
| 240 | Ga0495653_0036693 | 3300046463 | Bacteria | 3859 |
| 241 | Ga0495653_0043494 | 3300046463 | Bacteria | 3492 |
| 242 | Ga0495653_0059423 | 3300046463 | Bacteria | 2901 |
| 243 | Ga0495580_0063691 | 3300046472 | Bacteria | 2585 |
| 244 | Ga0495582_0000274 | 3300046473 | Bacteria | 28739 |
| 245 | Ga0495582_0024120 | 3300046473 | Bacteria | 3326 |
| 246 | Ga0495662_0096701 | 3300046476 | Bacteria | 1443 |
| 247 | Ga0495662_0114509 | 3300046476 | Bacteria | 1322 |
| 248 | Ga0495664_0010396 | 3300046477 | Bacteria | 5219 |
| 249 | Ga0495664_0051157 | 3300046477 | Bacteria | 2453 |
| 250 | Ga0495664_0052108 | 3300046477 | Bacteria | 2430 |
| 251 | Ga0495596_0030441 | 3300046500 | Bacteria | 2161 |
| 252 | Ga0495608_0000019 | 3300046511 | Bacteria | 180119 |
| 253 | Ga0495608_0002026 | 3300046511 | Bacteria | 14539 |
| 254 | Ga0495608_0003841 | 3300046511 | Bacteria | 10799 |
| 255 | Ga0495608_0006234 | 3300046511 | Bacteria | 8464 |
| 256 | Ga0495608_0014472 | 3300046511 | Bacteria | 5472 |
| 257 | Ga0495608_0015594 | 3300046511 | Bacteria | 5264 |
| 258 | Ga0495618_0002062 | 3300046514 | Bacteria | 13193 |
| 259 | Ga0495618_0006813 | 3300046514 | Bacteria | 6920 |
| 260 | Ga0495618_0019296 | 3300046514 | Bacteria | 4193 |
| 261 | Ga0495618_0111900 | 3300046514 | Bacteria | 1748 |
| 262 | Ga0495618_0162792 | 3300046514 | Bacteria | 1422 |
| 263 | Ga0495628_0000487 | 3300046516 | Bacteria | 36399 |
| 264 | Ga0495628_0004867 | 3300046516 | Bacteria | 11821 |
| 265 | Ga0495628_0092279 | 3300046516 | Bacteria | 2343 |
| 266 | Ga0495628_0112557 | 3300046516 | Bacteria | 2092 |
| 267 | Ga0495630_0019494 | 3300046517 | Bacteria | 4985 |
| 268 | Ga0495630_0027032 | 3300046517 | Bacteria | 4252 |
| 269 | Ga0495630_0031052 | 3300046517 | Bacteria | 3976 |
| 270 | Ga0495630_0098274 | 3300046517 | Bacteria | 2214 |
| 271 | Ga0495630_0182451 | 3300046517 | Bacteria | 1600 |
| 272 | Ga0495630_0230946 | 3300046517 | Bacteria | 1413 |
| 273 | Ga0495666_0048523 | 3300046526 | Bacteria | 2045 |
| 274 | Ga0495652_0000430 | 3300046529 | Bacteria | 49080 |
| 275 | Ga0495652_0003930 | 3300046529 | Bacteria | 14435 |
| 276 | Ga0495652_0006794 | 3300046529 | Bacteria | 10605 |
| 277 | Ga0495652_0016406 | 3300046529 | Bacteria | 6627 |
| 278 | Ga0495652_0020501 | 3300046529 | Bacteria | 5877 |
| 279 | Ga0495652_0046662 | 3300046529 | Bacteria | 3718 |
| 280 | Ga0495652_0072540 | 3300046529 | Bacteria | 2869 |
| 281 | Ga0495665_0028617 | 3300046531 | Bacteria | 2987 |
| 282 | Ga0495665_0029076 | 3300046531 | Bacteria | 2962 |
| 283 | Ga0495640_0011976 | 3300046533 | Bacteria | 6650 |
| 284 | Ga0495640_0021568 | 3300046533 | Bacteria | 4726 |
| 285 | Ga0495640_0035659 | 3300046533 | Bacteria | 3519 |
| 286 | Ga0495587_0000041 | 3300046536 | Bacteria | 110168 |
| 287 | Ga0495587_0004049 | 3300046536 | Bacteria | 9706 |
| 288 | Ga0495587_0019408 | 3300046536 | Bacteria | 4207 |
| 289 | Ga0495587_0021307 | 3300046536 | Bacteria | 3997 |
| 290 | Ga0495587_0054069 | 3300046536 | Bacteria | 2367 |
| 291 | Ga0495645_0004438 | 3300046543 | Bacteria | 9580 |
| 292 | Ga0495645_0013960 | 3300046543 | Bacteria | 5692 |
| 293 | Ga0495667_0000037 | 3300046559 | Bacteria | 133780 |
| 294 | Ga0495667_0000993 | 3300046559 | Bacteria | 18378 |
| 295 | Ga0495667_0002979 | 3300046559 | Bacteria | 11357 |
| 296 | Ga0495667_0003692 | 3300046559 | Bacteria | 10294 |
| 297 | Ga0495667_0008426 | 3300046559 | Bacteria | 6996 |
| 298 | Ga0495667_0015271 | 3300046559 | Bacteria | 5185 |
| 299 | Ga0495667_0138371 | 3300046559 | Bacteria | 1569 |
| 300 | Ga0495634_0040696 | 3300046642 | Bacteria | 3158 |
| 301 | Ga0495634_0044327 | 3300046642 | Bacteria | 3011 |
| 302 | Ga0495634_0092558 | 3300046642 | Bacteria | 1961 |
| 303 | Ga0495635_0002890 | 3300046663 | Bacteria | 11794 |
| 304 | Ga0495635_0009369 | 3300046663 | Bacteria | 6844 |
| 305 | Ga0495635_0009406 | 3300046663 | Bacteria | 6833 |
| 306 | Ga0495635_0024810 | 3300046663 | Bacteria | 4178 |
| 307 | Ga0495635_0029937 | 3300046663 | Bacteria | 3785 |
| 308 | Ga0495635_0030047 | 3300046663 | Bacteria | 3777 |
| 309 | Ga0495635_0115337 | 3300046663 | Bacteria | 1834 |
| 310 | Ga0495657_0000094 | 3300046675 | Bacteria | 78779 |
| 311 | Ga0495657_0004273 | 3300046675 | Bacteria | 11411 |
