F456485

General Info

Members Datasets Scaffolds Average Seq Length
506 236 1012 448

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100236540|Ga0070679_1002365401
Length 484
Sequence MPSVAERGTPRDSMSTVTPTPGSTPRPFHLLAKPTGAVCNLDCAYCFFLSKELLYPGSRFRMADELLETYLRQLIEAHGSEPEIAIAWQGGEPTLMGLDFFRRSVEIANSYLRPGQRAVYTIQTNGTLLDEEWAAFFREHSFLVGISIDGPRELHDAYRVDKGGKGSFDRVIRGLDCLRDGGVEWNVLTTVHAANGDHGRAVYRFLRDECGAQFIQFIPIIERDGGSAPPAEWTSWRDRPLYLQEGTATSERSVTASQYGRFLIDVFEEWVRHDVGEVYVQMFDVTLANWMGEPPGLCVHSETCGSALALEHTGDLYSCDHFVEPTYKLGNIKMTHMLDMISSPQQQRFGLDKRNTLPRFCLECDVRFVCHGGCPKDRFIETPDGEPGLNYLCDGFKAFFHHVAGPMRIMTELLEQGRAPSEIVAWYRAQDAKRGRNDVCTCGSGRKWKHCHGTETIPPMIWPRAGFSSRTRPPSESRGSETGQ

