F456492
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 506 | 286 | 1012 | 479 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100010259|Ga0068859_1000102593 |
| Length | 474 |
| Sequence | MASKPLTLYEKIWAAHVIERRDDGTCLIYIDRHLVHEVTSPQAFAGLRANGRPVRRPDLTLAVPDHNLPTTPRRDAAGNPLPIADPESAEQLSALRKNVADFGVPYIDALAVEQGIVHVVGPEQGFTLPGTTLVCGDSHTSAHGALGALAFGIGTSEVEHVLATQTLQLSPSKTMEIRVEGSLGFGVSPKDVVLAIIGKIGAAGGTGHVIEYTGDVIRNMSIEGRLTVGARAGLVAPDETTYAYLNGRPMAPKGEAWEQAVAWWRTLPSDAGARYDALVRLDATNIAPSLTWGTSPEDVVAITGAVPDPDSFADPAKRQAARKSLDYMGLTPGMRMQDVAIEHVFIGSCTNSRIEDLRAAAAVVKGRHIADRIRQALIVPGSGLVKRQAEAEGLDRIFLEAGFEWREPGCSMCLAMNPDKVPSGERCASTSNRNFVGRQGPGARTHLVSPAMAAAAAITGRLTDVRDLVGESAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 87 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 145 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 146 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 147 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 157 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 158 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 159 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 160 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 161 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 167 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 168 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 169 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 170 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 171 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 199 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 200 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 201 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 202 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 203 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 204 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 205 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 206 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 207 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 208 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 210 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 211 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 212 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 221 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 222 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 223 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 224 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 225 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 227 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 231 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 232 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 233 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 235 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 236 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 237 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 242 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 243 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 244 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 245 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 246 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 247 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 248 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 250 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 251 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 252 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 253 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 254 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 255 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 256 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 258 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 259 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 260 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 261 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 262 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 263 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 264 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 265 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 266 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 267 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 268 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 269 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 270 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 271 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 272 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 273 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 274 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 275 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 276 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 277 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 278 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 279 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 280 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 281 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 282 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 283 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 284 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 285 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 286 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.68 |
| Metatranscriptomes | 0 |
| Isolates | 6.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.4 |
| Nodule | 0 |
| Rhizoplane | 1.38 |
| Rhizosphere | 73.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068859_100010259 | 3300005617 | Bacteria | 9429 |
| 2 | SwRhRL2b_contig_453878 | 2162886007 | Bacteria | 5693 |
| 3 | JGI24736J21556_1000032 | 3300001904 | Bacteria | 24066 |
| 4 | JGI24736J21556_1000613 | 3300001904 | Bacteria | 6542 |
| 5 | JGI24736J21556_1005999 | 3300001904 | Bacteria | 2050 |
| 6 | JGI24741J21665_1000366 | 3300001915 | Bacteria | 13487 |
| 7 | JGI24752J21851_1000082 | 3300001976 | Bacteria | 12689 |
| 8 | JGI24740J21852_10005104 | 3300001979 | Bacteria | 5575 |
| 9 | JGI24740J21852_10005188 | 3300001979 | Bacteria | 5530 |
| 10 | JGI24739J22299_10005319 | 3300001989 | Bacteria | 4903 |
| 11 | JGI24739J22299_10007626 | 3300001989 | Bacteria | 4050 |
| 12 | JGI24737J22298_10001306 | 3300001990 | Bacteria | 8830 |
| 13 | JGI24735J21928_10001114 | 3300002067 | Bacteria | 9626 |
| 14 | JGI24735J21928_10004932 | 3300002067 | Bacteria | 4449 |
| 15 | JGI24748J21848_1000036 | 3300002074 | Bacteria | 72512 |
| 16 | JGI24738J21930_10000231 | 3300002075 | Bacteria | 15154 |
| 17 | JGI24749J21850_1000049 | 3300002076 | Bacteria | 22639 |