| 312 | Ga0495657_0004926 | 3300046675 | Bacteria | 10623 |
| 313 | Ga0495657_0007323 | 3300046675 | Bacteria | 8536 |
| 314 | Ga0495657_0011112 | 3300046675 | Bacteria | 6747 |
| 315 | Ga0495657_0055406 | 3300046675 | Bacteria | 2644 |
| 316 | Ga0495657_0058499 | 3300046675 | Bacteria | 2559 |
| 317 | Ga0495657_0058658 | 3300046675 | Bacteria | 2555 |
| 318 | Ga0495599_0000040 | 3300046678 | Bacteria | 97423 |
| 319 | Ga0495599_0000979 | 3300046678 | Bacteria | 15978 |
| 320 | Ga0495599_0001250 | 3300046678 | Bacteria | 14421 |
| 321 | Ga0495599_0001497 | 3300046678 | Bacteria | 13431 |
| 322 | Ga0495599_0029551 | 3300046678 | Bacteria | 3435 |
| 323 | Ga0495599_0046256 | 3300046678 | Bacteria | 2729 |
| 324 | Ga0495599_0151135 | 3300046678 | Bacteria | 1438 |
| 325 | Ga0495623_0000284 | 3300046679 | Bacteria | 32990 |
| 326 | Ga0495623_0051926 | 3300046679 | Bacteria | 2592 |
| 327 | Ga0495646_0001358 | 3300046680 | Bacteria | 14465 |
| 328 | Ga0495646_0040640 | 3300046680 | Bacteria | 2862 |
| 329 | Ga0495647_0071241 | 3300046681 | Bacteria | 1392 |
| 330 | Ga0495658_0000235 | 3300046683 | Bacteria | 31858 |
| 331 | Ga0495658_0023591 | 3300046683 | Bacteria | 3267 |
| 332 | Ga0495669_0013107 | 3300046684 | Bacteria | 3530 |
| 333 | Ga0495613_0001970 | 3300046689 | Bacteria | 15582 |
| 334 | Ga0495613_0012039 | 3300046689 | Bacteria | 6428 |
| 335 | Ga0495613_0034843 | 3300046689 | Bacteria | 3738 |
| 336 | Ga0495613_0106589 | 3300046689 | Bacteria | 2022 |
| 337 | Ga0495624_0048096 | 3300046690 | Bacteria | 2708 |
| 338 | Ga0495624_0079796 | 3300046690 | Bacteria | 2029 |
| 339 | Ga0495624_0085431 | 3300046690 | Bacteria | 1949 |
| 340 | Ga0495600_0000803 | 3300046809 | Bacteria | 16646 |
| 341 | Ga0495600_0004587 | 3300046809 | Bacteria | 8280 |
| 342 | Ga0495600_0012450 | 3300046809 | Bacteria | 5320 |
| 343 | Ga0495600_0015250 | 3300046809 | Bacteria | 4856 |
| 344 | Ga0495600_0086011 | 3300046809 | Bacteria | 2051 |
| 345 | Ga0495600_0102483 | 3300046809 | Bacteria | 1865 |
| 346 | Ga0495581_0000177 | 3300047315 | Bacteria | 29096 |
| 347 | Ga0495581_0026266 | 3300047315 | Bacteria | 3377 |
| 348 | Ga0495581_0032151 | 3300047315 | Bacteria | 3039 |
| 349 | Ga0495581_0053923 | 3300047315 | Bacteria | 2321 |
| 350 | Ga0495604_0000040 | 3300047317 | Bacteria | 120837 |
| 351 | Ga0495604_0003280 | 3300047317 | Bacteria | 12930 |
| 352 | Ga0495604_0014989 | 3300047317 | Bacteria | 6183 |
| 353 | Ga0495604_0039104 | 3300047317 | Bacteria | 3729 |
| 354 | Ga0495604_0039680 | 3300047317 | Bacteria | 3699 |
| 355 | Ga0495604_0040029 | 3300047317 | Bacteria | 3681 |
| 356 | Ga0495604_0043481 | 3300047317 | Bacteria | 3517 |
| 357 | Ga0495674_0013237 | 3300047319 | Bacteria | 7756 |
| 358 | Ga0495674_0018410 | 3300047319 | Bacteria | 6502 |
| 359 | Ga0495674_0021418 | 3300047319 | Bacteria | 5979 |
| 360 | Ga0495674_0022037 | 3300047319 | Bacteria | 5879 |
| 361 | Ga0495674_0023240 | 3300047319 | Bacteria | 5715 |
| 362 | Ga0495674_0026457 | 3300047319 | Bacteria | 5308 |
| 363 | Ga0495674_0030814 | 3300047319 | Bacteria | 4874 |
| 364 | Ga0495674_0047244 | 3300047319 | Bacteria | 3817 |
| 365 | Ga0495674_0052099 | 3300047319 | Bacteria | 3603 |
| 366 | Ga0495674_0111648 | 3300047319 | Bacteria | 2317 |
| 367 | Ga0495674_0188342 | 3300047319 | Bacteria | 1716 |
| 368 | Ga0495674_0239701 | 3300047319 | Bacteria | 1495 |
| 369 | Ga0495676_0008424 | 3300047321 | Bacteria | 9453 |
| 370 | Ga0495676_0115262 | 3300047321 | Bacteria | 1965 |
| 371 | Ga0495680_0000010 | 3300047322 | Bacteria | 142931 |
| 372 | Ga0495680_0002042 | 3300047322 | Bacteria | 21132 |
| 373 | Ga0495680_0002219 | 3300047322 | Bacteria | 20043 |
| 374 | Ga0495680_0007108 | 3300047322 | Bacteria | 10308 |
| 375 | Ga0495680_0016453 | 3300047322 | Bacteria | 6351 |
| 376 | Ga0495680_0017952 | 3300047322 | Bacteria | 6018 |
| 377 | Ga0495680_0027104 | 3300047322 | Bacteria | 4712 |
| 378 | Ga0495680_0032504 | 3300047322 | Bacteria | 4234 |
| 379 | Ga0495680_0036863 | 3300047322 | Bacteria | 3921 |
| 380 | Ga0495680_0199534 | 3300047322 | Bacteria | 1436 |
| 381 | Ga0495675_0000111 | 3300047444 | Bacteria | 58822 |
| 382 | Ga0495675_0066070 | 3300047444 | Bacteria | 2286 |