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
114 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.2
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.47
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100236540 3300005530 Bacteria 1785
2 JGI24751J29686_10000364 3300002459 Bacteria 15588
3 Ga0070670_100005638 3300005331 Bacteria 10563
4 Ga0070670_100049054 3300005331 Bacteria 3632
5 Ga0070666_10037103 3300005335 Bacteria 3239
6 Ga0068868_100013366 3300005338 Bacteria 6020
7 Ga0070660_100004332 3300005339 Bacteria 9801
8 Ga0070689_100003696 3300005340 Bacteria 10222
9 Ga0070687_100042305 3300005343 Bacteria 2308
10 Ga0070668_100022624 3300005347 Bacteria 4753
11 Ga0070669_100049766 3300005353 Bacteria 3060
12 Ga0070674_100010699 3300005356 Bacteria 5559
13 Ga0070659_100034762 3300005366 Bacteria 3921
14 Ga0070667_100020322 3300005367 Bacteria 5512
15 Ga0070714_100023937 3300005435 Bacteria 5023
16 Ga0070714_100157962 3300005435 Bacteria 2049
17 Ga0070711_100023574 3300005439 Bacteria 4005
18 Ga0070711_100065001 3300005439 Bacteria 2550
19 Ga0070700_100004534 3300005441 Bacteria 7266
20 Ga0070694_100080771 3300005444 Bacteria 2260
21 Ga0070708_100005227 3300005445 Bacteria 10280
22 Ga0070663_100003467 3300005455 Bacteria 9089
23 Ga0070681_10069437 3300005458 Bacteria 3490
24 Ga0068867_100003101 3300005459 Bacteria 11711
25 Ga0070685_10008098 3300005466 Bacteria 5388
26 Ga0070706_100003826 3300005467 Bacteria 14708
27 Ga0070706_100032132 3300005467 Bacteria 4841
28 Ga0070706_100108676 3300005467 Bacteria 2581
29 Ga0070707_100029782 3300005468 Bacteria 5195
30 Ga0070707_100060001 3300005468 Bacteria 3648
31 Ga0070698_100011063 3300005471 Bacteria 9588
32 Ga0070698_100020809 3300005471 Bacteria 6876
33 Ga0070699_100072459 3300005518 Bacteria 2996
34 Ga0070679_100023802 3300005530 Bacteria 6000
35 Ga0070679_100124569 3300005530 Bacteria 2560
36 Ga0068853_100009301 3300005539 Bacteria 7926
37 Ga0070672_100093302 3300005543 Bacteria 2431
38 Ga0070695_100118716 3300005545 Bacteria 1806
39 Ga0070696_100008409 3300005546 Bacteria 6905
40 Ga0070693_100011536 3300005547 Bacteria 4453
41 Ga0070665_100006556 3300005548 Bacteria 11831
42 Ga0070664_100073299 3300005564 Bacteria 2937
43 Ga0070664_100172357 3300005564 Bacteria 1920
44 Ga0068857_100011547 3300005577 Bacteria 7685
45 Ga0068857_100066707 3300005577 Bacteria 3203
46 Ga0068857_100169493 3300005577 Bacteria 1984
47 Ga0068856_100016953 3300005614 Bacteria 7060
48 Ga0068856_100062892 3300005614 Bacteria 3666
49 Ga0068852_100096231 3300005616 Bacteria 2661
50 Ga0068864_100002916 3300005618 Bacteria 14149
51 Ga0068866_10009250 3300005718 Bacteria 4178
52 Ga0068861_100045145 3300005719 Bacteria 3316
53 Ga0068861_100129676 3300005719 Bacteria 2045
54 Ga0068870_10007806 3300005840 Bacteria 4786
55 Ga0068863_100006716 3300005841 Bacteria 11280
56 Ga0068863_100068543 3300005841 Bacteria 3355
57 Ga0068860_100051931 3300005843 Bacteria 3900
58 Ga0081455_10002831 3300005937 Bacteria 20421
59 Ga0081455_10027661 3300005937 Bacteria 5194
60 Ga0070717_10008143 3300006028 Bacteria 7822
61 Ga0070717_10053718 3300006028 Bacteria 3321
62 Ga0070717_10058624 3300006028 Bacteria 3184
63 Ga0070712_100014065 3300006175 Bacteria 5131
64 Ga0070712_100028719 3300006175 Bacteria 3722
65 Ga0070712_100062023 3300006175 Bacteria 2643
66 Ga0097621_100015662 3300006237 Bacteria 5712
67 Ga0097621_100166818 3300006237 Bacteria 1896
68 Ga0068871_100002894 3300006358 Bacteria 11781
69 Ga0068871_100168184 3300006358 Bacteria 1878
70 Ga0075431_100210410 3300006847 Bacteria 1986
71 Ga0075433_10103798 3300006852 Bacteria 2518
72 Ga0075434_100124004 3300006871 Bacteria 2600
73 Ga0068865_100002653 3300006881 Bacteria 10626
74 Ga0075436_100005921 3300006914 Bacteria 8401
75 Ga0111539_10022227 3300009094 Bacteria 7797
76 Ga0111539_10065777 3300009094 Bacteria 4283
77 Ga0105245_10102118 3300009098 Bacteria 2655
78 Ga0105245_10119171 3300009098 Bacteria 2464
79 Ga0114129_10080778 3300009147 Bacteria 4519
80 Ga0105241_10066948 3300009174 Bacteria 2779
81 Ga0105242_10005638 3300009176 Bacteria 9663
82 Ga0105238_10031025 3300009551 Bacteria 5441
83 Ga0105238_10034622 3300009551 Bacteria 5138
84 Ga0105249_10001299 3300009553 Bacteria 21875
85 Ga0105249_10011422 3300009553 Bacteria 7800
86 Ga0105239_10003000 3300010375 Bacteria 21043
87 Ga0105239_10019317 3300010375 Bacteria 7526
88 Ga0105239_10112522 3300010375 Bacteria 3018
89 Ga0105239_10158771 3300010375 Bacteria 2526
90 Ga0105246_10000631 3300011119 Bacteria 19645
91 Ga0105246_10049441 3300011119 Bacteria 2880
92 Ga0157374_10016268 3300013296 Bacteria 6536
93 Ga0157374_10100719 3300013296 Bacteria 2769
94 Ga0163162_10007913 3300013306 Bacteria 10360
95 Ga0163162_10029741 3300013306 Bacteria 5407
96 Ga0157372_10033187 3300013307 Bacteria 5668
97 Ga0157372_10096340 3300013307 Bacteria 3372
98 Ga0163163_10007633 3300014325 Bacteria 9553
99 Ga0157380_10010051 3300014326 Bacteria 6792
100 Ga0157377_10075031 3300014745 Bacteria 1963
101 Ga0157376_10011956 3300014969 Bacteria 6420
102 Ga0163161_10127250 3300017792 Bacteria 1919
103 Ga0207692_10001200 3300025898 Bacteria 9613
104 Ga0207642_10004739 3300025899 Bacteria 4391
105 Ga0207643_10007440 3300025908 Bacteria 5876
106 Ga0207684_10000574 3300025910 Bacteria 44726
107 Ga0207684_10085667 3300025910 Bacteria 2683
108 Ga0207693_10000838 3300025915 Bacteria 27394
109 Ga0207693_10001310 3300025915 Bacteria 22068
110 Ga0207693_10005354 3300025915 Bacteria 10723
111 Ga0207693_10032508 3300025915 Bacteria 4117
112 Ga0207693_10075471 3300025915 Bacteria 2640
113 Ga0207663_10005861 3300025916 Bacteria 6231
114 Ga0207663_10139109 3300025916 Bacteria 1689
115 Ga0207662_10034213 3300025918 Bacteria 2965
116 Ga0207657_10005294 3300025919 Bacteria 13516
117 Ga0207652_10022216 3300025921 Bacteria 5244
118 Ga0207652_10049071 3300025921 Bacteria 3611
119 Ga0207646_10206638 3300025922 Bacteria 1773
120 Ga0207650_10000584 3300025925 Bacteria 29312
