F456492

General Info

Members Datasets Scaffolds Average Seq Length
506 286 1012 479

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100010259|Ga0068859_1000102593
Length 474
Sequence MASKPLTLYEKIWAAHVIERRDDGTCLIYIDRHLVHEVTSPQAFAGLRANGRPVRRPDLTLAVPDHNLPTTPRRDAAGNPLPIADPESAEQLSALRKNVADFGVPYIDALAVEQGIVHVVGPEQGFTLPGTTLVCGDSHTSAHGALGALAFGIGTSEVEHVLATQTLQLSPSKTMEIRVEGSLGFGVSPKDVVLAIIGKIGAAGGTGHVIEYTGDVIRNMSIEGRLTVGARAGLVAPDETTYAYLNGRPMAPKGEAWEQAVAWWRTLPSDAGARYDALVRLDATNIAPSLTWGTSPEDVVAITGAVPDPDSFADPAKRQAARKSLDYMGLTPGMRMQDVAIEHVFIGSCTNSRIEDLRAAAAVVKGRHIADRIRQALIVPGSGLVKRQAEAEGLDRIFLEAGFEWREPGCSMCLAMNPDKVPSGERCASTSNRNFVGRQGPGARTHLVSPAMAAAAAITGRLTDVRDLVGESAE

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
210 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
211 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
212 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
221 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
222 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
223 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
224 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
225 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
226 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
227 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
228 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
231 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
232 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
233 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
234 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
235 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
236 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
237 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
244 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
258 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
259 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
260 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
261 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
262 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
263 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
264 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
265 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
266 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
267 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
268 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
269 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
270 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
271 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
272 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
273 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
274 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
275 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
276 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
277 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
278 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
279 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
280 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
281 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
282 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
283 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
284 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
285 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
286 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.4
Nodule 0
Rhizoplane 1.38
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100010259 3300005617 Bacteria 9429
2 SwRhRL2b_contig_453878 2162886007 Bacteria 5693
3 JGI24736J21556_1000032 3300001904 Bacteria 24066
4 JGI24736J21556_1000613 3300001904 Bacteria 6542
5 JGI24736J21556_1005999 3300001904 Bacteria 2050
6 JGI24741J21665_1000366 3300001915 Bacteria 13487
7 JGI24752J21851_1000082 3300001976 Bacteria 12689
8 JGI24740J21852_10005104 3300001979 Bacteria 5575
9 JGI24740J21852_10005188 3300001979 Bacteria 5530
10 JGI24739J22299_10005319 3300001989 Bacteria 4903
11 JGI24739J22299_10007626 3300001989 Bacteria 4050
12 JGI24737J22298_10001306 3300001990 Bacteria 8830
13 JGI24735J21928_10001114 3300002067 Bacteria 9626
14 JGI24735J21928_10004932 3300002067 Bacteria 4449
15 JGI24748J21848_1000036 3300002074 Bacteria 72512
16 JGI24738J21930_10000231 3300002075 Bacteria 15154
17 JGI24749J21850_1000049 3300002076 Bacteria 22639
18 JGI24034J26672_10000008 3300002239 Bacteria 200986
19 JGI24034J26672_10000038 3300002239 Bacteria 75372
20 JGI24751J29686_10000216 3300002459 Bacteria 24503
21 JGI25150J39212_1001984 3300002774 Bacteria 5350
22 JGI25165J46597_1000041 3300003214 Bacteria 272566
23 JGI25153J46596_10000395 3300003215 Bacteria 29365
24 Ga0055526_1007921 3300003771 Bacteria 5406
25 Ga0055537_1003939 3300003773 Bacteria 4403
26 Ga0055524_1000539 3300003775 Bacteria 28724
27 Ga0055536_1002308 3300003781 Bacteria 10806
28 Ga0055536_1004688 3300003781 Bacteria 6890
29 Ga0055530_10000012 3300003791 Bacteria 164829
30 Ga0055530_10003402 3300003791 Bacteria 9077
31 Ga0055530_10028081 3300003791 Bacteria 1524