| 383 | Ga0495675_0070468 | 3300047444 | Bacteria | 2207 |
| 384 | Ga0495684_0001499 | 3300047471 | Bacteria | 18680 |
| 385 | Ga0495684_0002514 | 3300047471 | Bacteria | 14609 |
| 386 | Ga0495684_0019483 | 3300047471 | Bacteria | 5225 |
| 387 | Ga0495684_0031348 | 3300047471 | Bacteria | 4081 |
| 388 | Ga0495684_0040755 | 3300047471 | Bacteria | 3559 |
| 389 | Ga0495684_0041313 | 3300047471 | Bacteria | 3534 |
| 390 | Ga0495684_0082569 | 3300047471 | Bacteria | 2438 |
| 391 | Ga0495602_0000130 | 3300048088 | Bacteria | 71178 |
| 392 | Ga0495602_0007030 | 3300048088 | Bacteria | 11817 |
| 393 | Ga0495602_0016477 | 3300048088 | Bacteria | 7433 |
| 394 | Ga0495602_0017950 | 3300048088 | Bacteria | 7080 |
| 395 | Ga0495602_0026666 | 3300048088 | Bacteria | 5569 |
| 396 | Ga0495602_0073410 | 3300048088 | Bacteria | 2912 |
| 397 | Ga0495602_0080049 | 3300048088 | Bacteria | 2753 |
| 398 | Ga0495602_0087568 | 3300048088 | Bacteria | 2595 |
| 399 | Ga0496100_0002742 | 3300048903 | Bacteria | 9002 |
| 400 | Ga0496100_0003392 | 3300048903 | Bacteria | 8301 |
| 401 | Ga0496101_0008369 | 3300048904 | Bacteria | 6758 |
| 402 | Ga0496101_0010501 | 3300048904 | Bacteria | 6116 |
| 403 | Ga0496101_0040662 | 3300048904 | Bacteria | 3311 |
| 404 | Ga0496102_0008009 | 3300048905 | Bacteria | 9032 |
| 405 | Ga0496102_0106574 | 3300048905 | Bacteria | 2609 |
| 406 | Ga0496102_0362332 | 3300048905 | Bacteria | 1365 |
| 407 | Ga0496102_0410764 | 3300048905 | Bacteria | 1272 |
| 408 | Ga0496103_0007384 | 3300048906 | Bacteria | 6550 |
| 409 | Ga0496103_0012836 | 3300048906 | Bacteria | 4969 |
| 410 | Ga0496104_0008130 | 3300048907 | Bacteria | 9307 |
| 411 | Ga0496104_0016191 | 3300048907 | Bacteria | 6769 |
| 412 | Ga0496104_0078975 | 3300048907 | Bacteria | 3136 |
| 413 | Ga0496104_0094163 | 3300048907 | Bacteria | 2865 |
| 414 | Ga0496104_0142323 | 3300048907 | Bacteria | 2304 |
| 415 | Ga0496104_0189860 | 3300048907 | Bacteria | 1966 |
| 416 | Ga0496105_0001125 | 3300048908 | Bacteria | 18625 |
| 417 | Ga0496105_0020893 | 3300048908 | Bacteria | 5294 |
| 418 | Ga0496105_0021259 | 3300048908 | Bacteria | 5251 |
| 419 | Ga0496105_0119005 | 3300048908 | Bacteria | 2179 |
| 420 | Ga0496105_0192252 | 3300048908 | Bacteria | 1668 |
| 421 | Ga0496106_0006141 | 3300048909 | Bacteria | 8885 |
| 422 | Ga0496106_0016373 | 3300048909 | Bacteria | 5486 |
| 423 | Ga0496106_0034939 | 3300048909 | Bacteria | 3757 |
| 424 | Ga0496106_0040381 | 3300048909 | Bacteria | 3494 |
| 425 | Ga0496106_0054610 | 3300048909 | Bacteria | 3018 |
| 426 | Ga0496106_0092027 | 3300048909 | Bacteria | 2342 |
| 427 | Ga0496106_0175347 | 3300048909 | Bacteria | 1701 |
| 428 | Ga0496107_0003351 | 3300048910 | Bacteria | 10705 |
| 429 | Ga0496107_0009677 | 3300048910 | Bacteria | 6681 |
| 430 | Ga0496107_0032019 | 3300048910 | Bacteria | 3756 |
| 431 | Ga0496108_0018577 | 3300048911 | Bacteria | 5694 |
| 432 | Ga0496108_0019058 | 3300048911 | Bacteria | 5629 |
| 433 | Ga0496108_0034349 | 3300048911 | Bacteria | 4214 |
| 434 | Ga0496109_0001161 | 3300048912 | Bacteria | 21914 |
| 435 | Ga0496109_0005924 | 3300048912 | Bacteria | 10257 |
| 436 | Ga0496109_0018725 | 3300048912 | Bacteria | 6088 |
| 437 | Ga0496109_0198334 | 3300048912 | Bacteria | 1887 |
| 438 | Ga0496109_0270432 | 3300048912 | Bacteria | 1601 |
| 439 | Ga0496109_0311252 | 3300048912 | Bacteria | 1486 |
| 440 | Ga0496110_0040537 | 3300048913 | Bacteria | 4058 |
| 441 | Ga0496110_0043298 | 3300048913 | Bacteria | 3931 |
| 442 | Ga0496110_0111058 | 3300048913 | Bacteria | 2464 |
| 443 | Ga0496111_0186007 | 3300048914 | Bacteria | 1544 |
| 444 | Ga0496112_0019538 | 3300048915 | Bacteria | 6396 |
| 445 | Ga0496113_0059614 | 3300048916 | Bacteria | 2876 |
| 446 | Ga0496114_0007239 | 3300048917 | Bacteria | 8765 |
| 447 | Ga0496114_0028725 | 3300048917 | Bacteria | 4566 |
| 448 | Ga0496114_0067009 | 3300048917 | Bacteria | 3011 |
| 449 | Ga0496114_0109442 | 3300048917 | Bacteria | 2366 |
| 450 | Ga0496115_0000591 | 3300048918 | Bacteria | 27782 |
| 451 | Ga0496115_0098717 | 3300048918 | Bacteria | 2392 |
| 452 | Ga0501034_0106134 | 3300049571 | Bacteria | 2802 |
| 453 | Ga0501036_0227905 | 3300049572 | Bacteria | 1564 |
| 454 | Ga0501037_0016310 | 3300049573 | Bacteria | 5467 |