| 18 | JGI24034J26672_10000008 | 3300002239 | Bacteria | 200986 |
| 19 | JGI24034J26672_10000038 | 3300002239 | Bacteria | 75372 |
| 20 | JGI24751J29686_10000216 | 3300002459 | Bacteria | 24503 |
| 21 | JGI25150J39212_1001984 | 3300002774 | Bacteria | 5350 |
| 22 | JGI25165J46597_1000041 | 3300003214 | Bacteria | 272566 |
| 23 | JGI25153J46596_10000395 | 3300003215 | Bacteria | 29365 |
| 24 | Ga0055526_1007921 | 3300003771 | Bacteria | 5406 |
| 25 | Ga0055537_1003939 | 3300003773 | Bacteria | 4403 |
| 26 | Ga0055524_1000539 | 3300003775 | Bacteria | 28724 |
| 27 | Ga0055536_1002308 | 3300003781 | Bacteria | 10806 |
| 28 | Ga0055536_1004688 | 3300003781 | Bacteria | 6890 |
| 29 | Ga0055530_10000012 | 3300003791 | Bacteria | 164829 |
| 30 | Ga0055530_10003402 | 3300003791 | Bacteria | 9077 |
| 31 | Ga0055530_10028081 | 3300003791 | Bacteria | 1524 |
| 32 | Ga0055540_1002064 | 3300003792 | Bacteria | 11085 |
| 33 | Ga0055531_10000466 | 3300003794 | Bacteria | 37479 |
| 34 | Ga0055531_10003730 | 3300003794 | Bacteria | 9574 |
| 35 | Ga0055531_10004059 | 3300003794 | Bacteria | 9077 |
| 36 | Ga0055531_10006558 | 3300003794 | Bacteria | 6578 |
| 37 | Ga0065165_1005379 | 3300005262 | Bacteria | 7235 |
| 38 | Ga0065165_1018890 | 3300005262 | Bacteria | 2480 |
| 39 | Ga0065704_10001612 | 3300005289 | Bacteria | 10250 |
| 40 | Ga0065704_10116929 | 3300005289 | Bacteria | 1844 |
| 41 | Ga0065707_10000505 | 3300005295 | Bacteria | 50569 |
| 42 | Ga0065707_10084570 | 3300005295 | Bacteria | 7048 |
| 43 | Ga0070658_10030197 | 3300005327 | Bacteria | 4355 |
| 44 | Ga0070683_100024933 | 3300005329 | Bacteria | 5364 |
| 45 | Ga0070690_100000021 | 3300005330 | Bacteria | 74350 |
| 46 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 47 | Ga0070670_100000021 | 3300005331 | Bacteria | 202776 |
| 48 | Ga0070670_100002377 | 3300005331 | Bacteria | 15504 |
| 49 | Ga0070670_100039241 | 3300005331 | Bacteria | 4072 |
| 50 | Ga0070670_100204945 | 3300005331 | Bacteria | 1714 |
| 51 | Ga0070666_10000004 | 3300005335 | Bacteria | 372098 |
| 52 | Ga0070666_10005044 | 3300005335 | Bacteria | 8076 |
| 53 | Ga0070660_100032343 | 3300005339 | Bacteria | 3935 |
| 54 | Ga0070689_100056210 | 3300005340 | Bacteria | 3051 |
| 55 | Ga0070661_100005915 | 3300005344 | Bacteria | 8422 |
| 56 | Ga0070661_100013974 | 3300005344 | Bacteria | 5645 |
| 57 | Ga0070661_100033172 | 3300005344 | Bacteria | 3739 |
| 58 | Ga0070668_100000026 | 3300005347 | Bacteria | 92584 |
| 59 | Ga0070668_100000047 | 3300005347 | Bacteria | 76386 |
| 60 | Ga0070668_100000925 | 3300005347 | Bacteria | 20475 |
| 61 | Ga0070668_100020174 | 3300005347 | Bacteria | 5026 |
| 62 | Ga0070668_100031691 | 3300005347 | Bacteria | 4022 |
| 63 | Ga0070669_100000020 | 3300005353 | Bacteria | 181297 |
| 64 | Ga0070669_100004471 | 3300005353 | Bacteria | 10073 |
| 65 | Ga0070671_100000470 | 3300005355 | Bacteria | 28105 |
| 66 | Ga0070671_100019303 | 3300005355 | Bacteria | 5546 |
| 67 | Ga0070671_100027553 | 3300005355 | Bacteria | 4677 |
| 68 | Ga0070688_100022724 | 3300005365 | Bacteria | 3680 |
| 69 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 70 | Ga0070667_100000089 | 3300005367 | Bacteria | 113661 |
| 71 | Ga0070667_100000642 | 3300005367 | Bacteria | 33958 |
| 72 | Ga0070667_100179297 | 3300005367 | Bacteria | 1873 |
| 73 | Ga0070663_100002941 | 3300005455 | Bacteria | 9696 |
| 74 | Ga0070663_100013110 | 3300005455 | Bacteria | 5269 |
| 75 | Ga0070662_100003611 | 3300005457 | Bacteria | 9656 |
| 76 | Ga0070685_10000724 | 3300005466 | Bacteria | 17961 |
| 77 | Ga0070679_100004736 | 3300005530 | Bacteria | 12550 |
| 78 | Ga0070679_100007172 | 3300005530 | Bacteria | 10407 |
| 79 | Ga0068853_100074332 | 3300005539 | Bacteria | 2965 |
| 80 | Ga0070686_100000012 | 3300005544 | Bacteria | 176038 |
| 81 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 82 | Ga0070665_100000075 | 3300005548 | Bacteria | 189496 |
| 83 | Ga0070665_100000323 | 3300005548 | Bacteria | 73605 |
| 84 | Ga0068855_100038577 | 3300005563 | Bacteria | 5675 |
| 85 | Ga0070664_100030216 | 3300005564 | Bacteria | 4520 |
| 86 | Ga0068857_100021366 | 3300005577 | Bacteria | 5697 |
| 87 | Ga0068857_100052891 | 3300005577 | Bacteria | 3602 |
| 88 | Ga0068857_100059311 | 3300005577 | Bacteria | 3399 |
| 89 | Ga0068857_100160717 | 3300005577 | Bacteria | 2038 |
| 90 | Ga0068854_100007481 | 3300005578 | Bacteria | 6978 |
| 91 | Ga0068854_100068110 | 3300005578 | Bacteria | 2595 |
| 92 | Ga0068854_100069920 | 3300005578 | Bacteria | 2564 |
| 93 | Ga0068856_100019563 | 3300005614 | Bacteria | 6573 |
| 94 | Ga0068856_100020542 | 3300005614 | Bacteria | 6414 |
| 95 | Ga0068852_100002009 | 3300005616 | Bacteria | 13859 |
| 96 | Ga0068859_100003505 | 3300005617 | Bacteria | 15985 |
| 97 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 98 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 99 | Ga0068861_100000001 | 3300005719 | Bacteria | 116118 |
| 100 | Ga0068861_100014274 | 3300005719 | Bacteria | 5574 |
| 101 | Ga0068861_100020681 | 3300005719 | Bacteria | 4718 |
| 102 | Ga0068851_10040267 | 3300005834 | Bacteria | 2348 |
| 103 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 104 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 105 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 106 | Ga0068863_100000093 | 3300005841 | Bacteria | 96862 |
| 107 | Ga0068863_100002259 | 3300005841 | Bacteria | 19135 |
| 108 | Ga0068863_100080823 | 3300005841 | Bacteria | 3079 |
| 109 | Ga0068858_100025268 | 3300005842 | Bacteria | 5527 |
| 110 | Ga0068860_100000009 | 3300005843 | Bacteria | 372089 |
| 111 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 112 | Ga0068860_100000148 | 3300005843 | Bacteria | 113661 |
| 113 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 114 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 115 | Ga0068862_100000209 | 3300005844 | Bacteria | 65440 |
| 116 | Ga0068862_100086776 | 3300005844 | Bacteria | 2721 |
| 117 | Ga0081455_10000255 | 3300005937 | Bacteria | 69927 |
| 118 | Ga0075368_10003525 | 3300006042 | Bacteria | 5239 |
| 119 | Ga0075363_100005439 | 3300006048 | Bacteria | 5665 |
| 120 | Ga0075367_10000099 | 3300006178 | Bacteria | 24259 |
| 121 | Ga0068871_100130490 | 3300006358 | Bacteria | 2131 |
| 122 | Ga0097620_100003505 | 3300006931 | Bacteria | 15985 |
| 123 | Ga0097620_100010259 | 3300006931 | Bacteria | 9429 |
| 124 | Ga0105251_10001284 | 3300009011 | Bacteria | 21706 |
| 125 | Ga0105240_10000959 | 3300009093 | Bacteria | 51453 |
| 126 | Ga0105240_10005945 | 3300009093 | Bacteria | 18059 |
| 127 | Ga0105240_10239896 | 3300009093 | Bacteria | 2102 |
| 128 | Ga0105240_10270667 | 3300009093 | Bacteria | 1956 |
| 129 | Ga0105247_10008068 | 3300009101 | Bacteria | 6434 |
| 130 | Ga0114129_10336874 | 3300009147 | Bacteria | 2002 |