32 Ga0055540_1002064 3300003792 Bacteria 11085
33 Ga0055531_10000466 3300003794 Bacteria 37479
34 Ga0055531_10003730 3300003794 Bacteria 9574
35 Ga0055531_10004059 3300003794 Bacteria 9077
36 Ga0055531_10006558 3300003794 Bacteria 6578
37 Ga0065165_1005379 3300005262 Bacteria 7235
38 Ga0065165_1018890 3300005262 Bacteria 2480
39 Ga0065704_10001612 3300005289 Bacteria 10250
40 Ga0065704_10116929 3300005289 Bacteria 1844
41 Ga0065707_10000505 3300005295 Bacteria 50569
42 Ga0065707_10084570 3300005295 Bacteria 7048
43 Ga0070658_10030197 3300005327 Bacteria 4355
44 Ga0070683_100024933 3300005329 Bacteria 5364
45 Ga0070690_100000021 3300005330 Bacteria 74350
46 Ga0070670_100000003 3300005331 Bacteria 529510
47 Ga0070670_100000021 3300005331 Bacteria 202776
48 Ga0070670_100002377 3300005331 Bacteria 15504
49 Ga0070670_100039241 3300005331 Bacteria 4072
50 Ga0070670_100204945 3300005331 Bacteria 1714
51 Ga0070666_10000004 3300005335 Bacteria 372098
52 Ga0070666_10005044 3300005335 Bacteria 8076
53 Ga0070660_100032343 3300005339 Bacteria 3935
54 Ga0070689_100056210 3300005340 Bacteria 3051
55 Ga0070661_100005915 3300005344 Bacteria 8422
56 Ga0070661_100013974 3300005344 Bacteria 5645
57 Ga0070661_100033172 3300005344 Bacteria 3739
58 Ga0070668_100000026 3300005347 Bacteria 92584
59 Ga0070668_100000047 3300005347 Bacteria 76386
60 Ga0070668_100000925 3300005347 Bacteria 20475
61 Ga0070668_100020174 3300005347 Bacteria 5026
62 Ga0070668_100031691 3300005347 Bacteria 4022
63 Ga0070669_100000020 3300005353 Bacteria 181297
64 Ga0070669_100004471 3300005353 Bacteria 10073
65 Ga0070671_100000470 3300005355 Bacteria 28105
66 Ga0070671_100019303 3300005355 Bacteria 5546
67 Ga0070671_100027553 3300005355 Bacteria 4677
68 Ga0070688_100022724 3300005365 Bacteria 3680
69 Ga0070667_100000019 3300005367 Bacteria 224710
70 Ga0070667_100000089 3300005367 Bacteria 113661
71 Ga0070667_100000642 3300005367 Bacteria 33958
72 Ga0070667_100179297 3300005367 Bacteria 1873
73 Ga0070663_100002941 3300005455 Bacteria 9696
74 Ga0070663_100013110 3300005455 Bacteria 5269
75 Ga0070662_100003611 3300005457 Bacteria 9656
76 Ga0070685_10000724 3300005466 Bacteria 17961
77 Ga0070679_100004736 3300005530 Bacteria 12550
78 Ga0070679_100007172 3300005530 Bacteria 10407
79 Ga0068853_100074332 3300005539 Bacteria 2965
80 Ga0070686_100000012 3300005544 Bacteria 176038
81 Ga0070665_100000004 3300005548 Bacteria 785500
82 Ga0070665_100000075 3300005548 Bacteria 189496
83 Ga0070665_100000323 3300005548 Bacteria 73605
84 Ga0068855_100038577 3300005563 Bacteria 5675
85 Ga0070664_100030216 3300005564 Bacteria 4520
86 Ga0068857_100021366 3300005577 Bacteria 5697
87 Ga0068857_100052891 3300005577 Bacteria 3602
88 Ga0068857_100059311 3300005577 Bacteria 3399
89 Ga0068857_100160717 3300005577 Bacteria 2038
90 Ga0068854_100007481 3300005578 Bacteria 6978
91 Ga0068854_100068110 3300005578 Bacteria 2595
92 Ga0068854_100069920 3300005578 Bacteria 2564
93 Ga0068856_100019563 3300005614 Bacteria 6573
94 Ga0068856_100020542 3300005614 Bacteria 6414
95 Ga0068852_100002009 3300005616 Bacteria 13859
96 Ga0068859_100003505 3300005617 Bacteria 15985
97 Ga0068864_100000004 3300005618 Bacteria 489341
98 Ga0068864_100000005 3300005618 Bacteria 400840
99 Ga0068861_100000001 3300005719 Bacteria 116118
100 Ga0068861_100014274 3300005719 Bacteria 5574
101 Ga0068861_100020681 3300005719 Bacteria 4718
102 Ga0068851_10040267 3300005834 Bacteria 2348
103 Ga0068863_100000001 3300005841 Bacteria 581116
104 Ga0068863_100000002 3300005841 Bacteria 489510
105 Ga0068863_100000013 3300005841 Bacteria 220357
106 Ga0068863_100000093 3300005841 Bacteria 96862
107 Ga0068863_100002259 3300005841 Bacteria 19135
108 Ga0068863_100080823 3300005841 Bacteria 3079
109 Ga0068858_100025268 3300005842 Bacteria 5527
110 Ga0068860_100000009 3300005843 Bacteria 372089
111 Ga0068860_100000036 3300005843 Bacteria 234917
112 Ga0068860_100000148 3300005843 Bacteria 113661
113 Ga0068862_100000001 3300005844 Bacteria 523031
114 Ga0068862_100000002 3300005844 Bacteria 489341
115 Ga0068862_100000209 3300005844 Bacteria 65440
116 Ga0068862_100086776 3300005844 Bacteria 2721
117 Ga0081455_10000255 3300005937 Bacteria 69927
118 Ga0075368_10003525 3300006042 Bacteria 5239
119 Ga0075363_100005439 3300006048 Bacteria 5665
120 Ga0075367_10000099 3300006178 Bacteria 24259
121 Ga0068871_100130490 3300006358 Bacteria 2131
122 Ga0097620_100003505 3300006931 Bacteria 15985
123 Ga0097620_100010259 3300006931 Bacteria 9429
124 Ga0105251_10001284 3300009011 Bacteria 21706
125 Ga0105240_10000959 3300009093 Bacteria 51453
126 Ga0105240_10005945 3300009093 Bacteria 18059
127 Ga0105240_10239896 3300009093 Bacteria 2102
128 Ga0105240_10270667 3300009093 Bacteria 1956
129 Ga0105247_10008068 3300009101 Bacteria 6434
130 Ga0114129_10336874 3300009147 Bacteria 2002
131 Ga0105243_10107691 3300009148 Bacteria 2325
132 Ga0105248_10000010 3300009177 Bacteria 344314
133 Ga0105248_10001558 3300009177 Bacteria 25511
134 Ga0105248_10001758 3300009177 Bacteria 24108
135 Ga0105237_10048537 3300009545 Bacteria 4268
136 Ga0105237_10059493 3300009545 Bacteria 3822