| 455 | Ga0501038_0036802 | 3300049574 | Bacteria | 4294 |
| 456 | Ga0501042_0011310 | 3300049578 | Bacteria | 6017 |
| 457 | Ga0501042_0019923 | 3300049578 | Bacteria | 4664 |
| 458 | Ga0501043_0041469 | 3300049579 | Bacteria | 3616 |
| 459 | Ga0501046_0149601 | 3300049580 | Bacteria | 1762 |
| 460 | Ga0501047_0003527 | 3300049581 | Bacteria | 14764 |
| 461 | Ga0501048_0021442 | 3300049582 | Bacteria | 4730 |
| 462 | Ga0501067_0000274 | 3300049583 | Bacteria | 28121 |
| 463 | Ga0501068_0000008 | 3300049584 | Bacteria | 73707 |
| 464 | Ga0501068_0016639 | 3300049584 | Bacteria | 4240 |
| 465 | Ga0501069_0001093 | 3300049585 | Bacteria | 13067 |
| 466 | Ga0501069_0043004 | 3300049585 | Bacteria | 2500 |
| 467 | Ga0501072_0000004 | 3300049588 | Bacteria | 282897 |
| 468 | Ga0501073_0018351 | 3300049589 | Bacteria | 5056 |
| 469 | Ga0501074_0000205 | 3300049590 | Bacteria | 32327 |
| 470 | Ga0501074_0020749 | 3300049590 | Bacteria | 4772 |
| 471 | Ga0501076_0003225 | 3300049592 | Bacteria | 11403 |
| 472 | Ga0501076_0039696 | 3300049592 | Bacteria | 3696 |
| 473 | Ga0501076_0103340 | 3300049592 | Bacteria | 2298 |
| 474 | Ga0501077_0053474 | 3300049593 | Bacteria | 2563 |
| 475 | Ga0501077_0071928 | 3300049593 | Bacteria | 2192 |
| 476 | Ga0501079_0011326 | 3300049741 | Bacteria | 6803 |
| 477 | Ga0501080_0000952 | 3300049742 | Bacteria | 23698 |
| 478 | Ga0501081_0005308 | 3300049743 | Bacteria | 8308 |
| 479 | Ga0501083_0019132 | 3300049744 | Bacteria | 4769 |
| 480 | Ga0501083_0022737 | 3300049744 | Bacteria | 4350 |
| 481 | Ga0501035_0029798 | 3300049822 | Bacteria | 4977 |
| 482 | Ga0501045_0060681 | 3300049824 | Bacteria | 2772 |
| 483 | nmdc:mga05p37_61842_c1 | 3300050507 | Bacteria | 4609 |
| 484 | nmdc:mga05p37_93139_c1 | 3300050507 | Bacteria | 3713 |
| 485 | nmdc:mga08y16_25441_c1 | 3300050511 | Bacteria | 6242 |
| 486 | nmdc:mga0n895_36020_c1 | 3300050512 | Bacteria | 4776 |
| 487 | nmdc:mga0a205_25731_c1 | 3300050515 | Bacteria | 5608 |
| 488 | nmdc:mga0a205_30139_c1 | 3300050515 | Bacteria | 5194 |
| 489 | Ga0495601_0007082 | 3300053077 | Bacteria | 6570 |
| 490 | Ga0495601_0081914 | 3300053077 | Bacteria | 2071 |
| 491 | Ga0495601_0106871 | 3300053077 | Bacteria | 1810 |
| 492 | Ga0495601_0124046 | 3300053077 | Bacteria | 1679 |
| 493 | Ga0495595_0001990 | 3300053084 | Bacteria | 7951 |
| 494 | Ga0495595_0003683 | 3300053084 | Bacteria | 6095 |
| 495 | Ga0495595_0025865 | 3300053084 | Bacteria | 2604 |
| 496 | Ga0495619_0006826 | 3300053085 | Bacteria | 7215 |
| 497 | Ga0495619_0026633 | 3300053085 | Bacteria | 3721 |
| 498 | Ga0495619_0062316 | 3300053085 | Bacteria | 2482 |
| 499 | Ga0495619_0074135 | 3300053085 | Bacteria | 2282 |
| 500 | Ga0495619_0096109 | 3300053085 | Bacteria | 2011 |
| 501 | Ga0495619_0156090 | 3300053085 | Bacteria | 1575 |
| 502 | Ga0501084_0001872 | 3300054114 | Bacteria | 16764 |
| 503 | Ga0501084_0051885 | 3300054114 | Bacteria | 3432 |
| 504 | Ga0501082_0000113 | 3300060353 | Bacteria | 63799 |
| 505 | Ga0530510_0044604 | 3300061734 | Bacteria | 3204 |
| 506 | 2819668375 | 2818991458 | Bacteria | 4794049 |
| 507 | Ga0070679_100236540 | |||
| 508 | JGI24751J29686_10000364 | |||
| 509 | Ga0070670_100005638 | |||
| 510 | Ga0070670_100049054 | |||
| 511 | Ga0070666_10037103 | |||
| 512 | Ga0068868_100013366 | |||
| 513 | Ga0070660_100004332 | |||
| 514 | Ga0070689_100003696 | |||
| 515 | Ga0070687_100042305 | |||
| 516 | Ga0070668_100022624 | |||
| 517 | Ga0070669_100049766 | |||
| 518 | Ga0070674_100010699 | |||
| 519 | Ga0070659_100034762 | |||
| 520 | Ga0070667_100020322 | |||
| 521 | Ga0070714_100023937 | |||
| 522 | Ga0070714_100157962 | |||
| 523 | Ga0070711_100023574 | |||
| 524 | Ga0070711_100065001 | |||
| 525 | Ga0070700_100004534 | |||
| 526 | Ga0070694_100080771 | |||
| 527 | Ga0070708_100005227 | |||
| 528 | Ga0070663_100003467 | |||
| 529 | Ga0070681_10069437 | |||
| 530 | Ga0068867_100003101 | |||
| 531 | Ga0070685_10008098 | |||
| 532 | Ga0070706_100003826 | |||
| 533 | Ga0070706_100032132 | |||
| 534 | Ga0070706_100108676 | |||
| 535 | Ga0070707_100029782 | |||
| 536 | Ga0070707_100060001 | |||
| 537 | Ga0070698_100011063 | |||
| 538 | Ga0070698_100020809 | |||
| 539 | Ga0070699_100072459 | |||
| 540 | Ga0070679_100023802 | |||