| 131 | Ga0105243_10107691 | 3300009148 | Bacteria | 2325 |
| 132 | Ga0105248_10000010 | 3300009177 | Bacteria | 344314 |
| 133 | Ga0105248_10001558 | 3300009177 | Bacteria | 25511 |
| 134 | Ga0105248_10001758 | 3300009177 | Bacteria | 24108 |
| 135 | Ga0105237_10048537 | 3300009545 | Bacteria | 4268 |
| 136 | Ga0105237_10059493 | 3300009545 | Bacteria | 3822 |
| 137 | Ga0105249_10000006 | 3300009553 | Bacteria | 354449 |
| 138 | Ga0105249_10000041 | 3300009553 | Bacteria | 195999 |
| 139 | Ga0105249_10036895 | 3300009553 | Bacteria | 4435 |
| 140 | Ga0105239_10000156 | 3300010375 | Bacteria | 98400 |
| 141 | Ga0105246_10000348 | 3300011119 | Bacteria | 24737 |
| 142 | Ga0157373_10058315 | 3300013100 | Bacteria | 2737 |
| 143 | Ga0157373_10117885 | 3300013100 | Bacteria | 1866 |
| 144 | Ga0157371_10001066 | 3300013102 | Bacteria | 29941 |
| 145 | Ga0157371_10024110 | 3300013102 | Bacteria | 4444 |
| 146 | Ga0157371_10065408 | 3300013102 | Bacteria | 2575 |
| 147 | Ga0157370_10025717 | 3300013104 | Bacteria | 5825 |
| 148 | Ga0157370_10043180 | 3300013104 | Bacteria | 4340 |
| 149 | Ga0157370_10057965 | 3300013104 | Bacteria | 3681 |
| 150 | Ga0157369_10000239 | 3300013105 | Bacteria | 76144 |
| 151 | Ga0157369_10011078 | 3300013105 | Bacteria | 10258 |
| 152 | Ga0157369_10031578 | 3300013105 | Bacteria | 5831 |
| 153 | Ga0157369_10052031 | 3300013105 | Bacteria | 4431 |
| 154 | Ga0157369_10055073 | 3300013105 | Bacteria | 4294 |
| 155 | Ga0157374_10055242 | 3300013296 | Bacteria | 3705 |
| 156 | Ga0157372_10032771 | 3300013307 | Bacteria | 5701 |
| 157 | Ga0157372_10071451 | 3300013307 | Bacteria | 3908 |
| 158 | Ga0157375_10155315 | 3300013308 | Bacteria | 2427 |
| 159 | Ga0157380_10000029 | 3300014326 | Bacteria | 98248 |
| 160 | Ga0157380_10000182 | 3300014326 | Bacteria | 36263 |
| 161 | Ga0157380_10001161 | 3300014326 | Bacteria | 17056 |
| 162 | Ga0163161_10000101 | 3300017792 | Bacteria | 81604 |
| 163 | Ga0163161_10030181 | 3300017792 | Bacteria | 3856 |
| 164 | Ga0163161_10116653 | 3300017792 | Bacteria | 2002 |
| 165 | Ga0213875_10009905 | 3300021388 | Bacteria | 4804 |
| 166 | Ga0207672_1000388 | 3300025223 | Bacteria | 5719 |
| 167 | Ga0209437_103614 | 3300025233 | Bacteria | 2776 |
| 168 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 169 | Ga0209129_1004489 | 3300025258 | Bacteria | 5421 |
| 170 | Ga0209233_1000104 | 3300025261 | Bacteria | 272675 |
| 171 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 172 | Ga0209565_1000134 | 3300025263 | Bacteria | 104013 |
| 173 | Ga0209675_1000424 | 3300025291 | Bacteria | 34090 |
| 174 | Ga0209676_1000081 | 3300025292 | Bacteria | 285297 |
| 175 | Ga0209676_1000226 | 3300025292 | Bacteria | 124004 |
| 176 | Ga0209676_1000359 | 3300025292 | Bacteria | 86410 |
| 177 | Ga0209676_1003684 | 3300025292 | Bacteria | 9169 |
| 178 | Ga0209676_1024855 | 3300025292 | Bacteria | 1930 |
| 179 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 180 | Ga0209025_1027288 | 3300025294 | Bacteria | 2835 |
| 181 | Ga0209564_1000622 | 3300025295 | Bacteria | 53970 |
| 182 | Ga0209564_1018804 | 3300025295 | Bacteria | 2613 |
| 183 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 184 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 185 | Ga0209050_1000067 | 3300025298 | Bacteria | 304206 |
| 186 | Ga0209050_1000581 | 3300025298 | Bacteria | 59224 |
| 187 | Ga0209050_1012694 | 3300025298 | Bacteria | 3833 |
| 188 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 189 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 190 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 191 | Ga0209257_1000392 | 3300025304 | Bacteria | 87104 |
| 192 | Ga0209257_1000577 | 3300025304 | Bacteria | 61710 |
| 193 | Ga0209257_1000597 | 3300025304 | Bacteria | 59900 |
| 194 | Ga0209257_1000699 | 3300025304 | Bacteria | 51960 |
| 195 | Ga0209257_1000876 | 3300025304 | Bacteria | 42634 |
| 196 | Ga0209257_1002353 | 3300025304 | Bacteria | 19010 |
| 197 | Ga0209257_1002961 | 3300025304 | Bacteria | 15554 |
| 198 | Ga0207656_10004487 | 3300025321 | Bacteria | 4880 |
| 199 | Ga0207713_1001586 | 3300025735 | Bacteria | 17804 |
| 200 | Ga0207710_10017040 | 3300025900 | Bacteria | 3078 |
| 201 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 202 | Ga0207647_10000038 | 3300025904 | Bacteria | 94897 |
| 203 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 204 | Ga0207705_10000686 | 3300025909 | Bacteria | 28058 |
| 205 | Ga0207705_10095894 | 3300025909 | Bacteria | 2177 |
| 206 | Ga0207707_10088449 | 3300025912 | Bacteria | 2706 |
| 207 | Ga0207695_10000521 | 3300025913 | Bacteria | 81496 |
| 208 | Ga0207695_10001183 | 3300025913 | Bacteria | 45024 |
| 209 | Ga0207695_10002949 | 3300025913 | Bacteria | 24555 |
| 210 | Ga0207695_10027274 | 3300025913 | Bacteria | 6363 |
| 211 | Ga0207695_10034072 | 3300025913 | Bacteria | 5545 |
| 212 | Ga0207695_10142075 | 3300025913 | Bacteria | 2348 |
| 213 | Ga0207671_10001192 | 3300025914 | Bacteria | 30866 |
| 214 | Ga0207660_10102636 | 3300025917 | Bacteria | 2138 |
| 215 | Ga0207657_10005993 | 3300025919 | Bacteria | 12650 |
| 216 | Ga0207657_10101930 | 3300025919 | Bacteria | 2381 |
| 217 | Ga0207649_10000791 | 3300025920 | Bacteria | 20385 |
| 218 | Ga0207649_10005734 | 3300025920 | Bacteria | 6722 |
| 219 | Ga0207652_10071800 | 3300025921 | Bacteria | 3009 |
| 220 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 221 | Ga0207681_10000183 | 3300025923 | Bacteria | 51105 |
| 222 | Ga0207681_10042516 | 3300025923 | Bacteria | 3036 |
| 223 | Ga0207694_10002087 | 3300025924 | Bacteria | 16502 |
| 224 | Ga0207694_10068861 | 3300025924 | Bacteria | 2764 |
| 225 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 226 | Ga0207650_10000083 | 3300025925 | Bacteria | 127270 |
| 227 | Ga0207650_10006404 | 3300025925 | Bacteria | 8018 |
| 228 | Ga0207659_10031315 | 3300025926 | Bacteria | 3640 |
| 229 | Ga0207644_10000025 | 3300025931 | Bacteria | 152401 |
| 230 | Ga0207644_10000067 | 3300025931 | Bacteria | 76116 |
| 231 | Ga0207644_10001857 | 3300025931 | Bacteria | 13746 |
| 232 | Ga0207690_10013573 | 3300025932 | Bacteria | 4897 |
| 233 | Ga0207706_10004487 | 3300025933 | Bacteria | 13106 |
| 234 | Ga0207706_10009042 | 3300025933 | Bacteria | 9165 |
| 235 | Ga0207706_10051503 | 3300025933 | Bacteria | 3635 |
| 236 | Ga0207706_10083285 | 3300025933 | Bacteria | 2812 |
| 237 | Ga0207670_10038819 | 3300025936 | Bacteria | 3113 |
| 238 | Ga0207669_10000341 | 3300025937 | Bacteria | 21234 |
| 239 | Ga0207711_10000035 | 3300025941 | Bacteria | 177223 |
| 240 | Ga0207711_10000075 | 3300025941 | Bacteria | 106870 |
| 241 | Ga0207711_10000852 | 3300025941 | Bacteria | 29486 |
| 242 | Ga0207711_10023479 | 3300025941 | Bacteria | 5163 |