137 Ga0105249_10000006 3300009553 Bacteria 354449
138 Ga0105249_10000041 3300009553 Bacteria 195999
139 Ga0105249_10036895 3300009553 Bacteria 4435
140 Ga0105239_10000156 3300010375 Bacteria 98400
141 Ga0105246_10000348 3300011119 Bacteria 24737
142 Ga0157373_10058315 3300013100 Bacteria 2737
143 Ga0157373_10117885 3300013100 Bacteria 1866
144 Ga0157371_10001066 3300013102 Bacteria 29941
145 Ga0157371_10024110 3300013102 Bacteria 4444
146 Ga0157371_10065408 3300013102 Bacteria 2575
147 Ga0157370_10025717 3300013104 Bacteria 5825
148 Ga0157370_10043180 3300013104 Bacteria 4340
149 Ga0157370_10057965 3300013104 Bacteria 3681
150 Ga0157369_10000239 3300013105 Bacteria 76144
151 Ga0157369_10011078 3300013105 Bacteria 10258
152 Ga0157369_10031578 3300013105 Bacteria 5831
153 Ga0157369_10052031 3300013105 Bacteria 4431
154 Ga0157369_10055073 3300013105 Bacteria 4294
155 Ga0157374_10055242 3300013296 Bacteria 3705
156 Ga0157372_10032771 3300013307 Bacteria 5701
157 Ga0157372_10071451 3300013307 Bacteria 3908
158 Ga0157375_10155315 3300013308 Bacteria 2427
159 Ga0157380_10000029 3300014326 Bacteria 98248
160 Ga0157380_10000182 3300014326 Bacteria 36263
161 Ga0157380_10001161 3300014326 Bacteria 17056
162 Ga0163161_10000101 3300017792 Bacteria 81604
163 Ga0163161_10030181 3300017792 Bacteria 3856
164 Ga0163161_10116653 3300017792 Bacteria 2002
165 Ga0213875_10009905 3300021388 Bacteria 4804
166 Ga0207672_1000388 3300025223 Bacteria 5719
167 Ga0209437_103614 3300025233 Bacteria 2776
168 Ga0207425_1000041 3300025245 Bacteria 210441
169 Ga0209129_1004489 3300025258 Bacteria 5421
170 Ga0209233_1000104 3300025261 Bacteria 272675
171 Ga0209565_1000008 3300025263 Bacteria 774179
172 Ga0209565_1000134 3300025263 Bacteria 104013
173 Ga0209675_1000424 3300025291 Bacteria 34090
174 Ga0209676_1000081 3300025292 Bacteria 285297
175 Ga0209676_1000226 3300025292 Bacteria 124004
176 Ga0209676_1000359 3300025292 Bacteria 86410
177 Ga0209676_1003684 3300025292 Bacteria 9169
178 Ga0209676_1024855 3300025292 Bacteria 1930
179 Ga0209025_1000068 3300025294 Bacteria 294129
180 Ga0209025_1027288 3300025294 Bacteria 2835
181 Ga0209564_1000622 3300025295 Bacteria 53970
182 Ga0209564_1018804 3300025295 Bacteria 2613
183 Ga0209758_1000004 3300025297 Bacteria 1375322
184 Ga0209050_1000001 3300025298 Bacteria 3563507
185 Ga0209050_1000067 3300025298 Bacteria 304206
186 Ga0209050_1000581 3300025298 Bacteria 59224
187 Ga0209050_1012694 3300025298 Bacteria 3833
188 Ga0209256_1000009 3300025299 Bacteria 922071
189 Ga0209256_1000010 3300025299 Bacteria 912110
190 Ga0209051_1000191 3300025303 Bacteria 108763
191 Ga0209257_1000392 3300025304 Bacteria 87104
192 Ga0209257_1000577 3300025304 Bacteria 61710
193 Ga0209257_1000597 3300025304 Bacteria 59900
194 Ga0209257_1000699 3300025304 Bacteria 51960
195 Ga0209257_1000876 3300025304 Bacteria 42634
196 Ga0209257_1002353 3300025304 Bacteria 19010
197 Ga0209257_1002961 3300025304 Bacteria 15554
198 Ga0207656_10004487 3300025321 Bacteria 4880
199 Ga0207713_1001586 3300025735 Bacteria 17804
200 Ga0207710_10017040 3300025900 Bacteria 3078
201 Ga0207680_10000010 3300025903 Bacteria 414170
202 Ga0207647_10000038 3300025904 Bacteria 94897
203 Ga0207705_10000003 3300025909 Bacteria 709270
204 Ga0207705_10000686 3300025909 Bacteria 28058
205 Ga0207705_10095894 3300025909 Bacteria 2177
206 Ga0207707_10088449 3300025912 Bacteria 2706
207 Ga0207695_10000521 3300025913 Bacteria 81496
208 Ga0207695_10001183 3300025913 Bacteria 45024
209 Ga0207695_10002949 3300025913 Bacteria 24555
210 Ga0207695_10027274 3300025913 Bacteria 6363
211 Ga0207695_10034072 3300025913 Bacteria 5545
212 Ga0207695_10142075 3300025913 Bacteria 2348
213 Ga0207671_10001192 3300025914 Bacteria 30866
214 Ga0207660_10102636 3300025917 Bacteria 2138
215 Ga0207657_10005993 3300025919 Bacteria 12650
216 Ga0207657_10101930 3300025919 Bacteria 2381
217 Ga0207649_10000791 3300025920 Bacteria 20385
218 Ga0207649_10005734 3300025920 Bacteria 6722
219 Ga0207652_10071800 3300025921 Bacteria 3009
220 Ga0207681_10000005 3300025923 Bacteria 555724
221 Ga0207681_10000183 3300025923 Bacteria 51105
222 Ga0207681_10042516 3300025923 Bacteria 3036
223 Ga0207694_10002087 3300025924 Bacteria 16502
224 Ga0207694_10068861 3300025924 Bacteria 2764
225 Ga0207650_10000004 3300025925 Bacteria 743372
226 Ga0207650_10000083 3300025925 Bacteria 127270
227 Ga0207650_10006404 3300025925 Bacteria 8018
228 Ga0207659_10031315 3300025926 Bacteria 3640
229 Ga0207644_10000025 3300025931 Bacteria 152401
230 Ga0207644_10000067 3300025931 Bacteria 76116
231 Ga0207644_10001857 3300025931 Bacteria 13746
232 Ga0207690_10013573 3300025932 Bacteria 4897
233 Ga0207706_10004487 3300025933 Bacteria 13106
234 Ga0207706_10009042 3300025933 Bacteria 9165
235 Ga0207706_10051503 3300025933 Bacteria 3635
236 Ga0207706_10083285 3300025933 Bacteria 2812
237 Ga0207670_10038819 3300025936 Bacteria 3113
238 Ga0207669_10000341 3300025937 Bacteria 21234
239 Ga0207711_10000035 3300025941 Bacteria 177223
240 Ga0207711_10000075 3300025941 Bacteria 106870
241 Ga0207711_10000852 3300025941 Bacteria 29486
242 Ga0207711_10023479 3300025941 Bacteria 5163