| 541 | Ga0070679_100124569 | |||
| 542 | Ga0068853_100009301 | |||
| 543 | Ga0070672_100093302 | |||
| 544 | Ga0070695_100118716 | |||
| 545 | Ga0070696_100008409 | |||
| 546 | Ga0070693_100011536 | |||
| 547 | Ga0070665_100006556 | |||
| 548 | Ga0070664_100073299 | |||
| 549 | Ga0070664_100172357 | |||
| 550 | Ga0068857_100011547 | |||
| 551 | Ga0068857_100066707 | |||
| 552 | Ga0068857_100169493 | |||
| 553 | Ga0068856_100016953 | |||
| 554 | Ga0068856_100062892 | |||
| 555 | Ga0068852_100096231 | |||
| 556 | Ga0068864_100002916 | |||
| 557 | Ga0068866_10009250 | |||
| 558 | Ga0068861_100045145 | |||
| 559 | Ga0068861_100129676 | |||
| 560 | Ga0068870_10007806 | |||
| 561 | Ga0068863_100006716 | |||
| 562 | Ga0068863_100068543 | |||
| 563 | Ga0068860_100051931 | |||
| 564 | Ga0081455_10002831 | |||
| 565 | Ga0081455_10027661 | |||
| 566 | Ga0070717_10008143 | |||
| 567 | Ga0070717_10053718 | |||
| 568 | Ga0070717_10058624 | |||
| 569 | Ga0070712_100014065 | |||
| 570 | Ga0070712_100028719 | |||
| 571 | Ga0070712_100062023 | |||
| 572 | Ga0097621_100015662 | |||
| 573 | Ga0097621_100166818 | |||
| 574 | Ga0068871_100002894 | |||
| 575 | Ga0068871_100168184 | |||
| 576 | Ga0075431_100210410 | |||
| 577 | Ga0075433_10103798 | |||
| 578 | Ga0075434_100124004 | |||
| 579 | Ga0068865_100002653 | |||
| 580 | Ga0075436_100005921 | |||
| 581 | Ga0111539_10022227 | |||
| 582 | Ga0111539_10065777 | |||
| 583 | Ga0105245_10102118 | |||
| 584 | Ga0105245_10119171 | |||
| 585 | Ga0114129_10080778 | |||
| 586 | Ga0105241_10066948 | |||
| 587 | Ga0105242_10005638 | |||
| 588 | Ga0105238_10031025 | |||
| 589 | Ga0105238_10034622 | |||
| 590 | Ga0105249_10001299 | |||
| 591 | Ga0105249_10011422 | |||
| 592 | Ga0105239_10003000 | |||
| 593 | Ga0105239_10019317 | |||
| 594 | Ga0105239_10112522 | |||
| 595 | Ga0105239_10158771 | |||
| 596 | Ga0105246_10000631 | |||
| 597 | Ga0105246_10049441 | |||
| 598 | Ga0157374_10016268 | |||
| 599 | Ga0157374_10100719 | |||
| 600 | Ga0163162_10007913 | |||
| 601 | Ga0163162_10029741 | |||
| 602 | Ga0157372_10033187 | |||
| 603 | Ga0157372_10096340 | |||
| 604 | Ga0163163_10007633 | |||
| 605 | Ga0157380_10010051 | |||
| 606 | Ga0157377_10075031 | |||
| 607 | Ga0157376_10011956 | |||
| 608 | Ga0163161_10127250 | |||
| 609 | Ga0207692_10001200 | |||
| 610 | Ga0207642_10004739 | |||
| 611 | Ga0207643_10007440 | |||
| 612 | Ga0207684_10000574 | |||
| 613 | Ga0207684_10085667 | |||
| 614 | Ga0207693_10000838 | |||
| 615 | Ga0207693_10001310 | |||
| 616 | Ga0207693_10005354 | |||
| 617 | Ga0207693_10032508 | |||
| 618 | Ga0207693_10075471 | |||
| 619 | Ga0207663_10005861 | |||
| 620 | Ga0207663_10139109 | |||
| 621 | Ga0207662_10034213 | |||
| 622 | Ga0207657_10005294 | |||
| 623 | Ga0207652_10022216 | |||
| 624 | Ga0207652_10049071 | |||
| 625 | Ga0207646_10206638 | |||
| 626 | Ga0207650_10000584 | |||
| 627 | Ga0207687_10005957 | |||
| 628 | Ga0207687_10016123 | |||
| 629 | Ga0207664_10003430 | |||
| 630 | Ga0207664_10266684 | |||
| 631 | Ga0207644_10008068 | |||
| 632 | Ga0207644_10012108 | |||
| 633 | Ga0207686_10150567 | |||
| 634 | Ga0207704_10002075 | |||
| 635 | Ga0207665_10003181 | |||
| 636 | Ga0207691_10012873 | |||
| 637 | Ga0207712_10008962 | |||
| 638 | Ga0207712_10009630 | |||
| 639 | Ga0207712_10050917 | |||
| 640 | Ga0207668_10009922 | |||
| 641 | Ga0207668_10019694 | |||
| 642 | Ga0207677_10020568 | |||
| 643 | Ga0207639_10026471 | |||
| 644 | Ga0207708_10002999 | |||
| 645 | Ga0207702_10008917 | |||
| 646 | Ga0207641_10000605 | |||
| 647 | Ga0207641_10053352 | |||
| 648 | Ga0207648_10003424 | |||
| 649 | Ga0207676_10000835 | |||
| 650 | Ga0207674_10016400 | |||
| 651 | Ga0207674_10075917 | |||
| 652 | Ga0207674_10175136 | |||
| 653 | Ga0207675_100002157 | |||
| 654 | Ga0207683_10010846 | |||
| 655 | Ga0268266_10029385 | |||
| 656 | Ga0268264_10037886 | |||
| 657 | Ga0265338_10008682 | |||
| 658 | Ga0265760_10017369 | |||
| 659 | Ga0265327_10003153 | |||
| 660 | Ga0316579_10002295 | |||
| 661 | Ga0316576_10055700 | |||
| 662 | Ga0316578_10029120 | |||
| 663 | Ga0316577_10000051 | |||
| 664 | Ga0316577_10006523 | |||
| 665 | Ga0307409_100038798 | |||
| 666 | Ga0307409_100133242 | |||
| 667 | Ga0307416_100058644 | |||
| 668 | Ga0307411_10024824 | |||