| 243 | Ga0207679_10052103 | 3300025945 | Bacteria | 3000 |
| 244 | Ga0207667_10011748 | 3300025949 | Bacteria | 10154 |
| 245 | Ga0207667_10011755 | 3300025949 | Bacteria | 10151 |
| 246 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 247 | Ga0207712_10000620 | 3300025961 | Bacteria | 28034 |
| 248 | Ga0207712_10021227 | 3300025961 | Bacteria | 4261 |
| 249 | Ga0207712_10155058 | 3300025961 | Bacteria | 1773 |
| 250 | Ga0207668_10000066 | 3300025972 | Bacteria | 84452 |
| 251 | Ga0207668_10000081 | 3300025972 | Bacteria | 72145 |
| 252 | Ga0207668_10000207 | 3300025972 | Bacteria | 39613 |
| 253 | Ga0207668_10000632 | 3300025972 | Bacteria | 21688 |
| 254 | Ga0207668_10003532 | 3300025972 | Bacteria | 9188 |
| 255 | Ga0207668_10035832 | 3300025972 | Bacteria | 3308 |
| 256 | Ga0207640_10000322 | 3300025981 | Bacteria | 32021 |
| 257 | Ga0207640_10005185 | 3300025981 | Bacteria | 7087 |
| 258 | Ga0207640_10116586 | 3300025981 | Bacteria | 1904 |
| 259 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 260 | Ga0207658_10000069 | 3300025986 | Bacteria | 113687 |
| 261 | Ga0207658_10000388 | 3300025986 | Bacteria | 42759 |
| 262 | Ga0207658_10008782 | 3300025986 | Bacteria | 6860 |
| 263 | Ga0207658_10126112 | 3300025986 | Bacteria | 2049 |
| 264 | Ga0207703_10005351 | 3300026035 | Bacteria | 10337 |
| 265 | Ga0207703_10055115 | 3300026035 | Bacteria | 3234 |
| 266 | Ga0207639_10000213 | 3300026041 | Bacteria | 43227 |
| 267 | Ga0207639_10012302 | 3300026041 | Bacteria | 5959 |
| 268 | Ga0207639_10016174 | 3300026041 | Bacteria | 5271 |
| 269 | Ga0207639_10036303 | 3300026041 | Bacteria | 3651 |
| 270 | Ga0207678_10000857 | 3300026067 | Bacteria | 27922 |
| 271 | Ga0207678_10081500 | 3300026067 | Bacteria | 2770 |
| 272 | Ga0207678_10126348 | 3300026067 | Bacteria | 2181 |
| 273 | Ga0207702_10000887 | 3300026078 | Bacteria | 31141 |
| 274 | Ga0207702_10003360 | 3300026078 | Bacteria | 14672 |
| 275 | Ga0207702_10019109 | 3300026078 | Bacteria | 5670 |
| 276 | Ga0207702_10028147 | 3300026078 | Bacteria | 4669 |
| 277 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 278 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 279 | Ga0207641_10000029 | 3300026088 | Bacteria | 229383 |
| 280 | Ga0207641_10000099 | 3300026088 | Bacteria | 122892 |
| 281 | Ga0207641_10003319 | 3300026088 | Bacteria | 14317 |
| 282 | Ga0207641_10004490 | 3300026088 | Bacteria | 12070 |
| 283 | Ga0207641_10004505 | 3300026088 | Bacteria | 12048 |
| 284 | Ga0207641_10007449 | 3300026088 | Bacteria | 9105 |
| 285 | Ga0207641_10013693 | 3300026088 | Bacteria | 6656 |
| 286 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 287 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 288 | Ga0207676_10004057 | 3300026095 | Bacteria | 10327 |
| 289 | Ga0207674_10099190 | 3300026116 | Bacteria | 2895 |
| 290 | Ga0207674_10183384 | 3300026116 | Bacteria | 2044 |
| 291 | Ga0207674_10232733 | 3300026116 | Bacteria | 1790 |
| 292 | Ga0207675_100000159 | 3300026118 | Bacteria | 59714 |
| 293 | Ga0207675_100001138 | 3300026118 | Bacteria | 26336 |
| 294 | Ga0207675_100001918 | 3300026118 | Bacteria | 20742 |
| 295 | Ga0207698_10001007 | 3300026142 | Bacteria | 16393 |
| 296 | Ga0207698_10018132 | 3300026142 | Bacteria | 4790 |
| 297 | Ga0209813_10000051 | 3300027866 | Bacteria | 47545 |
| 298 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 299 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 300 | Ga0268266_10000103 | 3300028379 | Bacteria | 179736 |
| 301 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 302 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 303 | Ga0268265_10000047 | 3300028380 | Bacteria | 179354 |
| 304 | Ga0268265_10004726 | 3300028380 | Bacteria | 9397 |
| 305 | Ga0268265_10064228 | 3300028380 | Bacteria | 2827 |
| 306 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 307 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 308 | Ga0268264_10000217 | 3300028381 | Bacteria | 113674 |
| 309 | Ga0268264_10020628 | 3300028381 | Bacteria | 5383 |
| 310 | Ga0307517_10122471 | 3300028786 | Bacteria | 1915 |
| 311 | Ga0307513_10090649 | 3300031456 | Bacteria | 3117 |
| 312 | Ga0307508_10000231 | 3300031616 | Bacteria | 67806 |
| 313 | Ga0316575_10000031 | 3300031665 | Bacteria | 34008 |
| 314 | Ga0307412_10000306 | 3300031911 | Bacteria | 30998 |
| 315 | Ga0307412_10043907 | 3300031911 | Bacteria | 2914 |
| 316 | Ga0307412_10128431 | 3300031911 | Bacteria | 1837 |
| 317 | Ga0307416_100013673 | 3300032002 | Bacteria | 5526 |
| 318 | Ga0307414_10000107 | 3300032004 | Bacteria | 58717 |
| 319 | Ga0307414_10001551 | 3300032004 | Bacteria | 11939 |
| 320 | Ga0307414_10144870 | 3300032004 | Bacteria | 1865 |
| 321 | Ga0307411_10098607 | 3300032005 | Bacteria | 2060 |
| 322 | Ga0395900_0004316 | 3300037418 | Bacteria | 15070 |
| 323 | Ga0395900_0093280 | 3300037418 | Bacteria | 3093 |
| 324 | Ga0395900_0126827 | 3300037418 | Bacteria | 2617 |
| 325 | Ga0395898_0003945 | 3300037466 | Bacteria | 16365 |
| 326 | Ga0395898_0112185 | 3300037466 | Bacteria | 2613 |
| 327 | Ga0436364_1037353 | 3300037853 | Bacteria | 2350 |
| 328 | Ga0395901_0003484 | 3300038443 | Bacteria | 15855 |
| 329 | Ga0439461_0000869 | 3300041410 | Bacteria | 4466 |
| 330 | Ga0439465_0014629 | 3300041413 | Bacteria | 2446 |
| 331 | Ga0439431_0001353 | 3300041997 | Bacteria | 5407 |
| 332 | Ga0439445_0007310 | 3300042004 | Bacteria | 2559 |
| 333 | Ga0439432_008143 | 3300042006 | Bacteria | 3689 |
| 334 | Ga0439434_0001561 | 3300042435 | Bacteria | 6606 |
| 335 | Ga0466966_0000039 | 3300044684 | Bacteria | 97202 |
| 336 | Ga0466961_0066707 | 3300044693 | Bacteria | 2285 |
| 337 | Ga0466963_0015989 | 3300044694 | Bacteria | 4658 |
| 338 | Ga0466971_0020302 | 3300044719 | Bacteria | 2953 |
| 339 | Ga0466970_0020776 | 3300044765 | Bacteria | 3415 |
| 340 | Ga0466957_0004188 | 3300044842 | Bacteria | 7994 |
| 341 | Ga0466959_0080091 | 3300045049 | Bacteria | 2354 |
| 342 | Ga0451576_0000122 | 3300045051 | Bacteria | 197797 |
| 343 | Ga0466958_0000524 | 3300045836 | Bacteria | 16183 |
| 344 | Ga0495627_000156 | 3300046453 | Bacteria | 78784 |
| 345 | Ga0495627_000578 | 3300046453 | Bacteria | 29484 |
| 346 | Ga0495638_0000051 | 3300046460 | Bacteria | 206003 |
| 347 | Ga0495650_0000440 | 3300046471 | Bacteria | 66809 |
| 348 | Ga0495583_0000498 | 3300046506 | Bacteria | 56923 |
| 349 | Ga0495583_0000680 | 3300046506 | Bacteria | 44152 |
| 350 | Ga0495610_0000291 | 3300046512 | Bacteria | 52599 |
| 351 | Ga0495616_0001456 | 3300046513 | Bacteria | 16481 |
| 352 | Ga0495632_0000006 | 3300046519 | Bacteria | 345883 |
| 353 | Ga0495632_0000511 | 3300046519 | Bacteria | 36529 |
| 354 | Ga0495637_0000784 | 3300046520 | Bacteria | 21358 |
| 355 | Ga0495637_0010852 | 3300046520 | Bacteria | 4391 |