121 Ga0207687_10005957 3300025927 Bacteria 8065
122 Ga0207687_10016123 3300025927 Bacteria 4905
123 Ga0207664_10003430 3300025929 Bacteria 10567
124 Ga0207664_10266684 3300025929 Bacteria 1499
125 Ga0207644_10008068 3300025931 Bacteria 6890
126 Ga0207644_10012108 3300025931 Bacteria 5722
127 Ga0207686_10150567 3300025934 Bacteria 1619
128 Ga0207704_10002075 3300025938 Bacteria 8972
129 Ga0207665_10003181 3300025939 Bacteria 10994
130 Ga0207691_10012873 3300025940 Bacteria 8008
131 Ga0207712_10008962 3300025961 Bacteria 6327
132 Ga0207712_10009630 3300025961 Bacteria 6120
133 Ga0207712_10050917 3300025961 Bacteria 2894
134 Ga0207668_10009922 3300025972 Bacteria 5725
135 Ga0207668_10019694 3300025972 Bacteria 4271
136 Ga0207677_10020568 3300026023 Bacteria 4010
137 Ga0207639_10026471 3300026041 Bacteria 4215
138 Ga0207708_10002999 3300026075 Bacteria 12436
139 Ga0207702_10008917 3300026078 Bacteria 8456
140 Ga0207641_10000605 3300026088 Bacteria 39451
141 Ga0207641_10053352 3300026088 Bacteria 3427
142 Ga0207648_10003424 3300026089 Bacteria 16646
143 Ga0207676_10000835 3300026095 Bacteria 23994
144 Ga0207674_10016400 3300026116 Bacteria 8110
145 Ga0207674_10075917 3300026116 Bacteria 3370
146 Ga0207674_10175136 3300026116 Bacteria 2098
147 Ga0207675_100002157 3300026118 Bacteria 19547
148 Ga0207683_10010846 3300026121 Bacteria 7772
149 Ga0268266_10029385 3300028379 Bacteria 4673
150 Ga0268264_10037886 3300028381 Bacteria 3977
151 Ga0265338_10008682 3300028800 Bacteria 12293
152 Ga0265760_10017369 3300031090 Bacteria 2066
153 Ga0265327_10003153 3300031251 Bacteria 16178
154 Ga0316579_10002295 3300031691 Bacteria 7216
155 Ga0316576_10055700 3300031727 Bacteria 2886
156 Ga0316578_10029120 3300031728 Bacteria 3132
157 Ga0316577_10000051 3300031733 Bacteria 27441
158 Ga0316577_10006523 3300031733 Bacteria 6167
159 Ga0307409_100038798 3300031995 Bacteria 3526
160 Ga0307409_100133242 3300031995 Bacteria 2127
161 Ga0307416_100058644 3300032002 Bacteria 3123
162 Ga0307411_10024824 3300032005 Bacteria 3580
163 Ga0307415_100089871 3300032126 Bacteria 2220
164 Ga0316583_10012157 3300032133 Bacteria 3106
165 Ga0373928_0007609 3300035084 Bacteria 2092
166 Ga0373934_0000003 3300035086 Bacteria 87823
167 Ga0373934_0000828 3300035086 Bacteria 11173
168 Ga0373949_0007397 3300035090 Bacteria 2404
169 Ga0373953_0000347 3300035117 Bacteria 12507
170 Ga0373954_0000186 3300035118 Bacteria 22463
171 Ga0373954_0001600 3300035118 Bacteria 9236
172 Ga0373954_0047125 3300035118 Bacteria 2016
173 Ga0373956_0003515 3300035119 Bacteria 6307
174 Ga0373957_0000360 3300035120 Bacteria 11609
175 Ga0373957_0013441 3300035120 Bacteria 2777
176 Ga0373943_0027078 3300035170 Bacteria 2691
177 Ga0373946_0097762 3300035171 Bacteria 1311
178 Ga0373955_0001691 3300035172 Bacteria 9435
179 Ga0373955_0003150 3300035172 Bacteria 7215
180 Ga0373955_0027468 3300035172 Bacteria 2943
181 Ga0373942_0002609 3300035207 Bacteria 4342
182 Ga0373962_0011030 3300035242 Bacteria 2260
183 Ga0316574_0003343 3300035398 Bacteria 8257
184 Ga0316574_0024538 3300035398 Bacteria 3610
185 Ga0316574_0026177 3300035398 Bacteria 3507
186 Ga0373924_0000135 3300035410 Bacteria 21359
187 Ga0373924_0045887 3300035410 Bacteria 1798
188 Ga0373931_0059903 3300035691 Bacteria 2048
189 Ga0373935_0043976 3300035692 Bacteria 2813
190 Ga0373933_0000003 3300035724 Bacteria 150420
191 Ga0373933_0012320 3300035724 Bacteria 4723
192 Ga0373933_0055783 3300035724 Bacteria 2371
193 Ga0373947_0019135 3300035725 Bacteria 3947
194 Ga0373947_0042665 3300035725 Bacteria 2708
195 Ga0373937_0000016 3300036401 Bacteria 145523
196 Ga0373937_0009055 3300036401 Bacteria 8640
197 Ga0373937_0009428 3300036401 Bacteria 8486
198 Ga0373937_0016613 3300036401 Bacteria 6539
199 Ga0373937_0109247 3300036401 Bacteria 2572
200 Ga0373937_0136967 3300036401 Bacteria 2289
201 Ga0373937_0171231 3300036401 Bacteria 2037
202 Ga0373937_0190388 3300036401 Bacteria 1928
203 Ga0373937_0216730 3300036401 Bacteria 1801
204 Ga0373937_0264958 3300036401 Bacteria 1621
205 Ga0316582_0164843 3300036647 Bacteria 1502
206 Ga0316584_0034031 3300036712 Bacteria 3776
207 Ga0316584_0050796 3300036712 Bacteria 3100
208 Ga0316584_0113591 3300036712 Bacteria 2026
209 Ga0373925_0000092 3300037068 Bacteria 95847
210 Ga0373925_0011131 3300037068 Bacteria 6524
211 Ga0373925_0052636 3300037068 Bacteria 3042
212 Ga0373925_0097664 3300037068 Bacteria 2253
213 Ga0395899_0145981 3300037312 Bacteria 1680
214 Ga0395900_0011765 3300037418 Bacteria 8948
215 Ga0395905_0047503 3300037471 Bacteria 4023
216 Ga0316581_0002876 3300037588 Bacteria 4213
217 Ga0395901_0040568 3300038443 Bacteria 4822
218 Ga0400484_12813 3300038725 Bacteria 1996
219 Ga0436360_1253763 3300039438 Bacteria 8422
220 Ga0436362_0998725 3300039453 Bacteria 3084
221 Ga0439460_0009866 3300042461 Bacteria 2433
222 Ga0495592_0000116 3300046454 Bacteria 70091
223 Ga0495592_0005402 3300046454 Bacteria 9431
224 Ga0495592_0064503 3300046454 Bacteria 2684
225 Ga0495603_0025517 3300046455 Bacteria 3574
226 Ga0495603_0169852 3300046455 Unclassified 1263
227 Ga0495629_0004527 3300046459 Bacteria 10399
228 Ga0495629_0010423 3300046459 Bacteria 6764
229 Ga0495641_0056073 3300046461 Bacteria 1787
230 Ga0495651_0000009 3300046462 Bacteria 150455
231 Ga0495651_0000890 3300046462 Bacteria 23234
232 Ga0495651_0002816 3300046462 Bacteria 13475
233 Ga0495651_0012572 3300046462 Bacteria 6534
234 Ga0495651_0015502 3300046462 Bacteria 5896
235 Ga0495651_0098366 3300046462 Bacteria 2183
236 Ga0495653_0001057 3300046463 Bacteria 21196
237 Ga0495653_0007538 3300046463 Bacteria 8898
238 Ga0495653_0017241 3300046463 Bacteria 5873
239 Ga0495653_0018111 3300046463 Bacteria 5726
240 Ga0495653_0036693 3300046463 Bacteria 3859
241 Ga0495653_0043494 3300046463 Bacteria 3492
242 Ga0495653_0059423 3300046463 Bacteria 2901
243 Ga0495580_0063691 3300046472 Bacteria 2585
244 Ga0495582_0000274 3300046473 Bacteria 28739
245 Ga0495582_0024120 3300046473 Bacteria 3326