| 669 | Ga0307415_100089871 | |||
| 670 | Ga0316583_10012157 | |||
| 671 | Ga0373928_0007609 | |||
| 672 | Ga0373934_0000003 | |||
| 673 | Ga0373934_0000828 | |||
| 674 | Ga0373949_0007397 | |||
| 675 | Ga0373953_0000347 | |||
| 676 | Ga0373954_0000186 | |||
| 677 | Ga0373954_0001600 | |||
| 678 | Ga0373954_0047125 | |||
| 679 | Ga0373956_0003515 | |||
| 680 | Ga0373957_0000360 | |||
| 681 | Ga0373957_0013441 | |||
| 682 | Ga0373943_0027078 | |||
| 683 | Ga0373946_0097762 | |||
| 684 | Ga0373955_0001691 | |||
| 685 | Ga0373955_0003150 | |||
| 686 | Ga0373955_0027468 | |||
| 687 | Ga0373942_0002609 | |||
| 688 | Ga0373962_0011030 | |||
| 689 | Ga0316574_0003343 | |||
| 690 | Ga0316574_0024538 | |||
| 691 | Ga0316574_0026177 | |||
| 692 | Ga0373924_0000135 | |||
| 693 | Ga0373924_0045887 | |||
| 694 | Ga0373931_0059903 | |||
| 695 | Ga0373935_0043976 | |||
| 696 | Ga0373933_0000003 | |||
| 697 | Ga0373933_0012320 | |||
| 698 | Ga0373933_0055783 | |||
| 699 | Ga0373947_0019135 | |||
| 700 | Ga0373947_0042665 | |||
| 701 | Ga0373937_0000016 | |||
| 702 | Ga0373937_0009055 | |||
| 703 | Ga0373937_0009428 | |||
| 704 | Ga0373937_0016613 | |||
| 705 | Ga0373937_0109247 | |||
| 706 | Ga0373937_0136967 | |||
| 707 | Ga0373937_0171231 | |||
| 708 | Ga0373937_0190388 | |||
| 709 | Ga0373937_0216730 | |||
| 710 | Ga0373937_0264958 | |||
| 711 | Ga0316582_0164843 | |||
| 712 | Ga0316584_0034031 | |||
| 713 | Ga0316584_0050796 | |||
| 714 | Ga0316584_0113591 | |||
| 715 | Ga0373925_0000092 | |||
| 716 | Ga0373925_0011131 | |||
| 717 | Ga0373925_0052636 | |||
| 718 | Ga0373925_0097664 | |||
| 719 | Ga0395899_0145981 | |||
| 720 | Ga0395900_0011765 | |||
| 721 | Ga0395905_0047503 | |||
| 722 | Ga0316581_0002876 | |||
| 723 | Ga0395901_0040568 | |||
| 724 | Ga0400484_12813 | |||
| 725 | Ga0436360_1253763 | |||
| 726 | Ga0436362_0998725 | |||
| 727 | Ga0439460_0009866 | |||
| 728 | Ga0495592_0000116 | |||
| 729 | Ga0495592_0005402 | |||
| 730 | Ga0495592_0064503 | |||
| 731 | Ga0495603_0025517 | |||
| 732 | Ga0495603_0169852 | |||
| 733 | Ga0495629_0004527 | |||
| 734 | Ga0495629_0010423 | |||
| 735 | Ga0495641_0056073 | |||
| 736 | Ga0495651_0000009 | |||
| 737 | Ga0495651_0000890 | |||
| 738 | Ga0495651_0002816 | |||
| 739 | Ga0495651_0012572 | |||
| 740 | Ga0495651_0015502 | |||
| 741 | Ga0495651_0098366 | |||
| 742 | Ga0495653_0001057 | |||
| 743 | Ga0495653_0007538 | |||
| 744 | Ga0495653_0017241 | |||
| 745 | Ga0495653_0018111 | |||
| 746 | Ga0495653_0036693 | |||
| 747 | Ga0495653_0043494 | |||
| 748 | Ga0495653_0059423 | |||
| 749 | Ga0495580_0063691 | |||
| 750 | Ga0495582_0000274 | |||
| 751 | Ga0495582_0024120 | |||
| 752 | Ga0495662_0096701 | |||
| 753 | Ga0495662_0114509 | |||
| 754 | Ga0495664_0010396 | |||
| 755 | Ga0495664_0051157 | |||
| 756 | Ga0495664_0052108 | |||
| 757 | Ga0495596_0030441 | |||
| 758 | Ga0495608_0000019 | |||
| 759 | Ga0495608_0002026 | |||
| 760 | Ga0495608_0003841 | |||
| 761 | Ga0495608_0006234 | |||
| 762 | Ga0495608_0014472 | |||
| 763 | Ga0495608_0015594 | |||
| 764 | Ga0495618_0002062 | |||
| 765 | Ga0495618_0006813 | |||
| 766 | Ga0495618_0019296 | |||
| 767 | Ga0495618_0111900 | |||
| 768 | Ga0495618_0162792 | |||
| 769 | Ga0495628_0000487 | |||
| 770 | Ga0495628_0004867 | |||
| 771 | Ga0495628_0092279 | |||
| 772 | Ga0495628_0112557 | |||
| 773 | Ga0495630_0019494 | |||
| 774 | Ga0495630_0027032 | |||
| 775 | Ga0495630_0031052 | |||
| 776 | Ga0495630_0098274 | |||
| 777 | Ga0495630_0182451 | |||
| 778 | Ga0495630_0230946 | |||
| 779 | Ga0495666_0048523 | |||
| 780 | Ga0495652_0000430 | |||
| 781 | Ga0495652_0003930 | |||
| 782 | Ga0495652_0006794 | |||
| 783 | Ga0495652_0016406 | |||
| 784 | Ga0495652_0020501 | |||
| 785 | Ga0495652_0046662 | |||
| 786 | Ga0495652_0072540 | |||
| 787 | Ga0495665_0028617 | |||
| 788 | Ga0495665_0029076 | |||
| 789 | Ga0495640_0011976 | |||
| 790 | Ga0495640_0021568 | |||
| 791 | Ga0495640_0035659 | |||
| 792 | Ga0495587_0000041 | |||
| 793 | Ga0495587_0004049 | |||
| 794 | Ga0495587_0019408 | |||
| 795 | Ga0495587_0021307 | |||
| 796 | Ga0495587_0054069 | |||
| 797 | Ga0495645_0004438 | |||
| 798 | Ga0495645_0013960 | |||
| 799 | Ga0495667_0000037 | |||
| 800 | Ga0495667_0000993 | |||
| 801 | Ga0495667_0002979 | |||