| 356 | Ga0495643_0000021 | 3300046522 | Bacteria | 293465 |
| 357 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 358 | Ga0495648_0000459 | 3300046524 | Bacteria | 44196 |
| 359 | Ga0495648_0010683 | 3300046524 | Bacteria | 6974 |
| 360 | Ga0495648_0042230 | 3300046524 | Bacteria | 2871 |
| 361 | Ga0495663_0000008 | 3300046525 | Bacteria | 260614 |
| 362 | Ga0495663_0003362 | 3300046525 | Bacteria | 4626 |
| 363 | Ga0495654_0025872 | 3300046530 | Bacteria | 3022 |
| 364 | Ga0495597_0012521 | 3300046542 | Bacteria | 4092 |
| 365 | Ga0495633_0000190 | 3300046558 | Bacteria | 79967 |
| 366 | Ga0495633_0002635 | 3300046558 | Bacteria | 12531 |
| 367 | Ga0495633_0024761 | 3300046558 | Bacteria | 2962 |
| 368 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 369 | Ga0495668_0023455 | 3300046616 | Bacteria | 3518 |
| 370 | Ga0495611_0023270 | 3300046648 | Bacteria | 2687 |
| 371 | Ga0495625_0000853 | 3300046660 | Bacteria | 41514 |
| 372 | Ga0495625_0034464 | 3300046660 | Bacteria | 3736 |
| 373 | Ga0495625_0038886 | 3300046660 | Bacteria | 3478 |
| 374 | Ga0495671_0000017 | 3300046692 | Bacteria | 293465 |
| 375 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 376 | Ga0495683_0006914 | 3300047323 | Bacteria | 6164 |
| 377 | Ga0495687_000563 | 3300047443 | Bacteria | 43682 |
| 378 | Ga0495673_0000076 | 3300047469 | Bacteria | 205985 |
| 379 | Ga0495681_0000098 | 3300047470 | Bacteria | 75809 |
| 380 | Ga0495681_0008268 | 3300047470 | Bacteria | 6539 |
| 381 | Ga0495686_0001323 | 3300047472 | Bacteria | 27753 |
| 382 | Ga0495686_0008463 | 3300047472 | Bacteria | 7546 |
| 383 | Ga0495686_0016175 | 3300047472 | Bacteria | 5067 |
| 384 | Ga0496101_0061617 | 3300048904 | Bacteria | 2725 |
| 385 | Ga0496102_0048987 | 3300048905 | Bacteria | 3842 |
| 386 | Ga0496102_0294965 | 3300048905 | Bacteria | 1528 |
| 387 | Ga0496108_0000682 | 3300048911 | Bacteria | 26248 |
| 388 | Ga0496115_0001129 | 3300048918 | Bacteria | 19266 |
| 389 | Ga0496116_0021417 | 3300048919 | Bacteria | 4878 |
| 390 | Ga0496117_0003631 | 3300048920 | Bacteria | 17769 |
| 391 | Ga0496118_0000162 | 3300048921 | Bacteria | 119635 |
| 392 | Ga0496118_0000463 | 3300048921 | Bacteria | 67382 |
| 393 | Ga0496118_0041350 | 3300048921 | Bacteria | 3650 |
| 394 | Ga0496120_0030374 | 3300048923 | Bacteria | 3286 |
| 395 | Ga0496121_0000296 | 3300048924 | Bacteria | 103215 |
| 396 | Ga0496121_0003051 | 3300048924 | Bacteria | 24286 |
| 397 | Ga0496121_0004153 | 3300048924 | Bacteria | 19798 |
| 398 | Ga0496121_0006913 | 3300048924 | Bacteria | 13836 |
| 399 | Ga0496122_0003556 | 3300048925 | Bacteria | 20365 |
| 400 | Ga0496122_0008730 | 3300048925 | Bacteria | 10847 |
| 401 | Ga0496122_0039577 | 3300048925 | Bacteria | 3758 |
| 402 | Ga0496123_0006936 | 3300048926 | Bacteria | 10822 |
| 403 | Ga0496123_0016815 | 3300048926 | Bacteria | 5914 |
| 404 | Ga0496123_0049602 | 3300048926 | Bacteria | 2813 |
| 405 | Ga0496124_0000874 | 3300048927 | Bacteria | 49185 |
| 406 | Ga0496124_0005852 | 3300048927 | Bacteria | 13640 |
| 407 | Ga0496124_0023873 | 3300048927 | Bacteria | 5571 |
| 408 | Ga0496124_0069413 | 3300048927 | Bacteria | 2926 |
| 409 | Ga0496125_0159444 | 3300048928 | Bacteria | 1535 |
| 410 | Ga0496126_0004477 | 3300048929 | Bacteria | 16680 |
| 411 | Ga0495678_014836 | 3300049459 | Bacteria | 3610 |
| 412 | Ga0501290_000237 | 3300049513 | Bacteria | 9135 |
| 413 | Ga0501292_000042 | 3300049515 | Bacteria | 29474 |
| 414 | Ga0501294_000032 | 3300049517 | Bacteria | 13769 |
| 415 | Ga0501300_000392 | 3300049523 | Bacteria | 6689 |
| 416 | Ga0501033_0062148 | 3300049570 | Bacteria | 2750 |
| 417 | Ga0501034_0015035 | 3300049571 | Bacteria | 7959 |
| 418 | Ga0501036_0016173 | 3300049572 | Bacteria | 6231 |
| 419 | Ga0501037_0024382 | 3300049573 | Bacteria | 4474 |
| 420 | Ga0501038_0059946 | 3300049574 | Bacteria | 3258 |
| 421 | Ga0501043_0040198 | 3300049579 | Bacteria | 3676 |
| 422 | Ga0501047_0000731 | 3300049581 | Bacteria | 34159 |
| 423 | Ga0501202_004785 | 3300049652 | Bacteria | 2379 |
| 424 | Ga0501206_004338 | 3300049653 | Bacteria | 1802 |
| 425 | Ga0501207_003635 | 3300049654 | Bacteria | 2063 |
| 426 | Ga0501211_000103 | 3300049658 | Bacteria | 6327 |
| 427 | Ga0501222_004369 | 3300049662 | Bacteria | 1918 |
| 428 | Ga0501223_000039 | 3300049663 | Bacteria | 45537 |
| 429 | Ga0501224_000307 | 3300049664 | Bacteria | 5682 |
| 430 | Ga0501227_001503 | 3300049665 | Bacteria | 5201 |
| 431 | Ga0501233_003453 | 3300049668 | Bacteria | 2841 |
| 432 | Ga0501235_001097 | 3300049669 | Bacteria | 5663 |
| 433 | Ga0501249_000213 | 3300049679 | Bacteria | 17777 |
| 434 | Ga0501257_013485 | 3300049686 | Bacteria | 1874 |
| 435 | Ga0501261_000021 | 3300049690 | Bacteria | 37511 |
| 436 | Ga0501225_0000010 | 3300049705 | Bacteria | 82395 |
| 437 | Ga0501225_0002702 | 3300049705 | Bacteria | 5447 |
| 438 | Ga0501225_0004968 | 3300049705 | Bacteria | 3928 |
| 439 | Ga0501279_000010 | 3300049775 | Bacteria | 103375 |
| 440 | Ga0501280_000064 | 3300049776 | Bacteria | 31054 |
| 441 | Ga0501281_00086 | 3300049777 | Bacteria | 10989 |
| 442 | Ga0501282_000404 | 3300049778 | Bacteria | 5157 |
| 443 | Ga0501035_0018213 | 3300049822 | Bacteria | 6468 |
| 444 | Ga0501044_0119349 | 3300049823 | Bacteria | 2639 |
| 445 | nmdc:mga06z11_17_c1 | 3300050494 | Bacteria | 79602 |
| 446 | nmdc:mga04h51_146_c1 | 3300050495 | Bacteria | 20585 |
| 447 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 448 | Ga0500643_000135 | 3300053087 | Bacteria | 74911 |
| 449 | Ga0500643_000195 | 3300053087 | Bacteria | 57960 |
| 450 | Ga0500643_000644 | 3300053087 | Bacteria | 23511 |
| 451 | Ga0500643_000783 | 3300053087 | Bacteria | 20603 |
| 452 | Ga0500643_001242 | 3300053087 | Bacteria | 15099 |
| 453 | Ga0500643_001994 | 3300053087 | Bacteria | 11035 |
| 454 | Ga0500643_003224 | 3300053087 | Bacteria | 7943 |
| 455 | Ga0500643_004770 | 3300053087 | Bacteria | 6009 |
| 456 | Ga0500643_008402 | 3300053087 | Bacteria | 4060 |
| 457 | Ga0500566_0006685 | 3300053094 | Bacteria | 6826 |
| 458 | Ga0500592_000031 | 3300053116 | Bacteria | 47686 |
| 459 | Ga0500592_002102 | 3300053116 | Bacteria | 3208 |
| 460 | Ga0500594_0000698 | 3300053118 | Bacteria | 7181 |
| 461 | Ga0500595_001506 | 3300053119 | Bacteria | 12379 |
| 462 | Ga0500655_000251 | 3300053133 | Bacteria | 12576 |
| 463 | Ga0500658_0006467 | 3300053134 | Bacteria | 4345 |
| 464 | Ga0500559_0003794 | 3300053136 | Bacteria | 7323 |
| 465 | Ga0500568_0003157 | 3300053139 | Bacteria | 9385 |
| 466 | Ga0500573_0000086 | 3300053140 | Bacteria | 42361 |
| 467 | Ga0500590_000131 | 3300053148 | Bacteria | 20923 |
| 468 | Ga0500616_0033520 | 3300053153 | Bacteria | 2802 |
| 469 | Ga0500622_0025695 | 3300053156 | Bacteria | 3111 |
| 470 | Ga0500627_0000017 | 3300053158 | Bacteria | 119507 |