246 Ga0495662_0096701 3300046476 Bacteria 1443
247 Ga0495662_0114509 3300046476 Bacteria 1322
248 Ga0495664_0010396 3300046477 Bacteria 5219
249 Ga0495664_0051157 3300046477 Bacteria 2453
250 Ga0495664_0052108 3300046477 Bacteria 2430
251 Ga0495596_0030441 3300046500 Bacteria 2161
252 Ga0495608_0000019 3300046511 Bacteria 180119
253 Ga0495608_0002026 3300046511 Bacteria 14539
254 Ga0495608_0003841 3300046511 Bacteria 10799
255 Ga0495608_0006234 3300046511 Bacteria 8464
256 Ga0495608_0014472 3300046511 Bacteria 5472
257 Ga0495608_0015594 3300046511 Bacteria 5264
258 Ga0495618_0002062 3300046514 Bacteria 13193
259 Ga0495618_0006813 3300046514 Bacteria 6920
260 Ga0495618_0019296 3300046514 Bacteria 4193
261 Ga0495618_0111900 3300046514 Bacteria 1748
262 Ga0495618_0162792 3300046514 Bacteria 1422
263 Ga0495628_0000487 3300046516 Bacteria 36399
264 Ga0495628_0004867 3300046516 Bacteria 11821
265 Ga0495628_0092279 3300046516 Bacteria 2343
266 Ga0495628_0112557 3300046516 Bacteria 2092
267 Ga0495630_0019494 3300046517 Bacteria 4985
268 Ga0495630_0027032 3300046517 Bacteria 4252
269 Ga0495630_0031052 3300046517 Bacteria 3976
270 Ga0495630_0098274 3300046517 Bacteria 2214
271 Ga0495630_0182451 3300046517 Bacteria 1600
272 Ga0495630_0230946 3300046517 Bacteria 1413
273 Ga0495666_0048523 3300046526 Bacteria 2045
274 Ga0495652_0000430 3300046529 Bacteria 49080
275 Ga0495652_0003930 3300046529 Bacteria 14435
276 Ga0495652_0006794 3300046529 Bacteria 10605
277 Ga0495652_0016406 3300046529 Bacteria 6627
278 Ga0495652_0020501 3300046529 Bacteria 5877
279 Ga0495652_0046662 3300046529 Bacteria 3718
280 Ga0495652_0072540 3300046529 Bacteria 2869
281 Ga0495665_0028617 3300046531 Bacteria 2987
282 Ga0495665_0029076 3300046531 Bacteria 2962
283 Ga0495640_0011976 3300046533 Bacteria 6650
284 Ga0495640_0021568 3300046533 Bacteria 4726
285 Ga0495640_0035659 3300046533 Bacteria 3519
286 Ga0495587_0000041 3300046536 Bacteria 110168
287 Ga0495587_0004049 3300046536 Bacteria 9706
288 Ga0495587_0019408 3300046536 Bacteria 4207
289 Ga0495587_0021307 3300046536 Bacteria 3997
290 Ga0495587_0054069 3300046536 Bacteria 2367
291 Ga0495645_0004438 3300046543 Bacteria 9580
292 Ga0495645_0013960 3300046543 Bacteria 5692
293 Ga0495667_0000037 3300046559 Bacteria 133780
294 Ga0495667_0000993 3300046559 Bacteria 18378
295 Ga0495667_0002979 3300046559 Bacteria 11357
296 Ga0495667_0003692 3300046559 Bacteria 10294
297 Ga0495667_0008426 3300046559 Bacteria 6996
298 Ga0495667_0015271 3300046559 Bacteria 5185
299 Ga0495667_0138371 3300046559 Bacteria 1569
300 Ga0495634_0040696 3300046642 Bacteria 3158
301 Ga0495634_0044327 3300046642 Bacteria 3011
302 Ga0495634_0092558 3300046642 Bacteria 1961
303 Ga0495635_0002890 3300046663 Bacteria 11794
304 Ga0495635_0009369 3300046663 Bacteria 6844
305 Ga0495635_0009406 3300046663 Bacteria 6833
306 Ga0495635_0024810 3300046663 Bacteria 4178
307 Ga0495635_0029937 3300046663 Bacteria 3785
308 Ga0495635_0030047 3300046663 Bacteria 3777
309 Ga0495635_0115337 3300046663 Bacteria 1834
310 Ga0495657_0000094 3300046675 Bacteria 78779
311 Ga0495657_0004273 3300046675 Bacteria 11411
312 Ga0495657_0004926 3300046675 Bacteria 10623
313 Ga0495657_0007323 3300046675 Bacteria 8536
314 Ga0495657_0011112 3300046675 Bacteria 6747
315 Ga0495657_0055406 3300046675 Bacteria 2644
316 Ga0495657_0058499 3300046675 Bacteria 2559
317 Ga0495657_0058658 3300046675 Bacteria 2555
318 Ga0495599_0000040 3300046678 Bacteria 97423
319 Ga0495599_0000979 3300046678 Bacteria 15978
320 Ga0495599_0001250 3300046678 Bacteria 14421
321 Ga0495599_0001497 3300046678 Bacteria 13431
322 Ga0495599_0029551 3300046678 Bacteria 3435
323 Ga0495599_0046256 3300046678 Bacteria 2729
324 Ga0495599_0151135 3300046678 Bacteria 1438
325 Ga0495623_0000284 3300046679 Bacteria 32990
326 Ga0495623_0051926 3300046679 Bacteria 2592
327 Ga0495646_0001358 3300046680 Bacteria 14465
328 Ga0495646_0040640 3300046680 Bacteria 2862
329 Ga0495647_0071241 3300046681 Bacteria 1392
330 Ga0495658_0000235 3300046683 Bacteria 31858
331 Ga0495658_0023591 3300046683 Bacteria 3267
332 Ga0495669_0013107 3300046684 Bacteria 3530
333 Ga0495613_0001970 3300046689 Bacteria 15582
334 Ga0495613_0012039 3300046689 Bacteria 6428
335 Ga0495613_0034843 3300046689 Bacteria 3738
336 Ga0495613_0106589 3300046689 Bacteria 2022
337 Ga0495624_0048096 3300046690 Bacteria 2708
338 Ga0495624_0079796 3300046690 Bacteria 2029
339 Ga0495624_0085431 3300046690 Bacteria 1949
340 Ga0495600_0000803 3300046809 Bacteria 16646
341 Ga0495600_0004587 3300046809 Bacteria 8280
342 Ga0495600_0012450 3300046809 Bacteria 5320
343 Ga0495600_0015250 3300046809 Bacteria 4856
344 Ga0495600_0086011 3300046809 Bacteria 2051
345 Ga0495600_0102483 3300046809 Bacteria 1865
346 Ga0495581_0000177 3300047315 Bacteria 29096
347 Ga0495581_0026266 3300047315 Bacteria 3377
348 Ga0495581_0032151 3300047315 Bacteria 3039
349 Ga0495581_0053923 3300047315 Bacteria 2321
350 Ga0495604_0000040 3300047317 Bacteria 120837
351 Ga0495604_0003280 3300047317 Bacteria 12930
352 Ga0495604_0014989 3300047317 Bacteria 6183
353 Ga0495604_0039104 3300047317 Bacteria 3729
354 Ga0495604_0039680 3300047317 Bacteria 3699
355 Ga0495604_0040029 3300047317 Bacteria 3681
356 Ga0495604_0043481 3300047317 Bacteria 3517
357 Ga0495674_0013237 3300047319 Bacteria 7756
358 Ga0495674_0018410 3300047319 Bacteria 6502
359 Ga0495674_0021418 3300047319 Bacteria 5979
360 Ga0495674_0022037 3300047319 Bacteria 5879
361 Ga0495674_0023240 3300047319 Bacteria 5715
362 Ga0495674_0026457 3300047319 Bacteria 5308
363 Ga0495674_0030814 3300047319 Bacteria 4874
364 Ga0495674_0047244 3300047319 Bacteria 3817
365 Ga0495674_0052099 3300047319 Bacteria 3603
366 Ga0495674_0111648 3300047319 Bacteria 2317
367 Ga0495674_0188342 3300047319 Bacteria 1716
368 Ga0495674_0239701 3300047319 Bacteria 1495
369 Ga0495676_0008424 3300047321 Bacteria 9453
370 Ga0495676_0115262 3300047321 Bacteria 1965
371 Ga0495680_0000010 3300047322 Bacteria 142931