243 Ga0207679_10052103 3300025945 Bacteria 3000
244 Ga0207667_10011748 3300025949 Bacteria 10154
245 Ga0207667_10011755 3300025949 Bacteria 10151
246 Ga0207712_10000014 3300025961 Bacteria 375393
247 Ga0207712_10000620 3300025961 Bacteria 28034
248 Ga0207712_10021227 3300025961 Bacteria 4261
249 Ga0207712_10155058 3300025961 Bacteria 1773
250 Ga0207668_10000066 3300025972 Bacteria 84452
251 Ga0207668_10000081 3300025972 Bacteria 72145
252 Ga0207668_10000207 3300025972 Bacteria 39613
253 Ga0207668_10000632 3300025972 Bacteria 21688
254 Ga0207668_10003532 3300025972 Bacteria 9188
255 Ga0207668_10035832 3300025972 Bacteria 3308
256 Ga0207640_10000322 3300025981 Bacteria 32021
257 Ga0207640_10005185 3300025981 Bacteria 7087
258 Ga0207640_10116586 3300025981 Bacteria 1904
259 Ga0207658_10000002 3300025986 Bacteria 1364188
260 Ga0207658_10000069 3300025986 Bacteria 113687
261 Ga0207658_10000388 3300025986 Bacteria 42759
262 Ga0207658_10008782 3300025986 Bacteria 6860
263 Ga0207658_10126112 3300025986 Bacteria 2049
264 Ga0207703_10005351 3300026035 Bacteria 10337
265 Ga0207703_10055115 3300026035 Bacteria 3234
266 Ga0207639_10000213 3300026041 Bacteria 43227
267 Ga0207639_10012302 3300026041 Bacteria 5959
268 Ga0207639_10016174 3300026041 Bacteria 5271
269 Ga0207639_10036303 3300026041 Bacteria 3651
270 Ga0207678_10000857 3300026067 Bacteria 27922
271 Ga0207678_10081500 3300026067 Bacteria 2770
272 Ga0207678_10126348 3300026067 Bacteria 2181
273 Ga0207702_10000887 3300026078 Bacteria 31141
274 Ga0207702_10003360 3300026078 Bacteria 14672
275 Ga0207702_10019109 3300026078 Bacteria 5670
276 Ga0207702_10028147 3300026078 Bacteria 4669
277 Ga0207641_10000001 3300026088 Bacteria 1180841
278 Ga0207641_10000002 3300026088 Bacteria 981004
279 Ga0207641_10000029 3300026088 Bacteria 229383
280 Ga0207641_10000099 3300026088 Bacteria 122892
281 Ga0207641_10003319 3300026088 Bacteria 14317
282 Ga0207641_10004490 3300026088 Bacteria 12070
283 Ga0207641_10004505 3300026088 Bacteria 12048
284 Ga0207641_10007449 3300026088 Bacteria 9105
285 Ga0207641_10013693 3300026088 Bacteria 6656
286 Ga0207676_10000005 3300026095 Bacteria 698744
287 Ga0207676_10000006 3300026095 Bacteria 681936
288 Ga0207676_10004057 3300026095 Bacteria 10327
289 Ga0207674_10099190 3300026116 Bacteria 2895
290 Ga0207674_10183384 3300026116 Bacteria 2044
291 Ga0207674_10232733 3300026116 Bacteria 1790
292 Ga0207675_100000159 3300026118 Bacteria 59714
293 Ga0207675_100001138 3300026118 Bacteria 26336
294 Ga0207675_100001918 3300026118 Bacteria 20742
295 Ga0207698_10001007 3300026142 Bacteria 16393
296 Ga0207698_10018132 3300026142 Bacteria 4790
297 Ga0209813_10000051 3300027866 Bacteria 47545
298 Ga0268266_10000002 3300028379 Bacteria 3059047
299 Ga0268266_10000009 3300028379 Bacteria 1097737
300 Ga0268266_10000103 3300028379 Bacteria 179736
301 Ga0268265_10000001 3300028380 Bacteria 1230727
302 Ga0268265_10000003 3300028380 Bacteria 949201
303 Ga0268265_10000047 3300028380 Bacteria 179354
304 Ga0268265_10004726 3300028380 Bacteria 9397
305 Ga0268265_10064228 3300028380 Bacteria 2827
306 Ga0268264_10000001 3300028381 Bacteria 1221000
307 Ga0268264_10000023 3300028381 Bacteria 471408
308 Ga0268264_10000217 3300028381 Bacteria 113674
309 Ga0268264_10020628 3300028381 Bacteria 5383
310 Ga0307517_10122471 3300028786 Bacteria 1915
311 Ga0307513_10090649 3300031456 Bacteria 3117
312 Ga0307508_10000231 3300031616 Bacteria 67806
313 Ga0316575_10000031 3300031665 Bacteria 34008
314 Ga0307412_10000306 3300031911 Bacteria 30998
315 Ga0307412_10043907 3300031911 Bacteria 2914
316 Ga0307412_10128431 3300031911 Bacteria 1837
317 Ga0307416_100013673 3300032002 Bacteria 5526
318 Ga0307414_10000107 3300032004 Bacteria 58717
319 Ga0307414_10001551 3300032004 Bacteria 11939
320 Ga0307414_10144870 3300032004 Bacteria 1865
321 Ga0307411_10098607 3300032005 Bacteria 2060
322 Ga0395900_0004316 3300037418 Bacteria 15070
323 Ga0395900_0093280 3300037418 Bacteria 3093
324 Ga0395900_0126827 3300037418 Bacteria 2617
325 Ga0395898_0003945 3300037466 Bacteria 16365
326 Ga0395898_0112185 3300037466 Bacteria 2613
327 Ga0436364_1037353 3300037853 Bacteria 2350
328 Ga0395901_0003484 3300038443 Bacteria 15855
329 Ga0439461_0000869 3300041410 Bacteria 4466
330 Ga0439465_0014629 3300041413 Bacteria 2446
331 Ga0439431_0001353 3300041997 Bacteria 5407
332 Ga0439445_0007310 3300042004 Bacteria 2559
333 Ga0439432_008143 3300042006 Bacteria 3689
334 Ga0439434_0001561 3300042435 Bacteria 6606
335 Ga0466966_0000039 3300044684 Bacteria 97202
336 Ga0466961_0066707 3300044693 Bacteria 2285
337 Ga0466963_0015989 3300044694 Bacteria 4658
338 Ga0466971_0020302 3300044719 Bacteria 2953
339 Ga0466970_0020776 3300044765 Bacteria 3415
340 Ga0466957_0004188 3300044842 Bacteria 7994
341 Ga0466959_0080091 3300045049 Bacteria 2354
342 Ga0451576_0000122 3300045051 Bacteria 197797
343 Ga0466958_0000524 3300045836 Bacteria 16183
344 Ga0495627_000156 3300046453 Bacteria 78784
345 Ga0495627_000578 3300046453 Bacteria 29484
346 Ga0495638_0000051 3300046460 Bacteria 206003
347 Ga0495650_0000440 3300046471 Bacteria 66809
348 Ga0495583_0000498 3300046506 Bacteria 56923