| 471 | Ga0500627_0001223 | 3300053158 | Bacteria | 7068 |
| 472 | Ga0500636_0027233 | 3300053177 | Bacteria | 3376 |
| 473 | Ga0500570_004079 | 3300053724 | Bacteria | 7637 |
| 474 | Ga0500661_000092 | 3300055283 | Bacteria | 14368 |
| 475 | 2512645204 | 2512564014 | Bacteria | 4639632 |
| 476 | 2585262263 | 2582581305 | Bacteria | 4895574 |
| 477 | 2600202833 | 2599185354 | Bacteria | 4398675 |
| 478 | 2600225497 | 2599185359 | Bacteria | 4772316 |
| 479 | 2643729754 | 2643221541 | Bacteria | 5498788 |
| 480 | 2643731594 | 2643221541 | Bacteria | 5498788 |
| 481 | 2643820706 | 2643221560 | Bacteria | 4801179 |
| 482 | 2643833140 | 2643221563 | Bacteria | 4726935 |
| 483 | 2644036771 | 2643221605 | Bacteria | 4772303 |
| 484 | 2644042078 | 2643221606 | Bacteria | 5588032 |
| 485 | 2644044114 | 2643221606 | Bacteria | 5588032 |
| 486 | 2644053065 | 2643221608 | Bacteria | 4724829 |
| 487 | 2644126033 | 2643221622 | Bacteria | 4212502 |
| 488 | 2644392582 | 2643221671 | Bacteria | 5496681 |
| 489 | 2644394279 | 2643221671 | Bacteria | 5496681 |
| 490 | 2753767183 | 2751185897 | Bacteria | 5322941 |
| 491 | 2778125111 | 2775507255 | Bacteria | 3945731 |
| 492 | 2809063042 | 2808606401 | Bacteria | 4586670 |
| 493 | 2809079006 | 2808606404 | Bacteria | 4652788 |
| 494 | 2809083619 | 2808606405 | Bacteria | 4586632 |
| 495 | 2819713940 | 2818991466 | Bacteria | 4748179 |
| 496 | 2852656192 | 2852653556 | Bacteria | 4050083 |
| 497 | 2852682525 | 2852680915 | Bacteria | 4100189 |
| 498 | 2879165172 | 2879163058 | Bacteria | 4223965 |
| 499 | 2880520297 | 2880518877 | Bacteria | 5012590 |
| 500 | 2880521218 | 2880518877 | Bacteria | 5012590 |
| 501 | 2885429809 | 2885429604 | Bacteria | 3642894 |
| 502 | 2896254680 | 2896253425 | Bacteria | 3418029 |
| 503 | 2919713326 | 2919709256 | Bacteria | 4318106 |
| 504 | 2928528502 | 2928526807 | Bacteria | 4760224 |
| 505 | 2928970047 | 2928968154 | Bacteria | 4633371 |
| 506 | 8057101251 | 8057101203 | Bacteria | 5034064 |
| 507 | Ga0068859_100010259 | |||
| 508 | SwRhRL2b_contig_453878 | |||
| 509 | JGI24736J21556_1000032 | |||
| 510 | JGI24736J21556_1000613 | |||
| 511 | JGI24736J21556_1005999 | |||
| 512 | JGI24741J21665_1000366 | |||
| 513 | JGI24752J21851_1000082 | |||
| 514 | JGI24740J21852_10005104 | |||
| 515 | JGI24740J21852_10005188 | |||
| 516 | JGI24739J22299_10005319 | |||
| 517 | JGI24739J22299_10007626 | |||
| 518 | JGI24737J22298_10001306 | |||
| 519 | JGI24735J21928_10001114 | |||
| 520 | JGI24735J21928_10004932 | |||
| 521 | JGI24748J21848_1000036 | |||
| 522 | JGI24738J21930_10000231 | |||
| 523 | JGI24749J21850_1000049 | |||
| 524 | JGI24034J26672_10000008 | |||
| 525 | JGI24034J26672_10000038 | |||
| 526 | JGI24751J29686_10000216 | |||
| 527 | JGI25150J39212_1001984 | |||
| 528 | JGI25165J46597_1000041 | |||
| 529 | JGI25153J46596_10000395 | |||
| 530 | Ga0055526_1007921 | |||
| 531 | Ga0055537_1003939 | |||
| 532 | Ga0055524_1000539 | |||
| 533 | Ga0055536_1002308 | |||
| 534 | Ga0055536_1004688 | |||
| 535 | Ga0055530_10000012 | |||
| 536 | Ga0055530_10003402 | |||
| 537 | Ga0055530_10028081 | |||
| 538 | Ga0055540_1002064 | |||
| 539 | Ga0055531_10000466 | |||
| 540 | Ga0055531_10003730 | |||
| 541 | Ga0055531_10004059 | |||
| 542 | Ga0055531_10006558 | |||
| 543 | Ga0065165_1005379 | |||
| 544 | Ga0065165_1018890 | |||
| 545 | Ga0065704_10001612 | |||
| 546 | Ga0065704_10116929 | |||
| 547 | Ga0065707_10000505 | |||
| 548 | Ga0065707_10084570 | |||
| 549 | Ga0070658_10030197 | |||
| 550 | Ga0070683_100024933 | |||
| 551 | Ga0070690_100000021 | |||
| 552 | Ga0070670_100000003 | |||
| 553 | Ga0070670_100000021 | |||
| 554 | Ga0070670_100002377 | |||
| 555 | Ga0070670_100039241 | |||
| 556 | Ga0070670_100204945 | |||
| 557 | Ga0070666_10000004 | |||
| 558 | Ga0070666_10005044 | |||
| 559 | Ga0070660_100032343 | |||
| 560 | Ga0070689_100056210 | |||
| 561 | Ga0070661_100005915 | |||
| 562 | Ga0070661_100013974 | |||
| 563 | Ga0070661_100033172 | |||
| 564 | Ga0070668_100000026 | |||
| 565 | Ga0070668_100000047 | |||
| 566 | Ga0070668_100000925 | |||
| 567 | Ga0070668_100020174 | |||
| 568 | Ga0070668_100031691 | |||
| 569 | Ga0070669_100000020 | |||
| 570 | Ga0070669_100004471 | |||
| 571 | Ga0070671_100000470 | |||
| 572 | Ga0070671_100019303 | |||
| 573 | Ga0070671_100027553 | |||
| 574 | Ga0070688_100022724 | |||
| 575 | Ga0070667_100000019 | |||
| 576 | Ga0070667_100000089 | |||
| 577 | Ga0070667_100000642 | |||
| 578 | Ga0070667_100179297 | |||
| 579 | Ga0070663_100002941 | |||
| 580 | Ga0070663_100013110 | |||
| 581 | Ga0070662_100003611 | |||
| 582 | Ga0070685_10000724 | |||
| 583 | Ga0070679_100004736 | |||
| 584 | Ga0070679_100007172 | |||
| 585 | Ga0068853_100074332 | |||
| 586 | Ga0070686_100000012 | |||
| 587 | Ga0070665_100000004 | |||
| 588 | Ga0070665_100000075 | |||
| 589 | Ga0070665_100000323 | |||
| 590 | Ga0068855_100038577 | |||
| 591 | Ga0070664_100030216 | |||
| 592 | Ga0068857_100021366 | |||
| 593 | Ga0068857_100052891 | |||
| 594 | Ga0068857_100059311 | |||
| 595 | Ga0068857_100160717 | |||
| 596 | Ga0068854_100007481 | |||
| 597 | Ga0068854_100068110 | |||
| 598 | Ga0068854_100069920 | |||
| 599 | Ga0068856_100019563 | |||
| 600 | Ga0068856_100020542 | |||
| 601 | Ga0068852_100002009 | |||
| 602 | Ga0068859_100003505 | |||
| 603 | Ga0068864_100000004 | |||
| 604 | Ga0068864_100000005 | |||
| 605 | Ga0068861_100000001 | |||
| 606 | Ga0068861_100014274 | |||
| 607 | Ga0068861_100020681 | |||
| 608 | Ga0068851_10040267 | |||
| 609 | Ga0068863_100000001 | |||
| 610 | Ga0068863_100000002 | |||
| 611 | Ga0068863_100000013 | |||
| 612 | Ga0068863_100000093 | |||
| 613 | Ga0068863_100002259 | |||
| 614 | Ga0068863_100080823 | |||
| 615 | Ga0068858_100025268 | |||
| 616 | Ga0068860_100000009 | |||
| 617 | Ga0068860_100000036 | |||
| 618 | Ga0068860_100000148 | |||
| 619 | Ga0068862_100000001 | |||
| 620 | Ga0068862_100000002 | |||
| 621 | Ga0068862_100000209 | |||
| 622 | Ga0068862_100086776 | |||
| 623 | Ga0081455_10000255 | |||
| 624 | Ga0075368_10003525 | |||
| 625 | Ga0075363_100005439 | |||
| 626 | Ga0075367_10000099 | |||
| 627 | Ga0068871_100130490 | |||
| 628 | Ga0097620_100003505 | |||
| 629 | Ga0097620_100010259 | |||
| 630 | Ga0105251_10001284 | |||
| 631 | Ga0105240_10000959 | |||
| 632 | Ga0105240_10005945 | |||
| 633 | Ga0105240_10239896 | |||
| 634 | Ga0105240_10270667 | |||
| 635 | Ga0105247_10008068 | |||
| 636 | Ga0114129_10336874 | |||
| 637 | Ga0105243_10107691 | |||
| 638 | Ga0105248_10000010 | |||
| 639 | Ga0105248_10001558 | |||
| 640 | Ga0105248_10001758 | |||
| 641 | Ga0105237_10048537 | |||
| 642 | Ga0105237_10059493 | |||
| 643 | Ga0105249_10000006 | |||
| 644 | Ga0105249_10000041 | |||
| 645 | Ga0105249_10036895 | |||
| 646 | Ga0105239_10000156 | |||