372 Ga0495680_0002042 3300047322 Bacteria 21132
373 Ga0495680_0002219 3300047322 Bacteria 20043
374 Ga0495680_0007108 3300047322 Bacteria 10308
375 Ga0495680_0016453 3300047322 Bacteria 6351
376 Ga0495680_0017952 3300047322 Bacteria 6018
377 Ga0495680_0027104 3300047322 Bacteria 4712
378 Ga0495680_0032504 3300047322 Bacteria 4234
379 Ga0495680_0036863 3300047322 Bacteria 3921
380 Ga0495680_0199534 3300047322 Bacteria 1436
381 Ga0495675_0000111 3300047444 Bacteria 58822
382 Ga0495675_0066070 3300047444 Bacteria 2286
383 Ga0495675_0070468 3300047444 Bacteria 2207
384 Ga0495684_0001499 3300047471 Bacteria 18680
385 Ga0495684_0002514 3300047471 Bacteria 14609
386 Ga0495684_0019483 3300047471 Bacteria 5225
387 Ga0495684_0031348 3300047471 Bacteria 4081
388 Ga0495684_0040755 3300047471 Bacteria 3559
389 Ga0495684_0041313 3300047471 Bacteria 3534
390 Ga0495684_0082569 3300047471 Bacteria 2438
391 Ga0495602_0000130 3300048088 Bacteria 71178
392 Ga0495602_0007030 3300048088 Bacteria 11817
393 Ga0495602_0016477 3300048088 Bacteria 7433
394 Ga0495602_0017950 3300048088 Bacteria 7080
395 Ga0495602_0026666 3300048088 Bacteria 5569
396 Ga0495602_0073410 3300048088 Bacteria 2912
397 Ga0495602_0080049 3300048088 Bacteria 2753
398 Ga0495602_0087568 3300048088 Bacteria 2595
399 Ga0496100_0002742 3300048903 Bacteria 9002
400 Ga0496100_0003392 3300048903 Bacteria 8301
401 Ga0496101_0008369 3300048904 Bacteria 6758
402 Ga0496101_0010501 3300048904 Bacteria 6116
403 Ga0496101_0040662 3300048904 Bacteria 3311
404 Ga0496102_0008009 3300048905 Bacteria 9032
405 Ga0496102_0106574 3300048905 Bacteria 2609
406 Ga0496102_0362332 3300048905 Bacteria 1365
407 Ga0496102_0410764 3300048905 Bacteria 1272
408 Ga0496103_0007384 3300048906 Bacteria 6550
409 Ga0496103_0012836 3300048906 Bacteria 4969
410 Ga0496104_0008130 3300048907 Bacteria 9307
411 Ga0496104_0016191 3300048907 Bacteria 6769
412 Ga0496104_0078975 3300048907 Bacteria 3136
413 Ga0496104_0094163 3300048907 Bacteria 2865
414 Ga0496104_0142323 3300048907 Bacteria 2304
415 Ga0496104_0189860 3300048907 Bacteria 1966
416 Ga0496105_0001125 3300048908 Bacteria 18625
417 Ga0496105_0020893 3300048908 Bacteria 5294
418 Ga0496105_0021259 3300048908 Bacteria 5251
419 Ga0496105_0119005 3300048908 Bacteria 2179
420 Ga0496105_0192252 3300048908 Bacteria 1668
421 Ga0496106_0006141 3300048909 Bacteria 8885
422 Ga0496106_0016373 3300048909 Bacteria 5486
423 Ga0496106_0034939 3300048909 Bacteria 3757
424 Ga0496106_0040381 3300048909 Bacteria 3494
425 Ga0496106_0054610 3300048909 Bacteria 3018
426 Ga0496106_0092027 3300048909 Bacteria 2342
427 Ga0496106_0175347 3300048909 Bacteria 1701
428 Ga0496107_0003351 3300048910 Bacteria 10705
429 Ga0496107_0009677 3300048910 Bacteria 6681
430 Ga0496107_0032019 3300048910 Bacteria 3756
431 Ga0496108_0018577 3300048911 Bacteria 5694
432 Ga0496108_0019058 3300048911 Bacteria 5629
433 Ga0496108_0034349 3300048911 Bacteria 4214
434 Ga0496109_0001161 3300048912 Bacteria 21914
435 Ga0496109_0005924 3300048912 Bacteria 10257
436 Ga0496109_0018725 3300048912 Bacteria 6088
437 Ga0496109_0198334 3300048912 Bacteria 1887
438 Ga0496109_0270432 3300048912 Bacteria 1601
439 Ga0496109_0311252 3300048912 Bacteria 1486
440 Ga0496110_0040537 3300048913 Bacteria 4058
441 Ga0496110_0043298 3300048913 Bacteria 3931
442 Ga0496110_0111058 3300048913 Bacteria 2464
443 Ga0496111_0186007 3300048914 Bacteria 1544
444 Ga0496112_0019538 3300048915 Bacteria 6396
445 Ga0496113_0059614 3300048916 Bacteria 2876
446 Ga0496114_0007239 3300048917 Bacteria 8765
447 Ga0496114_0028725 3300048917 Bacteria 4566
448 Ga0496114_0067009 3300048917 Bacteria 3011
449 Ga0496114_0109442 3300048917 Bacteria 2366
450 Ga0496115_0000591 3300048918 Bacteria 27782
451 Ga0496115_0098717 3300048918 Bacteria 2392
452 Ga0501034_0106134 3300049571 Bacteria 2802
453 Ga0501036_0227905 3300049572 Bacteria 1564
454 Ga0501037_0016310 3300049573 Bacteria 5467
455 Ga0501038_0036802 3300049574 Bacteria 4294
456 Ga0501042_0011310 3300049578 Bacteria 6017
457 Ga0501042_0019923 3300049578 Bacteria 4664
458 Ga0501043_0041469 3300049579 Bacteria 3616
459 Ga0501046_0149601 3300049580 Bacteria 1762
460 Ga0501047_0003527 3300049581 Bacteria 14764
461 Ga0501048_0021442 3300049582 Bacteria 4730
462 Ga0501067_0000274 3300049583 Bacteria 28121
463 Ga0501068_0000008 3300049584 Bacteria 73707
464 Ga0501068_0016639 3300049584 Bacteria 4240
465 Ga0501069_0001093 3300049585 Bacteria 13067
466 Ga0501069_0043004 3300049585 Bacteria 2500
467 Ga0501072_0000004 3300049588 Bacteria 282897
468 Ga0501073_0018351 3300049589 Bacteria 5056
469 Ga0501074_0000205 3300049590 Bacteria 32327
470 Ga0501074_0020749 3300049590 Bacteria 4772
471 Ga0501076_0003225 3300049592 Bacteria 11403
472 Ga0501076_0039696 3300049592 Bacteria 3696
473 Ga0501076_0103340 3300049592 Bacteria 2298
474 Ga0501077_0053474 3300049593 Bacteria 2563
475 Ga0501077_0071928 3300049593 Bacteria 2192
476 Ga0501079_0011326 3300049741 Bacteria 6803
477 Ga0501080_0000952 3300049742 Bacteria 23698
478 Ga0501081_0005308 3300049743 Bacteria 8308
479 Ga0501083_0019132 3300049744 Bacteria 4769
480 Ga0501083_0022737 3300049744 Bacteria 4350
481 Ga0501035_0029798 3300049822 Bacteria 4977
482 Ga0501045_0060681 3300049824 Bacteria 2772
483 nmdc:mga05p37_61842_c1 3300050507 Bacteria 4609
484 nmdc:mga05p37_93139_c1 3300050507 Bacteria 3713
485 nmdc:mga08y16_25441_c1 3300050511 Bacteria 6242
486 nmdc:mga0n895_36020_c1 3300050512 Bacteria 4776
487 nmdc:mga0a205_25731_c1 3300050515 Bacteria 5608
488 nmdc:mga0a205_30139_c1 3300050515 Bacteria 5194
489 Ga0495601_0007082 3300053077 Bacteria 6570
490 Ga0495601_0081914 3300053077 Bacteria 2071
491 Ga0495601_0106871 3300053077 Bacteria 1810
492 Ga0495601_0124046 3300053077 Bacteria 1679
493 Ga0495595_0001990 3300053084 Bacteria 7951
494 Ga0495595_0003683 3300053084 Bacteria 6095
495 Ga0495595_0025865 3300053084 Bacteria 2604
496 Ga0495619_0006826 3300053085 Bacteria 7215