349 Ga0495583_0000680 3300046506 Bacteria 44152
350 Ga0495610_0000291 3300046512 Bacteria 52599
351 Ga0495616_0001456 3300046513 Bacteria 16481
352 Ga0495632_0000006 3300046519 Bacteria 345883
353 Ga0495632_0000511 3300046519 Bacteria 36529
354 Ga0495637_0000784 3300046520 Bacteria 21358
355 Ga0495637_0010852 3300046520 Bacteria 4391
356 Ga0495643_0000021 3300046522 Bacteria 293465
357 Ga0495648_0000032 3300046524 Bacteria 205970
358 Ga0495648_0000459 3300046524 Bacteria 44196
359 Ga0495648_0010683 3300046524 Bacteria 6974
360 Ga0495648_0042230 3300046524 Bacteria 2871
361 Ga0495663_0000008 3300046525 Bacteria 260614
362 Ga0495663_0003362 3300046525 Bacteria 4626
363 Ga0495654_0025872 3300046530 Bacteria 3022
364 Ga0495597_0012521 3300046542 Bacteria 4092
365 Ga0495633_0000190 3300046558 Bacteria 79967
366 Ga0495633_0002635 3300046558 Bacteria 12531
367 Ga0495633_0024761 3300046558 Bacteria 2962
368 Ga0495668_0000002 3300046616 Bacteria 763179
369 Ga0495668_0023455 3300046616 Bacteria 3518
370 Ga0495611_0023270 3300046648 Bacteria 2687
371 Ga0495625_0000853 3300046660 Bacteria 41514
372 Ga0495625_0034464 3300046660 Bacteria 3736
373 Ga0495625_0038886 3300046660 Bacteria 3478
374 Ga0495671_0000017 3300046692 Bacteria 293465
375 Ga0495671_0000020 3300046692 Bacteria 268306
376 Ga0495683_0006914 3300047323 Bacteria 6164
377 Ga0495687_000563 3300047443 Bacteria 43682
378 Ga0495673_0000076 3300047469 Bacteria 205985
379 Ga0495681_0000098 3300047470 Bacteria 75809
380 Ga0495681_0008268 3300047470 Bacteria 6539
381 Ga0495686_0001323 3300047472 Bacteria 27753
382 Ga0495686_0008463 3300047472 Bacteria 7546
383 Ga0495686_0016175 3300047472 Bacteria 5067
384 Ga0496101_0061617 3300048904 Bacteria 2725
385 Ga0496102_0048987 3300048905 Bacteria 3842
386 Ga0496102_0294965 3300048905 Bacteria 1528
387 Ga0496108_0000682 3300048911 Bacteria 26248
388 Ga0496115_0001129 3300048918 Bacteria 19266
389 Ga0496116_0021417 3300048919 Bacteria 4878
390 Ga0496117_0003631 3300048920 Bacteria 17769
391 Ga0496118_0000162 3300048921 Bacteria 119635
392 Ga0496118_0000463 3300048921 Bacteria 67382
393 Ga0496118_0041350 3300048921 Bacteria 3650
394 Ga0496120_0030374 3300048923 Bacteria 3286
395 Ga0496121_0000296 3300048924 Bacteria 103215
396 Ga0496121_0003051 3300048924 Bacteria 24286
397 Ga0496121_0004153 3300048924 Bacteria 19798
398 Ga0496121_0006913 3300048924 Bacteria 13836
399 Ga0496122_0003556 3300048925 Bacteria 20365
400 Ga0496122_0008730 3300048925 Bacteria 10847
401 Ga0496122_0039577 3300048925 Bacteria 3758
402 Ga0496123_0006936 3300048926 Bacteria 10822
403 Ga0496123_0016815 3300048926 Bacteria 5914
404 Ga0496123_0049602 3300048926 Bacteria 2813
405 Ga0496124_0000874 3300048927 Bacteria 49185
406 Ga0496124_0005852 3300048927 Bacteria 13640
407 Ga0496124_0023873 3300048927 Bacteria 5571
408 Ga0496124_0069413 3300048927 Bacteria 2926
409 Ga0496125_0159444 3300048928 Bacteria 1535
410 Ga0496126_0004477 3300048929 Bacteria 16680
411 Ga0495678_014836 3300049459 Bacteria 3610
412 Ga0501290_000237 3300049513 Bacteria 9135
413 Ga0501292_000042 3300049515 Bacteria 29474
414 Ga0501294_000032 3300049517 Bacteria 13769
415 Ga0501300_000392 3300049523 Bacteria 6689
416 Ga0501033_0062148 3300049570 Bacteria 2750
417 Ga0501034_0015035 3300049571 Bacteria 7959
418 Ga0501036_0016173 3300049572 Bacteria 6231
419 Ga0501037_0024382 3300049573 Bacteria 4474
420 Ga0501038_0059946 3300049574 Bacteria 3258
421 Ga0501043_0040198 3300049579 Bacteria 3676
422 Ga0501047_0000731 3300049581 Bacteria 34159
423 Ga0501202_004785 3300049652 Bacteria 2379
424 Ga0501206_004338 3300049653 Bacteria 1802
425 Ga0501207_003635 3300049654 Bacteria 2063
426 Ga0501211_000103 3300049658 Bacteria 6327
427 Ga0501222_004369 3300049662 Bacteria 1918
428 Ga0501223_000039 3300049663 Bacteria 45537
429 Ga0501224_000307 3300049664 Bacteria 5682
430 Ga0501227_001503 3300049665 Bacteria 5201
431 Ga0501233_003453 3300049668 Bacteria 2841
432 Ga0501235_001097 3300049669 Bacteria 5663
433 Ga0501249_000213 3300049679 Bacteria 17777
434 Ga0501257_013485 3300049686 Bacteria 1874
435 Ga0501261_000021 3300049690 Bacteria 37511
436 Ga0501225_0000010 3300049705 Bacteria 82395
437 Ga0501225_0002702 3300049705 Bacteria 5447
438 Ga0501225_0004968 3300049705 Bacteria 3928
439 Ga0501279_000010 3300049775 Bacteria 103375
440 Ga0501280_000064 3300049776 Bacteria 31054
441 Ga0501281_00086 3300049777 Bacteria 10989
442 Ga0501282_000404 3300049778 Bacteria 5157
443 Ga0501035_0018213 3300049822 Bacteria 6468
444 Ga0501044_0119349 3300049823 Bacteria 2639
445 nmdc:mga06z11_17_c1 3300050494 Bacteria 79602
446 nmdc:mga04h51_146_c1 3300050495 Bacteria 20585
447 Ga0500643_000004 3300053087 Bacteria 857484
448 Ga0500643_000135 3300053087 Bacteria 74911
449 Ga0500643_000195 3300053087 Bacteria 57960
450 Ga0500643_000644 3300053087 Bacteria 23511
451 Ga0500643_000783 3300053087 Bacteria 20603
452 Ga0500643_001242 3300053087 Bacteria 15099
453 Ga0500643_001994 3300053087 Bacteria 11035
454 Ga0500643_003224 3300053087 Bacteria 7943
455 Ga0500643_004770 3300053087 Bacteria 6009
456 Ga0500643_008402 3300053087 Bacteria 4060
457 Ga0500566_0006685 3300053094 Bacteria 6826