| 647 | Ga0105246_10000348 | |||
| 648 | Ga0157373_10058315 | |||
| 649 | Ga0157373_10117885 | |||
| 650 | Ga0157371_10001066 | |||
| 651 | Ga0157371_10024110 | |||
| 652 | Ga0157371_10065408 | |||
| 653 | Ga0157370_10025717 | |||
| 654 | Ga0157370_10043180 | |||
| 655 | Ga0157370_10057965 | |||
| 656 | Ga0157369_10000239 | |||
| 657 | Ga0157369_10011078 | |||
| 658 | Ga0157369_10031578 | |||
| 659 | Ga0157369_10052031 | |||
| 660 | Ga0157369_10055073 | |||
| 661 | Ga0157374_10055242 | |||
| 662 | Ga0157372_10032771 | |||
| 663 | Ga0157372_10071451 | |||
| 664 | Ga0157375_10155315 | |||
| 665 | Ga0157380_10000029 | |||
| 666 | Ga0157380_10000182 | |||
| 667 | Ga0157380_10001161 | |||
| 668 | Ga0163161_10000101 | |||
| 669 | Ga0163161_10030181 | |||
| 670 | Ga0163161_10116653 | |||
| 671 | Ga0213875_10009905 | |||
| 672 | Ga0207672_1000388 | |||
| 673 | Ga0209437_103614 | |||
| 674 | Ga0207425_1000041 | |||
| 675 | Ga0209129_1004489 | |||
| 676 | Ga0209233_1000104 | |||
| 677 | Ga0209565_1000008 | |||
| 678 | Ga0209565_1000134 | |||
| 679 | Ga0209675_1000424 | |||
| 680 | Ga0209676_1000081 | |||
| 681 | Ga0209676_1000226 | |||
| 682 | Ga0209676_1000359 | |||
| 683 | Ga0209676_1003684 | |||
| 684 | Ga0209676_1024855 | |||
| 685 | Ga0209025_1000068 | |||
| 686 | Ga0209025_1027288 | |||
| 687 | Ga0209564_1000622 | |||
| 688 | Ga0209564_1018804 | |||
| 689 | Ga0209758_1000004 | |||
| 690 | Ga0209050_1000001 | |||
| 691 | Ga0209050_1000067 | |||
| 692 | Ga0209050_1000581 | |||
| 693 | Ga0209050_1012694 | |||
| 694 | Ga0209256_1000009 | |||
| 695 | Ga0209256_1000010 | |||
| 696 | Ga0209051_1000191 | |||
| 697 | Ga0209257_1000392 | |||
| 698 | Ga0209257_1000577 | |||
| 699 | Ga0209257_1000597 | |||
| 700 | Ga0209257_1000699 | |||
| 701 | Ga0209257_1000876 | |||
| 702 | Ga0209257_1002353 | |||
| 703 | Ga0209257_1002961 | |||
| 704 | Ga0207656_10004487 | |||
| 705 | Ga0207713_1001586 | |||
| 706 | Ga0207710_10017040 | |||
| 707 | Ga0207680_10000010 | |||
| 708 | Ga0207647_10000038 | |||
| 709 | Ga0207705_10000003 | |||
| 710 | Ga0207705_10000686 | |||
| 711 | Ga0207705_10095894 | |||
| 712 | Ga0207707_10088449 | |||
| 713 | Ga0207695_10000521 | |||
| 714 | Ga0207695_10001183 | |||
| 715 | Ga0207695_10002949 | |||
| 716 | Ga0207695_10027274 | |||
| 717 | Ga0207695_10034072 | |||
| 718 | Ga0207695_10142075 | |||
| 719 | Ga0207671_10001192 | |||
| 720 | Ga0207660_10102636 | |||
| 721 | Ga0207657_10005993 | |||
| 722 | Ga0207657_10101930 | |||
| 723 | Ga0207649_10000791 | |||
| 724 | Ga0207649_10005734 | |||
| 725 | Ga0207652_10071800 | |||
| 726 | Ga0207681_10000005 | |||
| 727 | Ga0207681_10000183 | |||
| 728 | Ga0207681_10042516 | |||
| 729 | Ga0207694_10002087 | |||
| 730 | Ga0207694_10068861 | |||
| 731 | Ga0207650_10000004 | |||
| 732 | Ga0207650_10000083 | |||
| 733 | Ga0207650_10006404 | |||
| 734 | Ga0207659_10031315 | |||
| 735 | Ga0207644_10000025 | |||
| 736 | Ga0207644_10000067 | |||
| 737 | Ga0207644_10001857 | |||
| 738 | Ga0207690_10013573 | |||
| 739 | Ga0207706_10004487 | |||
| 740 | Ga0207706_10009042 | |||
| 741 | Ga0207706_10051503 | |||
| 742 | Ga0207706_10083285 | |||
| 743 | Ga0207670_10038819 | |||
| 744 | Ga0207669_10000341 | |||
| 745 | Ga0207711_10000035 | |||
| 746 | Ga0207711_10000075 | |||
| 747 | Ga0207711_10000852 | |||
| 748 | Ga0207711_10023479 | |||
| 749 | Ga0207679_10052103 | |||
| 750 | Ga0207667_10011748 | |||
| 751 | Ga0207667_10011755 | |||
| 752 | Ga0207712_10000014 | |||
| 753 | Ga0207712_10000620 | |||
| 754 | Ga0207712_10021227 | |||
| 755 | Ga0207712_10155058 | |||
| 756 | Ga0207668_10000066 | |||
| 757 | Ga0207668_10000081 | |||
| 758 | Ga0207668_10000207 | |||
| 759 | Ga0207668_10000632 | |||
| 760 | Ga0207668_10003532 | |||
| 761 | Ga0207668_10035832 | |||
| 762 | Ga0207640_10000322 | |||
| 763 | Ga0207640_10005185 | |||
| 764 | Ga0207640_10116586 | |||
| 765 | Ga0207658_10000002 | |||
| 766 | Ga0207658_10000069 | |||
| 767 | Ga0207658_10000388 | |||
| 768 | Ga0207658_10008782 | |||
| 769 | Ga0207658_10126112 | |||
| 770 | Ga0207703_10005351 | |||
| 771 | Ga0207703_10055115 | |||
| 772 | Ga0207639_10000213 | |||
| 773 | Ga0207639_10012302 | |||
| 774 | Ga0207639_10016174 | |||
| 775 | Ga0207639_10036303 | |||
| 776 | Ga0207678_10000857 | |||
| 777 | Ga0207678_10081500 | |||
| 778 | Ga0207678_10126348 | |||
| 779 | Ga0207702_10000887 | |||
| 780 | Ga0207702_10003360 | |||
| 781 | Ga0207702_10019109 | |||
| 782 | Ga0207702_10028147 | |||
| 783 | Ga0207641_10000001 | |||
| 784 | Ga0207641_10000002 | |||
| 785 | Ga0207641_10000029 | |||
| 786 | Ga0207641_10000099 | |||
| 787 | Ga0207641_10003319 | |||
| 788 | Ga0207641_10004490 | |||
| 789 | Ga0207641_10004505 | |||
| 790 | Ga0207641_10007449 | |||
| 791 | Ga0207641_10013693 | |||
| 792 | Ga0207676_10000005 | |||
| 793 | Ga0207676_10000006 | |||
| 794 | Ga0207676_10004057 | |||
| 795 | Ga0207674_10099190 | |||
| 796 | Ga0207674_10183384 | |||
| 797 | Ga0207674_10232733 | |||
| 798 | Ga0207675_100000159 | |||
| 799 | Ga0207675_100001138 | |||
| 800 | Ga0207675_100001918 | |||
| 801 | Ga0207698_10001007 | |||
| 802 | Ga0207698_10018132 | |||
| 803 | Ga0209813_10000051 | |||
| 804 | Ga0268266_10000002 | |||
| 805 | Ga0268266_10000009 | |||
| 806 | Ga0268266_10000103 | |||
| 807 | Ga0268265_10000001 | |||
| 808 | Ga0268265_10000003 | |||
| 809 | Ga0268265_10000047 | |||
| 810 | Ga0268265_10004726 | |||
| 811 | Ga0268265_10064228 | |||
| 812 | Ga0268264_10000001 | |||
| 813 | Ga0268264_10000023 | |||
| 814 | Ga0268264_10000217 | |||
| 815 | Ga0268264_10020628 | |||
| 816 | Ga0307517_10122471 | |||
| 817 | Ga0307513_10090649 | |||
| 818 | Ga0307508_10000231 | |||
| 819 | Ga0316575_10000031 | |||
| 820 | Ga0307412_10000306 | |||
| 821 | Ga0307412_10043907 | |||
| 822 | Ga0307412_10128431 | |||
| 823 | Ga0307416_100013673 | |||
| 824 | Ga0307414_10000107 | |||
| 825 | Ga0307414_10001551 | |||
| 826 | Ga0307414_10144870 | |||
| 827 | Ga0307411_10098607 | |||
| 828 | Ga0395900_0004316 | |||
| 829 | Ga0395900_0093280 | |||
| 830 | Ga0395900_0126827 | |||
| 831 | Ga0395898_0003945 | |||
| 832 | Ga0395898_0112185 | |||
| 833 | Ga0436364_1037353 | |||
| 834 | Ga0395901_0003484 | |||
| 835 | Ga0439461_0000869 | |||
| 836 | Ga0439465_0014629 | |||
| 837 | Ga0439431_0001353 | |||
| 838 | Ga0439445_0007310 | |||
| 839 | Ga0439432_008143 | |||
| 840 | Ga0439434_0001561 | |||
| 841 | Ga0466966_0000039 | |||
| 842 | Ga0466961_0066707 | |||
| 843 | Ga0466963_0015989 | |||
| 844 | Ga0466971_0020302 | |||
| 845 | Ga0466970_0020776 | |||
| 846 | Ga0466957_0004188 | |||
| 847 | Ga0466959_0080091 | |||
| 848 | Ga0451576_0000122 | |||
| 849 | Ga0466958_0000524 | |||
| 850 | Ga0495627_000156 | |||
| 851 | Ga0495627_000578 | |||
| 852 | Ga0495638_0000051 | |||
| 853 | Ga0495650_0000440 | |||