497 Ga0495619_0026633 3300053085 Bacteria 3721
498 Ga0495619_0062316 3300053085 Bacteria 2482
499 Ga0495619_0074135 3300053085 Bacteria 2282
500 Ga0495619_0096109 3300053085 Bacteria 2011
501 Ga0495619_0156090 3300053085 Bacteria 1575
502 Ga0501084_0001872 3300054114 Bacteria 16764
503 Ga0501084_0051885 3300054114 Bacteria 3432
504 Ga0501082_0000113 3300060353 Bacteria 63799
505 Ga0530510_0044604 3300061734 Bacteria 3204
506 2819668375 2818991458 Bacteria 4794049
507 Ga0070679_100236540
508 JGI24751J29686_10000364
509 Ga0070670_100005638
510 Ga0070670_100049054
511 Ga0070666_10037103
512 Ga0068868_100013366
513 Ga0070660_100004332
514 Ga0070689_100003696
515 Ga0070687_100042305
516 Ga0070668_100022624
517 Ga0070669_100049766
518 Ga0070674_100010699
519 Ga0070659_100034762
520 Ga0070667_100020322
521 Ga0070714_100023937
522 Ga0070714_100157962
523 Ga0070711_100023574
524 Ga0070711_100065001
525 Ga0070700_100004534
526 Ga0070694_100080771
527 Ga0070708_100005227
528 Ga0070663_100003467
529 Ga0070681_10069437
530 Ga0068867_100003101
531 Ga0070685_10008098
532 Ga0070706_100003826
533 Ga0070706_100032132
534 Ga0070706_100108676
535 Ga0070707_100029782
536 Ga0070707_100060001
537 Ga0070698_100011063
538 Ga0070698_100020809
539 Ga0070699_100072459
540 Ga0070679_100023802
541 Ga0070679_100124569
542 Ga0068853_100009301
543 Ga0070672_100093302
544 Ga0070695_100118716
545 Ga0070696_100008409
546 Ga0070693_100011536
547 Ga0070665_100006556
548 Ga0070664_100073299
549 Ga0070664_100172357
550 Ga0068857_100011547
551 Ga0068857_100066707
552 Ga0068857_100169493
553 Ga0068856_100016953
554 Ga0068856_100062892
555 Ga0068852_100096231
556 Ga0068864_100002916
557 Ga0068866_10009250
558 Ga0068861_100045145
559 Ga0068861_100129676
560 Ga0068870_10007806
561 Ga0068863_100006716
562 Ga0068863_100068543
563 Ga0068860_100051931
564 Ga0081455_10002831
565 Ga0081455_10027661
566 Ga0070717_10008143
567 Ga0070717_10053718
568 Ga0070717_10058624
569 Ga0070712_100014065
570 Ga0070712_100028719
571 Ga0070712_100062023
572 Ga0097621_100015662
573 Ga0097621_100166818
574 Ga0068871_100002894
575 Ga0068871_100168184
576 Ga0075431_100210410
577 Ga0075433_10103798
578 Ga0075434_100124004
579 Ga0068865_100002653
580 Ga0075436_100005921
581 Ga0111539_10022227
582 Ga0111539_10065777
583 Ga0105245_10102118
584 Ga0105245_10119171
585 Ga0114129_10080778
586 Ga0105241_10066948
587 Ga0105242_10005638
588 Ga0105238_10031025
589 Ga0105238_10034622
590 Ga0105249_10001299
591 Ga0105249_10011422
592 Ga0105239_10003000
593 Ga0105239_10019317
594 Ga0105239_10112522
595 Ga0105239_10158771
596 Ga0105246_10000631
597 Ga0105246_10049441
598 Ga0157374_10016268
599 Ga0157374_10100719
600 Ga0163162_10007913
601 Ga0163162_10029741
602 Ga0157372_10033187
603 Ga0157372_10096340
604 Ga0163163_10007633
605 Ga0157380_10010051
606 Ga0157377_10075031
607 Ga0157376_10011956
608 Ga0163161_10127250
609 Ga0207692_10001200
610 Ga0207642_10004739
611 Ga0207643_10007440
612 Ga0207684_10000574
613 Ga0207684_10085667
614 Ga0207693_10000838
615 Ga0207693_10001310
616 Ga0207693_10005354
617 Ga0207693_10032508
618 Ga0207693_10075471
619 Ga0207663_10005861
620 Ga0207663_10139109
621 Ga0207662_10034213
622 Ga0207657_10005294
623 Ga0207652_10022216
624 Ga0207652_10049071
625 Ga0207646_10206638
626 Ga0207650_10000584
627 Ga0207687_10005957
628 Ga0207687_10016123
629 Ga0207664_10003430
630 Ga0207664_10266684
631 Ga0207644_10008068
632 Ga0207644_10012108
633 Ga0207686_10150567
634 Ga0207704_10002075
635 Ga0207665_10003181
636 Ga0207691_10012873
637 Ga0207712_10008962
638 Ga0207712_10009630
639 Ga0207712_10050917
640 Ga0207668_10009922
641 Ga0207668_10019694
642 Ga0207677_10020568
643 Ga0207639_10026471
644 Ga0207708_10002999
645 Ga0207702_10008917
646 Ga0207641_10000605
647 Ga0207641_10053352
648 Ga0207648_10003424
649 Ga0207676_10000835
650 Ga0207674_10016400
651 Ga0207674_10075917
652 Ga0207674_10175136
653 Ga0207675_100002157
654 Ga0207683_10010846
655 Ga0268266_10029385
656 Ga0268264_10037886
657 Ga0265338_10008682
658 Ga0265760_10017369
659 Ga0265327_10003153
660 Ga0316579_10002295
661 Ga0316576_10055700
662 Ga0316578_10029120
663 Ga0316577_10000051
664 Ga0316577_10006523
665 Ga0307409_100038798
666 Ga0307409_100133242
667 Ga0307416_100058644
668 Ga0307411_10024824
669 Ga0307415_100089871
670 Ga0316583_10012157
671 Ga0373928_0007609
672 Ga0373934_0000003
673 Ga0373934_0000828
674 Ga0373949_0007397
675 Ga0373953_0000347
676 Ga0373954_0000186
677 Ga0373954_0001600
678 Ga0373954_0047125
679 Ga0373956_0003515
680 Ga0373957_0000360
681 Ga0373957_0013441
682 Ga0373943_0027078
683 Ga0373946_0097762
684 Ga0373955_0001691
685 Ga0373955_0003150
686 Ga0373955_0027468
687 Ga0373942_0002609
688 Ga0373962_0011030
689 Ga0316574_0003343
690 Ga0316574_0024538
691 Ga0316574_0026177
692 Ga0373924_0000135
693 Ga0373924_0045887
694 Ga0373931_0059903
695 Ga0373935_0043976
696 Ga0373933_0000003
697 Ga0373933_0012320
698 Ga0373933_0055783
699 Ga0373947_0019135
700 Ga0373947_0042665
701 Ga0373937_0000016
702 Ga0373937_0009055
703 Ga0373937_0009428
704 Ga0373937_0016613
705 Ga0373937_0109247
706 Ga0373937_0136967
707 Ga0373937_0171231
708 Ga0373937_0190388
709 Ga0373937_0216730
710 Ga0373937_0264958
711 Ga0316582_0164843
712 Ga0316584_0034031
713 Ga0316584_0050796
714 Ga0316584_0113591
715 Ga0373925_0000092
716 Ga0373925_0011131
717 Ga0373925_0052636
718 Ga0373925_0097664
719 Ga0395899_0145981
720 Ga0395900_0011765
721 Ga0395905_0047503
722 Ga0316581_0002876
723 Ga0395901_0040568
724 Ga0400484_12813
725 Ga0436360_1253763
726 Ga0436362_0998725
727 Ga0439460_0009866
728 Ga0495592_0000116
729 Ga0495592_0005402
730 Ga0495592_0064503
731 Ga0495603_0025517
732 Ga0495603_0169852
733 Ga0495629_0004527
734 Ga0495629_0010423
735 Ga0495641_0056073
736 Ga0495651_0000009
737 Ga0495651_0000890
738 Ga0495651_0002816
739 Ga0495651_0012572
740 Ga0495651_0015502
741 Ga0495651_0098366
742 Ga0495653_0001057
743 Ga0495653_0007538
744 Ga0495653_0017241
745 Ga0495653_0018111
746 Ga0495653_0036693