| 802 | Ga0495667_0003692 | |||
| 803 | Ga0495667_0008426 | |||
| 804 | Ga0495667_0015271 | |||
| 805 | Ga0495667_0138371 | |||
| 806 | Ga0495634_0040696 | |||
| 807 | Ga0495634_0044327 | |||
| 808 | Ga0495634_0092558 | |||
| 809 | Ga0495635_0002890 | |||
| 810 | Ga0495635_0009369 | |||
| 811 | Ga0495635_0009406 | |||
| 812 | Ga0495635_0024810 | |||
| 813 | Ga0495635_0029937 | |||
| 814 | Ga0495635_0030047 | |||
| 815 | Ga0495635_0115337 | |||
| 816 | Ga0495657_0000094 | |||
| 817 | Ga0495657_0004273 | |||
| 818 | Ga0495657_0004926 | |||
| 819 | Ga0495657_0007323 | |||
| 820 | Ga0495657_0011112 | |||
| 821 | Ga0495657_0055406 | |||
| 822 | Ga0495657_0058499 | |||
| 823 | Ga0495657_0058658 | |||
| 824 | Ga0495599_0000040 | |||
| 825 | Ga0495599_0000979 | |||
| 826 | Ga0495599_0001250 | |||
| 827 | Ga0495599_0001497 | |||
| 828 | Ga0495599_0029551 | |||
| 829 | Ga0495599_0046256 | |||
| 830 | Ga0495599_0151135 | |||
| 831 | Ga0495623_0000284 | |||
| 832 | Ga0495623_0051926 | |||
| 833 | Ga0495646_0001358 | |||
| 834 | Ga0495646_0040640 | |||
| 835 | Ga0495647_0071241 | |||
| 836 | Ga0495658_0000235 | |||
| 837 | Ga0495658_0023591 | |||
| 838 | Ga0495669_0013107 | |||
| 839 | Ga0495613_0001970 | |||
| 840 | Ga0495613_0012039 | |||
| 841 | Ga0495613_0034843 | |||
| 842 | Ga0495613_0106589 | |||
| 843 | Ga0495624_0048096 | |||
| 844 | Ga0495624_0079796 | |||
| 845 | Ga0495624_0085431 | |||
| 846 | Ga0495600_0000803 | |||
| 847 | Ga0495600_0004587 | |||
| 848 | Ga0495600_0012450 | |||
| 849 | Ga0495600_0015250 | |||
| 850 | Ga0495600_0086011 | |||
| 851 | Ga0495600_0102483 | |||
| 852 | Ga0495581_0000177 | |||
| 853 | Ga0495581_0026266 | |||
| 854 | Ga0495581_0032151 | |||
| 855 | Ga0495581_0053923 | |||
| 856 | Ga0495604_0000040 | |||
| 857 | Ga0495604_0003280 | |||
| 858 | Ga0495604_0014989 | |||
| 859 | Ga0495604_0039104 | |||
| 860 | Ga0495604_0039680 | |||
| 861 | Ga0495604_0040029 | |||
| 862 | Ga0495604_0043481 | |||
| 863 | Ga0495674_0013237 | |||
| 864 | Ga0495674_0018410 | |||
| 865 | Ga0495674_0021418 | |||
| 866 | Ga0495674_0022037 | |||
| 867 | Ga0495674_0023240 | |||
| 868 | Ga0495674_0026457 | |||
| 869 | Ga0495674_0030814 | |||
| 870 | Ga0495674_0047244 | |||
| 871 | Ga0495674_0052099 | |||
| 872 | Ga0495674_0111648 | |||
| 873 | Ga0495674_0188342 | |||
| 874 | Ga0495674_0239701 | |||
| 875 | Ga0495676_0008424 | |||
| 876 | Ga0495676_0115262 | |||
| 877 | Ga0495680_0000010 | |||
| 878 | Ga0495680_0002042 | |||
| 879 | Ga0495680_0002219 | |||
| 880 | Ga0495680_0007108 | |||
| 881 | Ga0495680_0016453 | |||
| 882 | Ga0495680_0017952 | |||
| 883 | Ga0495680_0027104 | |||
| 884 | Ga0495680_0032504 | |||
| 885 | Ga0495680_0036863 | |||
| 886 | Ga0495680_0199534 | |||
| 887 | Ga0495675_0000111 | |||
| 888 | Ga0495675_0066070 | |||
| 889 | Ga0495675_0070468 | |||
| 890 | Ga0495684_0001499 | |||
| 891 | Ga0495684_0002514 | |||
| 892 | Ga0495684_0019483 | |||
| 893 | Ga0495684_0031348 | |||
| 894 | Ga0495684_0040755 | |||
| 895 | Ga0495684_0041313 | |||
| 896 | Ga0495684_0082569 | |||
| 897 | Ga0495602_0000130 | |||
| 898 | Ga0495602_0007030 | |||
| 899 | Ga0495602_0016477 | |||
| 900 | Ga0495602_0017950 | |||
| 901 | Ga0495602_0026666 | |||
| 902 | Ga0495602_0073410 | |||
| 903 | Ga0495602_0080049 | |||
| 904 | Ga0495602_0087568 | |||
| 905 | Ga0496100_0002742 | |||
| 906 | Ga0496100_0003392 | |||
| 907 | Ga0496101_0008369 | |||
| 908 | Ga0496101_0010501 | |||
| 909 | Ga0496101_0040662 | |||
| 910 | Ga0496102_0008009 | |||
| 911 | Ga0496102_0106574 | |||
| 912 | Ga0496102_0362332 | |||
| 913 | Ga0496102_0410764 | |||
| 914 | Ga0496103_0007384 | |||
| 915 | Ga0496103_0012836 | |||
| 916 | Ga0496104_0008130 | |||
| 917 | Ga0496104_0016191 | |||
| 918 | Ga0496104_0078975 | |||
| 919 | Ga0496104_0094163 | |||
| 920 | Ga0496104_0142323 | |||
| 921 | Ga0496104_0189860 | |||
| 922 | Ga0496105_0001125 | |||
| 923 | Ga0496105_0020893 | |||
| 924 | Ga0496105_0021259 | |||
| 925 | Ga0496105_0119005 | |||
| 926 | Ga0496105_0192252 | |||
| 927 | Ga0496106_0006141 | |||
| 928 | Ga0496106_0016373 | |||
| 929 | Ga0496106_0034939 | |||
| 930 | Ga0496106_0040381 | |||
| 931 | Ga0496106_0054610 | |||
| 932 | Ga0496106_0092027 | |||
| 933 | Ga0496106_0175347 | |||
| 934 | Ga0496107_0003351 | |||