| 854 | Ga0495583_0000498 | |||
| 855 | Ga0495583_0000680 | |||
| 856 | Ga0495610_0000291 | |||
| 857 | Ga0495616_0001456 | |||
| 858 | Ga0495632_0000006 | |||
| 859 | Ga0495632_0000511 | |||
| 860 | Ga0495637_0000784 | |||
| 861 | Ga0495637_0010852 | |||
| 862 | Ga0495643_0000021 | |||
| 863 | Ga0495648_0000032 | |||
| 864 | Ga0495648_0000459 | |||
| 865 | Ga0495648_0010683 | |||
| 866 | Ga0495648_0042230 | |||
| 867 | Ga0495663_0000008 | |||
| 868 | Ga0495663_0003362 | |||
| 869 | Ga0495654_0025872 | |||
| 870 | Ga0495597_0012521 | |||
| 871 | Ga0495633_0000190 | |||
| 872 | Ga0495633_0002635 | |||
| 873 | Ga0495633_0024761 | |||
| 874 | Ga0495668_0000002 | |||
| 875 | Ga0495668_0023455 | |||
| 876 | Ga0495611_0023270 | |||
| 877 | Ga0495625_0000853 | |||
| 878 | Ga0495625_0034464 | |||
| 879 | Ga0495625_0038886 | |||
| 880 | Ga0495671_0000017 | |||
| 881 | Ga0495671_0000020 | |||
| 882 | Ga0495683_0006914 | |||
| 883 | Ga0495687_000563 | |||
| 884 | Ga0495673_0000076 | |||
| 885 | Ga0495681_0000098 | |||
| 886 | Ga0495681_0008268 | |||
| 887 | Ga0495686_0001323 | |||
| 888 | Ga0495686_0008463 | |||
| 889 | Ga0495686_0016175 | |||
| 890 | Ga0496101_0061617 | |||
| 891 | Ga0496102_0048987 | |||
| 892 | Ga0496102_0294965 | |||
| 893 | Ga0496108_0000682 | |||
| 894 | Ga0496115_0001129 | |||
| 895 | Ga0496116_0021417 | |||
| 896 | Ga0496117_0003631 | |||
| 897 | Ga0496118_0000162 | |||
| 898 | Ga0496118_0000463 | |||
| 899 | Ga0496118_0041350 | |||
| 900 | Ga0496120_0030374 | |||
| 901 | Ga0496121_0000296 | |||
| 902 | Ga0496121_0003051 | |||
| 903 | Ga0496121_0004153 | |||
| 904 | Ga0496121_0006913 | |||
| 905 | Ga0496122_0003556 | |||
| 906 | Ga0496122_0008730 | |||
| 907 | Ga0496122_0039577 | |||
| 908 | Ga0496123_0006936 | |||
| 909 | Ga0496123_0016815 | |||
| 910 | Ga0496123_0049602 | |||
| 911 | Ga0496124_0000874 | |||
| 912 | Ga0496124_0005852 | |||
| 913 | Ga0496124_0023873 | |||
| 914 | Ga0496124_0069413 | |||
| 915 | Ga0496125_0159444 | |||
| 916 | Ga0496126_0004477 | |||
| 917 | Ga0495678_014836 | |||
| 918 | Ga0501290_000237 | |||
| 919 | Ga0501292_000042 | |||
| 920 | Ga0501294_000032 | |||
| 921 | Ga0501300_000392 | |||
| 922 | Ga0501033_0062148 | |||
| 923 | Ga0501034_0015035 | |||
| 924 | Ga0501036_0016173 | |||
| 925 | Ga0501037_0024382 | |||
| 926 | Ga0501038_0059946 | |||
| 927 | Ga0501043_0040198 | |||
| 928 | Ga0501047_0000731 | |||
| 929 | Ga0501202_004785 | |||
| 930 | Ga0501206_004338 | |||
| 931 | Ga0501207_003635 | |||
| 932 | Ga0501211_000103 | |||
| 933 | Ga0501222_004369 | |||
| 934 | Ga0501223_000039 | |||
| 935 | Ga0501224_000307 | |||
| 936 | Ga0501227_001503 | |||
| 937 | Ga0501233_003453 | |||
| 938 | Ga0501235_001097 | |||
| 939 | Ga0501249_000213 | |||
| 940 | Ga0501257_013485 | |||
| 941 | Ga0501261_000021 | |||
| 942 | Ga0501225_0000010 | |||
| 943 | Ga0501225_0002702 | |||
| 944 | Ga0501225_0004968 | |||
| 945 | Ga0501279_000010 | |||
| 946 | Ga0501280_000064 | |||
| 947 | Ga0501281_00086 | |||
| 948 | Ga0501282_000404 | |||
| 949 | Ga0501035_0018213 | |||
| 950 | Ga0501044_0119349 | |||
| 951 | nmdc:mga06z11_17_c1 | |||
| 952 | nmdc:mga04h51_146_c1 | |||
| 953 | Ga0500643_000004 | |||
| 954 | Ga0500643_000135 | |||
| 955 | Ga0500643_000195 | |||
| 956 | Ga0500643_000644 | |||
| 957 | Ga0500643_000783 | |||
| 958 | Ga0500643_001242 | |||
| 959 | Ga0500643_001994 | |||
| 960 | Ga0500643_003224 | |||
| 961 | Ga0500643_004770 | |||
| 962 | Ga0500643_008402 | |||
| 963 | Ga0500566_0006685 | |||
| 964 | Ga0500592_000031 | |||
| 965 | Ga0500592_002102 | |||
| 966 | Ga0500594_0000698 | |||
| 967 | Ga0500595_001506 | |||
| 968 | Ga0500655_000251 | |||
| 969 | Ga0500658_0006467 | |||
| 970 | Ga0500559_0003794 | |||
| 971 | Ga0500568_0003157 | |||
| 972 | Ga0500573_0000086 | |||
| 973 | Ga0500590_000131 | |||
| 974 | Ga0500616_0033520 | |||
| 975 | Ga0500622_0025695 | |||
| 976 | Ga0500627_0000017 | |||
| 977 | Ga0500627_0001223 | |||
| 978 | Ga0500636_0027233 | |||
| 979 | Ga0500570_004079 | |||
| 980 | Ga0500661_000092 | |||
| 981 | 2512645204 | |||
| 982 | 2585262263 | |||
| 983 | 2600202833 | |||
| 984 | 2600225497 | |||
| 985 | 2643729754 | |||
| 986 | 2643731594 | |||
| 987 | 2643820706 | |||
| 988 | 2643833140 | |||
| 989 | 2644036771 | |||
| 990 | 2644042078 | |||
| 991 | 2644044114 | |||
| 992 | 2644053065 | |||
| 993 | 2644126033 | |||
| 994 | 2644392582 | |||
| 995 | 2644394279 | |||
| 996 | 2753767183 | |||
| 997 | 2778125111 | |||
| 998 | 2809063042 | |||
| 999 | 2809079006 | |||
| 1000 | 2809083619 | |||
| 1001 | 2819713940 | |||
| 1002 | 2852656192 | |||
| 1003 | 2852682525 | |||
| 1004 | 2879165172 | |||
| 1005 | 2880520297 | |||
| 1006 | 2880521218 | |||
| 1007 | 2885429809 | |||
| 1008 | 2896254680 | |||
| 1009 | 2919713326 | |||
| 1010 | 2928528502 | |||
| 1011 | 2928970047 | |||
| 1012 | 8057101251 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kp2-assembly1.cif.gz_B-2 | crystal structure of homoaconitase large subunit from methanococcus jannaschii (mj1003) | 0.9317 | 6 | 469 |
| 4kp2-assembly1.cif.gz_B-2 | crystal structure of homoaconitase large subunit from methanococcus jannaschii (mj1003) | 0.9231 | 6 | 469 |
| 4kp1-assembly1.cif.gz_A | crystal structure of ipm isomerase large subunit from methanococcus jannaschii (mj0499) | 0.8807 | 5 | 474 |
| 1c97-assembly1.cif.gz_A | s642a:isocitrate complex of aconitase | 0.8778 | 3 | 468 |
| 4kp1-assembly1.cif.gz_A | crystal structure of ipm isomerase large subunit from methanococcus jannaschii (mj0499) | 0.8767 | 5 | 474 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6A6_327_466_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9709 | 335 | 474 | 3.30.499.10 |
| af_P0A6A6_327_466_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9574 | 335 | 474 | 3.30.499.10 |
| af_O14289_10_298_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9569 | 6 | 294 | 3.30.499.10 |
| af_O14289_10_298_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9537 | 6 | 294 | 3.30.499.10 |
| af_O14289_312_505_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9431 | 309 | 484 | 3.30.499.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2E7N6-F1-model_v4 | deleted | 0.9868 | 1 | 301 |
|
| AF-A0A3M0Z7U1-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9868 | 169 | 475 |
GO:0003861
GO:0009098 GO:0046872 GO:0051539 |
| AF-C6HYC0-F1-model_v4 | 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) | 0.9862 | 4 | 474 |
GO:0003861
GO:0009098 GO:0046872 GO:0051539 |
| AF-A0A220W962-F1-model_v4 | 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) | 0.9858 | 1 | 474 |
GO:0003861
GO:0009098 GO:0046872 GO:0051539 |
| AF-Q3SNV3-F1-model_v4 | 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) | 0.9853 | 1 | 474 |
GO:0003861
GO:0009098 GO:0046872 GO:0051539 |