747 Ga0495653_0043494
748 Ga0495653_0059423
749 Ga0495580_0063691
750 Ga0495582_0000274
751 Ga0495582_0024120
752 Ga0495662_0096701
753 Ga0495662_0114509
754 Ga0495664_0010396
755 Ga0495664_0051157
756 Ga0495664_0052108
757 Ga0495596_0030441
758 Ga0495608_0000019
759 Ga0495608_0002026
760 Ga0495608_0003841
761 Ga0495608_0006234
762 Ga0495608_0014472
763 Ga0495608_0015594
764 Ga0495618_0002062
765 Ga0495618_0006813
766 Ga0495618_0019296
767 Ga0495618_0111900
768 Ga0495618_0162792
769 Ga0495628_0000487
770 Ga0495628_0004867
771 Ga0495628_0092279
772 Ga0495628_0112557
773 Ga0495630_0019494
774 Ga0495630_0027032
775 Ga0495630_0031052
776 Ga0495630_0098274
777 Ga0495630_0182451
778 Ga0495630_0230946
779 Ga0495666_0048523
780 Ga0495652_0000430
781 Ga0495652_0003930
782 Ga0495652_0006794
783 Ga0495652_0016406
784 Ga0495652_0020501
785 Ga0495652_0046662
786 Ga0495652_0072540
787 Ga0495665_0028617
788 Ga0495665_0029076
789 Ga0495640_0011976
790 Ga0495640_0021568
791 Ga0495640_0035659
792 Ga0495587_0000041
793 Ga0495587_0004049
794 Ga0495587_0019408
795 Ga0495587_0021307
796 Ga0495587_0054069
797 Ga0495645_0004438
798 Ga0495645_0013960
799 Ga0495667_0000037
800 Ga0495667_0000993
801 Ga0495667_0002979
802 Ga0495667_0003692
803 Ga0495667_0008426
804 Ga0495667_0015271
805 Ga0495667_0138371
806 Ga0495634_0040696
807 Ga0495634_0044327
808 Ga0495634_0092558
809 Ga0495635_0002890
810 Ga0495635_0009369
811 Ga0495635_0009406
812 Ga0495635_0024810
813 Ga0495635_0029937
814 Ga0495635_0030047
815 Ga0495635_0115337
816 Ga0495657_0000094
817 Ga0495657_0004273
818 Ga0495657_0004926
819 Ga0495657_0007323
820 Ga0495657_0011112
821 Ga0495657_0055406
822 Ga0495657_0058499
823 Ga0495657_0058658
824 Ga0495599_0000040
825 Ga0495599_0000979
826 Ga0495599_0001250
827 Ga0495599_0001497
828 Ga0495599_0029551
829 Ga0495599_0046256
830 Ga0495599_0151135
831 Ga0495623_0000284
832 Ga0495623_0051926
833 Ga0495646_0001358
834 Ga0495646_0040640
835 Ga0495647_0071241
836 Ga0495658_0000235
837 Ga0495658_0023591
838 Ga0495669_0013107
839 Ga0495613_0001970
840 Ga0495613_0012039
841 Ga0495613_0034843
842 Ga0495613_0106589
843 Ga0495624_0048096
844 Ga0495624_0079796
845 Ga0495624_0085431
846 Ga0495600_0000803
847 Ga0495600_0004587
848 Ga0495600_0012450
849 Ga0495600_0015250
850 Ga0495600_0086011
851 Ga0495600_0102483
852 Ga0495581_0000177
853 Ga0495581_0026266
854 Ga0495581_0032151
855 Ga0495581_0053923
856 Ga0495604_0000040
857 Ga0495604_0003280
858 Ga0495604_0014989
859 Ga0495604_0039104
860 Ga0495604_0039680
861 Ga0495604_0040029
862 Ga0495604_0043481
863 Ga0495674_0013237
864 Ga0495674_0018410
865 Ga0495674_0021418
866 Ga0495674_0022037
867 Ga0495674_0023240
868 Ga0495674_0026457
869 Ga0495674_0030814
870 Ga0495674_0047244
871 Ga0495674_0052099
872 Ga0495674_0111648
873 Ga0495674_0188342
874 Ga0495674_0239701
875 Ga0495676_0008424
876 Ga0495676_0115262
877 Ga0495680_0000010
878 Ga0495680_0002042
879 Ga0495680_0002219
880 Ga0495680_0007108
881 Ga0495680_0016453
882 Ga0495680_0017952
883 Ga0495680_0027104
884 Ga0495680_0032504
885 Ga0495680_0036863
886 Ga0495680_0199534
887 Ga0495675_0000111
888 Ga0495675_0066070
889 Ga0495675_0070468
890 Ga0495684_0001499
891 Ga0495684_0002514
892 Ga0495684_0019483
893 Ga0495684_0031348
894 Ga0495684_0040755
895 Ga0495684_0041313
896 Ga0495684_0082569
897 Ga0495602_0000130
898 Ga0495602_0007030
899 Ga0495602_0016477
900 Ga0495602_0017950
901 Ga0495602_0026666
902 Ga0495602_0073410
903 Ga0495602_0080049
904 Ga0495602_0087568
905 Ga0496100_0002742
906 Ga0496100_0003392
907 Ga0496101_0008369
908 Ga0496101_0010501
909 Ga0496101_0040662
910 Ga0496102_0008009
911 Ga0496102_0106574
912 Ga0496102_0362332
913 Ga0496102_0410764
914 Ga0496103_0007384
915 Ga0496103_0012836
916 Ga0496104_0008130
917 Ga0496104_0016191
918 Ga0496104_0078975
919 Ga0496104_0094163
920 Ga0496104_0142323
921 Ga0496104_0189860
922 Ga0496105_0001125
923 Ga0496105_0020893
924 Ga0496105_0021259
925 Ga0496105_0119005
926 Ga0496105_0192252
927 Ga0496106_0006141
928 Ga0496106_0016373
929 Ga0496106_0034939
930 Ga0496106_0040381
931 Ga0496106_0054610
932 Ga0496106_0092027
933 Ga0496106_0175347
934 Ga0496107_0003351
935 Ga0496107_0009677
936 Ga0496107_0032019
937 Ga0496108_0018577
938 Ga0496108_0019058
939 Ga0496108_0034349
940 Ga0496109_0001161
941 Ga0496109_0005924
942 Ga0496109_0018725
943 Ga0496109_0198334
944 Ga0496109_0270432
945 Ga0496109_0311252
946 Ga0496110_0040537
947 Ga0496110_0043298
948 Ga0496110_0111058
949 Ga0496111_0186007
950 Ga0496112_0019538
951 Ga0496113_0059614
952 Ga0496114_0007239
953 Ga0496114_0028725
954 Ga0496114_0067009
955 Ga0496114_0109442
956 Ga0496115_0000591
957 Ga0496115_0098717
958 Ga0501034_0106134
959 Ga0501036_0227905
960 Ga0501037_0016310
961 Ga0501038_0036802
962 Ga0501042_0011310
963 Ga0501042_0019923
964 Ga0501043_0041469
965 Ga0501046_0149601
966 Ga0501047_0003527
967 Ga0501048_0021442
968 Ga0501067_0000274
969 Ga0501068_0000008
970 Ga0501068_0016639
971 Ga0501069_0001093
972 Ga0501069_0043004
973 Ga0501072_0000004
974 Ga0501073_0018351
975 Ga0501074_0000205
976 Ga0501074_0020749
977 Ga0501076_0003225
978 Ga0501076_0039696
979 Ga0501076_0103340
980 Ga0501077_0053474
981 Ga0501077_0071928
982 Ga0501079_0011326
983 Ga0501080_0000952
984 Ga0501081_0005308
985 Ga0501083_0019132
986 Ga0501083_0022737
987 Ga0501035_0029798
988 Ga0501045_0060681
989 nmdc:mga05p37_61842_c1
990 nmdc:mga05p37_93139_c1
991 nmdc:mga08y16_25441_c1
992 nmdc:mga0n895_36020_c1
993 nmdc:mga0a205_25731_c1
994 nmdc:mga0a205_30139_c1
995 Ga0495601_0007082
996 Ga0495601_0081914
997 Ga0495601_0106871
998 Ga0495601_0124046
999 Ga0495595_0001990
1000 Ga0495595_0003683
1001 Ga0495595_0025865
1002 Ga0495619_0006826
1003 Ga0495619_0026633
1004 Ga0495619_0062316
1005 Ga0495619_0074135
1006 Ga0495619_0096109
1007 Ga0495619_0156090
1008 Ga0501084_0001872
1009 Ga0501084_0051885
1010 Ga0501082_0000113
1011 Ga0530510_0044604
1012 2819668375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02810