458 Ga0500592_000031 3300053116 Bacteria 47686
459 Ga0500592_002102 3300053116 Bacteria 3208
460 Ga0500594_0000698 3300053118 Bacteria 7181
461 Ga0500595_001506 3300053119 Bacteria 12379
462 Ga0500655_000251 3300053133 Bacteria 12576
463 Ga0500658_0006467 3300053134 Bacteria 4345
464 Ga0500559_0003794 3300053136 Bacteria 7323
465 Ga0500568_0003157 3300053139 Bacteria 9385
466 Ga0500573_0000086 3300053140 Bacteria 42361
467 Ga0500590_000131 3300053148 Bacteria 20923
468 Ga0500616_0033520 3300053153 Bacteria 2802
469 Ga0500622_0025695 3300053156 Bacteria 3111
470 Ga0500627_0000017 3300053158 Bacteria 119507
471 Ga0500627_0001223 3300053158 Bacteria 7068
472 Ga0500636_0027233 3300053177 Bacteria 3376
473 Ga0500570_004079 3300053724 Bacteria 7637
474 Ga0500661_000092 3300055283 Bacteria 14368
475 2512645204 2512564014 Bacteria 4639632
476 2585262263 2582581305 Bacteria 4895574
477 2600202833 2599185354 Bacteria 4398675
478 2600225497 2599185359 Bacteria 4772316
479 2643729754 2643221541 Bacteria 5498788
480 2643731594 2643221541 Bacteria 5498788
481 2643820706 2643221560 Bacteria 4801179
482 2643833140 2643221563 Bacteria 4726935
483 2644036771 2643221605 Bacteria 4772303
484 2644042078 2643221606 Bacteria 5588032
485 2644044114 2643221606 Bacteria 5588032
486 2644053065 2643221608 Bacteria 4724829
487 2644126033 2643221622 Bacteria 4212502
488 2644392582 2643221671 Bacteria 5496681
489 2644394279 2643221671 Bacteria 5496681
490 2753767183 2751185897 Bacteria 5322941
491 2778125111 2775507255 Bacteria 3945731
492 2809063042 2808606401 Bacteria 4586670
493 2809079006 2808606404 Bacteria 4652788
494 2809083619 2808606405 Bacteria 4586632
495 2819713940 2818991466 Bacteria 4748179
496 2852656192 2852653556 Bacteria 4050083
497 2852682525 2852680915 Bacteria 4100189
498 2879165172 2879163058 Bacteria 4223965
499 2880520297 2880518877 Bacteria 5012590
500 2880521218 2880518877 Bacteria 5012590
501 2885429809 2885429604 Bacteria 3642894
502 2896254680 2896253425 Bacteria 3418029
503 2919713326 2919709256 Bacteria 4318106
504 2928528502 2928526807 Bacteria 4760224
505 2928970047 2928968154 Bacteria 4633371
506 8057101251 8057101203 Bacteria 5034064
507 Ga0068859_100010259
508 SwRhRL2b_contig_453878
509 JGI24736J21556_1000032
510 JGI24736J21556_1000613
511 JGI24736J21556_1005999
512 JGI24741J21665_1000366
513 JGI24752J21851_1000082
514 JGI24740J21852_10005104
515 JGI24740J21852_10005188
516 JGI24739J22299_10005319
517 JGI24739J22299_10007626
518 JGI24737J22298_10001306
519 JGI24735J21928_10001114
520 JGI24735J21928_10004932
521 JGI24748J21848_1000036
522 JGI24738J21930_10000231
523 JGI24749J21850_1000049
524 JGI24034J26672_10000008
525 JGI24034J26672_10000038
526 JGI24751J29686_10000216
527 JGI25150J39212_1001984
528 JGI25165J46597_1000041
529 JGI25153J46596_10000395
530 Ga0055526_1007921
531 Ga0055537_1003939
532 Ga0055524_1000539
533 Ga0055536_1002308
534 Ga0055536_1004688
535 Ga0055530_10000012
536 Ga0055530_10003402
537 Ga0055530_10028081
538 Ga0055540_1002064
539 Ga0055531_10000466
540 Ga0055531_10003730
541 Ga0055531_10004059
542 Ga0055531_10006558
543 Ga0065165_1005379
544 Ga0065165_1018890
545 Ga0065704_10001612
546 Ga0065704_10116929
547 Ga0065707_10000505
548 Ga0065707_10084570
549 Ga0070658_10030197
550 Ga0070683_100024933
551 Ga0070690_100000021
552 Ga0070670_100000003
553 Ga0070670_100000021
554 Ga0070670_100002377
555 Ga0070670_100039241
556 Ga0070670_100204945
557 Ga0070666_10000004
558 Ga0070666_10005044
559 Ga0070660_100032343
560 Ga0070689_100056210
561 Ga0070661_100005915
562 Ga0070661_100013974
563 Ga0070661_100033172
564 Ga0070668_100000026
565 Ga0070668_100000047
566 Ga0070668_100000925
567 Ga0070668_100020174
568 Ga0070668_100031691
569 Ga0070669_100000020
570 Ga0070669_100004471
571 Ga0070671_100000470
572 Ga0070671_100019303
573 Ga0070671_100027553
574 Ga0070688_100022724
575 Ga0070667_100000019
576 Ga0070667_100000089
577 Ga0070667_100000642
578 Ga0070667_100179297
579 Ga0070663_100002941
580 Ga0070663_100013110
581 Ga0070662_100003611
582 Ga0070685_10000724
583 Ga0070679_100004736
584 Ga0070679_100007172
585 Ga0068853_100074332
586 Ga0070686_100000012
587 Ga0070665_100000004
588 Ga0070665_100000075
589 Ga0070665_100000323
590 Ga0068855_100038577
591 Ga0070664_100030216
592 Ga0068857_100021366
593 Ga0068857_100052891
594 Ga0068857_100059311
595 Ga0068857_100160717
596 Ga0068854_100007481
597 Ga0068854_100068110
598 Ga0068854_100069920
599 Ga0068856_100019563
600 Ga0068856_100020542
601 Ga0068852_100002009
602 Ga0068859_100003505
603 Ga0068864_100000004
604 Ga0068864_100000005
605 Ga0068861_100000001
606 Ga0068861_100014274
607 Ga0068861_100020681
608 Ga0068851_10040267
609 Ga0068863_100000001
610 Ga0068863_100000002
611 Ga0068863_100000013
612 Ga0068863_100000093
613 Ga0068863_100002259
614 Ga0068863_100080823
615 Ga0068858_100025268
616 Ga0068860_100000009
617 Ga0068860_100000036
618 Ga0068860_100000148
619 Ga0068862_100000001
620 Ga0068862_100000002
621 Ga0068862_100000209
622 Ga0068862_100086776
623 Ga0081455_10000255
624 Ga0075368_10003525
625 Ga0075363_100005439
626 Ga0075367_10000099
627 Ga0068871_100130490