| 935 | Ga0496107_0009677 | |||
| 936 | Ga0496107_0032019 | |||
| 937 | Ga0496108_0018577 | |||
| 938 | Ga0496108_0019058 | |||
| 939 | Ga0496108_0034349 | |||
| 940 | Ga0496109_0001161 | |||
| 941 | Ga0496109_0005924 | |||
| 942 | Ga0496109_0018725 | |||
| 943 | Ga0496109_0198334 | |||
| 944 | Ga0496109_0270432 | |||
| 945 | Ga0496109_0311252 | |||
| 946 | Ga0496110_0040537 | |||
| 947 | Ga0496110_0043298 | |||
| 948 | Ga0496110_0111058 | |||
| 949 | Ga0496111_0186007 | |||
| 950 | Ga0496112_0019538 | |||
| 951 | Ga0496113_0059614 | |||
| 952 | Ga0496114_0007239 | |||
| 953 | Ga0496114_0028725 | |||
| 954 | Ga0496114_0067009 | |||
| 955 | Ga0496114_0109442 | |||
| 956 | Ga0496115_0000591 | |||
| 957 | Ga0496115_0098717 | |||
| 958 | Ga0501034_0106134 | |||
| 959 | Ga0501036_0227905 | |||
| 960 | Ga0501037_0016310 | |||
| 961 | Ga0501038_0036802 | |||
| 962 | Ga0501042_0011310 | |||
| 963 | Ga0501042_0019923 | |||
| 964 | Ga0501043_0041469 | |||
| 965 | Ga0501046_0149601 | |||
| 966 | Ga0501047_0003527 | |||
| 967 | Ga0501048_0021442 | |||
| 968 | Ga0501067_0000274 | |||
| 969 | Ga0501068_0000008 | |||
| 970 | Ga0501068_0016639 | |||
| 971 | Ga0501069_0001093 | |||
| 972 | Ga0501069_0043004 | |||
| 973 | Ga0501072_0000004 | |||
| 974 | Ga0501073_0018351 | |||
| 975 | Ga0501074_0000205 | |||
| 976 | Ga0501074_0020749 | |||
| 977 | Ga0501076_0003225 | |||
| 978 | Ga0501076_0039696 | |||
| 979 | Ga0501076_0103340 | |||
| 980 | Ga0501077_0053474 | |||
| 981 | Ga0501077_0071928 | |||
| 982 | Ga0501079_0011326 | |||
| 983 | Ga0501080_0000952 | |||
| 984 | Ga0501081_0005308 | |||
| 985 | Ga0501083_0019132 | |||
| 986 | Ga0501083_0022737 | |||
| 987 | Ga0501035_0029798 | |||
| 988 | Ga0501045_0060681 | |||
| 989 | nmdc:mga05p37_61842_c1 | |||
| 990 | nmdc:mga05p37_93139_c1 | |||
| 991 | nmdc:mga08y16_25441_c1 | |||
| 992 | nmdc:mga0n895_36020_c1 | |||
| 993 | nmdc:mga0a205_25731_c1 | |||
| 994 | nmdc:mga0a205_30139_c1 | |||
| 995 | Ga0495601_0007082 | |||
| 996 | Ga0495601_0081914 | |||
| 997 | Ga0495601_0106871 | |||
| 998 | Ga0495601_0124046 | |||
| 999 | Ga0495595_0001990 | |||
| 1000 | Ga0495595_0003683 | |||
| 1001 | Ga0495595_0025865 | |||
| 1002 | Ga0495619_0006826 | |||
| 1003 | Ga0495619_0026633 | |||
| 1004 | Ga0495619_0062316 | |||
| 1005 | Ga0495619_0074135 | |||
| 1006 | Ga0495619_0096109 | |||
| 1007 | Ga0495619_0156090 | |||
| 1008 | Ga0501084_0001872 | |||
| 1009 | Ga0501084_0051885 | |||
| 1010 | Ga0501082_0000113 | |||
| 1011 | Ga0530510_0044604 | |||
| 1012 | 2819668375 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4k39-assembly2.cif.gz_B | native ansmecpe with bound adomet and cp18cys peptide | 0.9071 | 15 | 405 |
| 4k39-assembly1.cif.gz_A | native ansmecpe with bound adomet and cp18cys peptide | 0.9064 | 18 | 405 |
| 4k38-assembly2.cif.gz_B | native ansmecpe with bound adomet and kp18cys peptide | 0.9038 | 18 | 405 |
| 4k39-assembly2.cif.gz_B | native ansmecpe with bound adomet and cp18cys peptide | 0.8998 | 15 | 405 |
| 4k36-assembly2.cif.gz_B | his6 tagged ansmecpe with bound adomet | 0.8936 | 15 | 405 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25550_8_393_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9309 | 16 | 407 | 3.20.20.70 |
| af_P76134_1_367_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9304 | 18 | 407 | 3.20.20.70 |
| af_P25550_8_393_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9238 | 16 | 407 | 3.20.20.70 |
| af_P76134_1_367_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.923 | 18 | 407 | 3.20.20.70 |
| 4k37B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8839 | 18 | 405 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M0L5B6-F1-model_v4 | Anaerobic sulfatase maturase | 0.9812 | 51 | 419 |
GO:0016491
GO:0046872 GO:0051539 |
| AF-A0A0B8QBA9-F1-model_v4 | Putative arylsulfatase regulatory protein | 0.981 | 87 | 214 |
GO:0016491
GO:0046872 GO:0051536 |
| AF-A0A6I3IGF6-F1-model_v4 | Anaerobic sulfatase maturase | 0.9805 | 14 | 422 |
GO:0016491
GO:0046872 GO:0051539 |
| AF-A0A6I3H9K1-F1-model_v4 | Anaerobic sulfatase maturase | 0.9798 | 13 | 423 |
GO:0016491
GO:0046872 GO:0051539 |
| AF-X1TAJ7-F1-model_v4 | 4Fe4S-binding SPASM domain-containing protein | 0.978 | 204 | 419 |
GO:0016491
GO:0051539 |