SEC-C

SEC-C motif

436

454

0.98

PF13186

SPASM

Iron-sulfur cluster-binding domain

298

365

0.9

PF04055

Radical_SAM

Radical SAM superfamily

34

206

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k39-assembly2.cif.gz_B native ansmecpe with bound adomet and cp18cys peptide 0.9071 15 405
4k39-assembly1.cif.gz_A native ansmecpe with bound adomet and cp18cys peptide 0.9064 18 405
4k38-assembly2.cif.gz_B native ansmecpe with bound adomet and kp18cys peptide 0.9038 18 405
4k39-assembly2.cif.gz_B native ansmecpe with bound adomet and cp18cys peptide 0.8998 15 405
4k36-assembly2.cif.gz_B his6 tagged ansmecpe with bound adomet 0.8936 15 405
ID Description Score Start End Superfamily
af_P25550_8_393_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9309 16 407 3.20.20.70
af_P76134_1_367_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9304 18 407 3.20.20.70
af_P25550_8_393_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9238 16 407 3.20.20.70
af_P76134_1_367_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.923 18 407 3.20.20.70
4k37B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8839 18 405 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0M0L5B6-F1-model_v4 Anaerobic sulfatase maturase 0.9812 51 419 GO:0016491
GO:0046872
GO:0051539
AF-A0A0B8QBA9-F1-model_v4 Putative arylsulfatase regulatory protein 0.981 87 214 GO:0016491
GO:0046872
GO:0051536
AF-A0A6I3IGF6-F1-model_v4 Anaerobic sulfatase maturase 0.9805 14 422 GO:0016491
GO:0046872
GO:0051539
AF-A0A6I3H9K1-F1-model_v4 Anaerobic sulfatase maturase 0.9798 13 423 GO:0016491
GO:0046872
GO:0051539
AF-X1TAJ7-F1-model_v4 4Fe4S-binding SPASM domain-containing protein 0.978 204 419 GO:0016491
GO:0051539

Map