628 Ga0097620_100003505
629 Ga0097620_100010259
630 Ga0105251_10001284
631 Ga0105240_10000959
632 Ga0105240_10005945
633 Ga0105240_10239896
634 Ga0105240_10270667
635 Ga0105247_10008068
636 Ga0114129_10336874
637 Ga0105243_10107691
638 Ga0105248_10000010
639 Ga0105248_10001558
640 Ga0105248_10001758
641 Ga0105237_10048537
642 Ga0105237_10059493
643 Ga0105249_10000006
644 Ga0105249_10000041
645 Ga0105249_10036895
646 Ga0105239_10000156
647 Ga0105246_10000348
648 Ga0157373_10058315
649 Ga0157373_10117885
650 Ga0157371_10001066
651 Ga0157371_10024110
652 Ga0157371_10065408
653 Ga0157370_10025717
654 Ga0157370_10043180
655 Ga0157370_10057965
656 Ga0157369_10000239
657 Ga0157369_10011078
658 Ga0157369_10031578
659 Ga0157369_10052031
660 Ga0157369_10055073
661 Ga0157374_10055242
662 Ga0157372_10032771
663 Ga0157372_10071451
664 Ga0157375_10155315
665 Ga0157380_10000029
666 Ga0157380_10000182
667 Ga0157380_10001161
668 Ga0163161_10000101
669 Ga0163161_10030181
670 Ga0163161_10116653
671 Ga0213875_10009905
672 Ga0207672_1000388
673 Ga0209437_103614
674 Ga0207425_1000041
675 Ga0209129_1004489
676 Ga0209233_1000104
677 Ga0209565_1000008
678 Ga0209565_1000134
679 Ga0209675_1000424
680 Ga0209676_1000081
681 Ga0209676_1000226
682 Ga0209676_1000359
683 Ga0209676_1003684
684 Ga0209676_1024855
685 Ga0209025_1000068
686 Ga0209025_1027288
687 Ga0209564_1000622
688 Ga0209564_1018804
689 Ga0209758_1000004
690 Ga0209050_1000001
691 Ga0209050_1000067
692 Ga0209050_1000581
693 Ga0209050_1012694
694 Ga0209256_1000009
695 Ga0209256_1000010
696 Ga0209051_1000191
697 Ga0209257_1000392
698 Ga0209257_1000577
699 Ga0209257_1000597
700 Ga0209257_1000699
701 Ga0209257_1000876
702 Ga0209257_1002353
703 Ga0209257_1002961
704 Ga0207656_10004487
705 Ga0207713_1001586
706 Ga0207710_10017040
707 Ga0207680_10000010
708 Ga0207647_10000038
709 Ga0207705_10000003
710 Ga0207705_10000686
711 Ga0207705_10095894
712 Ga0207707_10088449
713 Ga0207695_10000521
714 Ga0207695_10001183
715 Ga0207695_10002949
716 Ga0207695_10027274
717 Ga0207695_10034072
718 Ga0207695_10142075
719 Ga0207671_10001192
720 Ga0207660_10102636
721 Ga0207657_10005993
722 Ga0207657_10101930
723 Ga0207649_10000791
724 Ga0207649_10005734
725 Ga0207652_10071800
726 Ga0207681_10000005
727 Ga0207681_10000183
728 Ga0207681_10042516
729 Ga0207694_10002087
730 Ga0207694_10068861
731 Ga0207650_10000004
732 Ga0207650_10000083
733 Ga0207650_10006404
734 Ga0207659_10031315
735 Ga0207644_10000025
736 Ga0207644_10000067
737 Ga0207644_10001857
738 Ga0207690_10013573
739 Ga0207706_10004487
740 Ga0207706_10009042
741 Ga0207706_10051503
742 Ga0207706_10083285
743 Ga0207670_10038819
744 Ga0207669_10000341
745 Ga0207711_10000035
746 Ga0207711_10000075
747 Ga0207711_10000852
748 Ga0207711_10023479
749 Ga0207679_10052103
750 Ga0207667_10011748
751 Ga0207667_10011755
752 Ga0207712_10000014
753 Ga0207712_10000620
754 Ga0207712_10021227
755 Ga0207712_10155058
756 Ga0207668_10000066
757 Ga0207668_10000081
758 Ga0207668_10000207
759 Ga0207668_10000632
760 Ga0207668_10003532
761 Ga0207668_10035832
762 Ga0207640_10000322
763 Ga0207640_10005185
764 Ga0207640_10116586
765 Ga0207658_10000002
766 Ga0207658_10000069
767 Ga0207658_10000388
768 Ga0207658_10008782
769 Ga0207658_10126112
770 Ga0207703_10005351
771 Ga0207703_10055115
772 Ga0207639_10000213
773 Ga0207639_10012302
774 Ga0207639_10016174
775 Ga0207639_10036303
776 Ga0207678_10000857
777 Ga0207678_10081500
778 Ga0207678_10126348
779 Ga0207702_10000887
780 Ga0207702_10003360
781 Ga0207702_10019109
782 Ga0207702_10028147
783 Ga0207641_10000001
784 Ga0207641_10000002
785 Ga0207641_10000029
786 Ga0207641_10000099
787 Ga0207641_10003319
788 Ga0207641_10004490
789 Ga0207641_10004505
790 Ga0207641_10007449
791 Ga0207641_10013693
792 Ga0207676_10000005
793 Ga0207676_10000006
794 Ga0207676_10004057
795 Ga0207674_10099190
796 Ga0207674_10183384
797 Ga0207674_10232733
798 Ga0207675_100000159
799 Ga0207675_100001138
800 Ga0207675_100001918
801 Ga0207698_10001007
802 Ga0207698_10018132
803 Ga0209813_10000051
804 Ga0268266_10000002
805 Ga0268266_10000009
806 Ga0268266_10000103
807 Ga0268265_10000001
808 Ga0268265_10000003
809 Ga0268265_10000047
810 Ga0268265_10004726
811 Ga0268265_10064228
812 Ga0268264_10000001
813 Ga0268264_10000023
814 Ga0268264_10000217
815 Ga0268264_10020628
816 Ga0307517_10122471
817 Ga0307513_10090649
818 Ga0307508_10000231
819 Ga0316575_10000031
820 Ga0307412_10000306
821 Ga0307412_10043907
822 Ga0307412_10128431
823 Ga0307416_100013673
824 Ga0307414_10000107
825 Ga0307414_10001551
826 Ga0307414_10144870
827 Ga0307411_10098607
828 Ga0395900_0004316
829 Ga0395900_0093280
830 Ga0395900_0126827
831 Ga0395898_0003945
832 Ga0395898_0112185
833 Ga0436364_1037353
834 Ga0395901_0003484
835 Ga0439461_0000869
836 Ga0439465_0014629
837 Ga0439431_0001353
838 Ga0439445_0007310
839 Ga0439432_008143
840 Ga0439434_0001561
841 Ga0466966_0000039
842 Ga0466961_0066707
843 Ga0466963_0015989
844 Ga0466971_0020302
845 Ga0466970_0020776
846 Ga0466957_0004188
847 Ga0466959_0080091
848 Ga0451576_0000122
849 Ga0466958_0000524
850 Ga0495627_000156
851 Ga0495627_000578
852 Ga0495638_0000051
853 Ga0495650_0000440
854 Ga0495583_0000498
855 Ga0495583_0000680
856 Ga0495610_0000291
857 Ga0495616_0001456
858 Ga0495632_0000006
859 Ga0495632_0000511
860 Ga0495637_0000784
861 Ga0495637_0010852
862 Ga0495643_0000021
863 Ga0495648_0000032
864 Ga0495648_0000459
865 Ga0495648_0010683
866 Ga0495648_0042230
867 Ga0495663_0000008
868 Ga0495663_0003362
869 Ga0495654_0025872
870 Ga0495597_0012521
871 Ga0495633_0000190
872 Ga0495633_0002635
873 Ga0495633_0024761
874 Ga0495668_0000002
875 Ga0495668_0023455
876 Ga0495611_0023270
877 Ga0495625_0000853
878 Ga0495625_0034464
879 Ga0495625_0038886
880 Ga0495671_0000017
881 Ga0495671_0000020
882 Ga0495683_0006914
883 Ga0495687_000563
884 Ga0495673_0000076
885 Ga0495681_0000098
886 Ga0495681_0008268
887 Ga0495686_0001323
888 Ga0495686_0008463
889 Ga0495686_0016175
890 Ga0496101_0061617
891 Ga0496102_0048987
892 Ga0496102_0294965
893 Ga0496108_0000682
894 Ga0496115_0001129
895 Ga0496116_0021417
896 Ga0496117_0003631
897 Ga0496118_0000162
898 Ga0496118_0000463
899 Ga0496118_0041350
900 Ga0496120_0030374
901 Ga0496121_0000296
902 Ga0496121_0003051
903 Ga0496121_0004153
904 Ga0496121_0006913
905 Ga0496122_0003556
906 Ga0496122_0008730
907 Ga0496122_0039577
908 Ga0496123_0006936
909 Ga0496123_0016815
910 Ga0496123_0049602
911 Ga0496124_0000874
912 Ga0496124_0005852
913 Ga0496124_0023873
914 Ga0496124_0069413
915 Ga0496125_0159444
916 Ga0496126_0004477
917 Ga0495678_014836
918 Ga0501290_000237
919 Ga0501292_000042
920 Ga0501294_000032
921 Ga0501300_000392
922 Ga0501033_0062148
923 Ga0501034_0015035
924 Ga0501036_0016173
925 Ga0501037_0024382
926 Ga0501038_0059946
927 Ga0501043_0040198
928 Ga0501047_0000731
929 Ga0501202_004785
930 Ga0501206_004338
931 Ga0501207_003635
932 Ga0501211_000103
933 Ga0501222_004369
934 Ga0501223_000039
935 Ga0501224_000307
936 Ga0501227_001503
937 Ga0501233_003453
938 Ga0501235_001097
939 Ga0501249_000213
940 Ga0501257_013485
941 Ga0501261_000021
942 Ga0501225_0000010
943 Ga0501225_0002702
944 Ga0501225_0004968
945 Ga0501279_000010
946 Ga0501280_000064
947 Ga0501281_00086
948 Ga0501282_000404
949 Ga0501035_0018213
950 Ga0501044_0119349
951 nmdc:mga06z11_17_c1
952 nmdc:mga04h51_146_c1
953 Ga0500643_000004
954 Ga0500643_000135
955 Ga0500643_000195
956 Ga0500643_000644
957 Ga0500643_000783
958 Ga0500643_001242
959 Ga0500643_001994
960 Ga0500643_003224
961 Ga0500643_004770
962 Ga0500643_008402
963 Ga0500566_0006685
964 Ga0500592_000031
965 Ga0500592_002102
966 Ga0500594_0000698
967 Ga0500595_001506
968 Ga0500655_000251
969 Ga0500658_0006467
970 Ga0500559_0003794
971 Ga0500568_0003157
972 Ga0500573_0000086
973 Ga0500590_000131
974 Ga0500616_0033520
975 Ga0500622_0025695
976 Ga0500627_0000017
977 Ga0500627_0001223
978 Ga0500636_0027233
979 Ga0500570_004079
980 Ga0500661_000092
981 2512645204
982 2585262263
983 2600202833
984 2600225497
985 2643729754
986 2643731594
987 2643820706
988 2643833140
989 2644036771
990 2644042078
991 2644044114
992 2644053065
993 2644126033
994 2644392582
995 2644394279
996 2753767183
997 2778125111
998 2809063042
999 2809079006
1000 2809083619
1001 2819713940
1002 2852656192
1003 2852682525
1004 2879165172
1005 2880520297
1006 2880521218
1007 2885429809
1008 2896254680
1009 2919713326
1010 2928528502
1011 2928970047
1012 8057101251

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00330

Aconitase

Aconitase family (aconitate hydratase)

10

460

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kp2-assembly1.cif.gz_B-2 crystal structure of homoaconitase large subunit from methanococcus jannaschii (mj1003) 0.9317 6 469
4kp2-assembly1.cif.gz_B-2 crystal structure of homoaconitase large subunit from methanococcus jannaschii (mj1003) 0.9231 6 469
4kp1-assembly1.cif.gz_A crystal structure of ipm isomerase large subunit from methanococcus jannaschii (mj0499) 0.8807 5 474
1c97-assembly1.cif.gz_A s642a:isocitrate complex of aconitase 0.8778 3 468
4kp1-assembly1.cif.gz_A crystal structure of ipm isomerase large subunit from methanococcus jannaschii (mj0499) 0.8767 5 474
ID Description Score Start End Superfamily
af_P0A6A6_327_466_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9709 335 474 3.30.499.10
af_P0A6A6_327_466_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9574 335 474 3.30.499.10
af_O14289_10_298_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9569 6 294 3.30.499.10
af_O14289_10_298_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9537 6 294 3.30.499.10
af_O14289_312_505_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9431 309 484 3.30.499.10
ID Description Score Start End GO Terms
AF-A0A3D2E7N6-F1-model_v4 deleted 0.9868 1 301
AF-A0A3M0Z7U1-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9868 169 475 GO:0003861
GO:0009098
GO:0046872
GO:0051539
AF-C6HYC0-F1-model_v4 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9862 4 474 GO:0003861
GO:0009098
GO:0046872
GO:0051539
AF-A0A220W962-F1-model_v4 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9858 1 474 GO:0003861
GO:0009098
GO:0046872
GO:0051539
AF-Q3SNV3-F1-model_v4 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9853 1 474 GO:0003861
GO:0009098
GO:0046872
GO:0051539

Map