F456502

General Info

Members Datasets Scaffolds Average Seq Length
506 308 1008 161

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10191276|Ga0075369_101912762
Length 180
Sequence VSQVTTSQVTTSNDSYRFREYSGGCQCGAVRWHATELRDNPHVCYCRMCQKASGNFFADLVGIRHEHLTWTRGKPSEFNSSDVAARGFCRDCGTPLYYRSLGGPHVSMTIGSFDTPHLVPILYEMGLEGRHPSLRPVPGAEQIGTTEEGDGVEAVARVRASNHQHPDHDTDKWVMGGADG

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
77 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
128 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
241 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
255 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
256 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
257 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
258 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
259 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
260 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
261 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
262 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
263 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
264 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
265 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
266 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
267 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
268 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
269 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
270 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
271 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
272 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
273 2643221629 Devosia sp. Root105 Isolate Unclassified
274 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
275 2643221662 Devosia sp. Root413D1 Isolate Unclassified
276 2643221718 Rhizobium sp. Root268 Isolate Unclassified
277 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
278 2718217927 Rhizobium sp. N324 Isolate Nodule
279 2718218423 Rhizobium sp. N941 Isolate Nodule
280 2721755809 Rhizobium sp. N541 Isolate Nodule
281 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
282 2791355267 Rhizobium sp. L18 Isolate Nodule
283 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
284 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
285 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
286 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
287 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
288 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
289 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
290 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
291 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
292 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
293 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
294 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
295 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
296 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
297 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
298 8005275841 Rhizobium sp. N4311 Isolate Nodule
299 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
300 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
301 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
302 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
303 8018176218 Rhizobium sp. N122 Isolate Nodule
304 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
305 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
306 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
307 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
308 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.93
Metatranscriptomes 0
Isolates 11.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.43
Nodule 5.14
Rhizoplane 1.58
Rhizosphere 66.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10191276 3300006186 Bacteria 943
2 JGI25155J39150_1000032 3300002704 Bacteria 105511
3 JGI25156J39149_1000153 3300002705 Bacteria 50769
4 JGI25162J39368_1000442 3300002737 Bacteria 32936
5 JGI25162J39368_1001722 3300002737 Bacteria 10557
6 JGI25154J39366_1000152 3300002738 Bacteria 53779
7 JGI25157J39369_1000061 3300002741 Bacteria 105511
8 JGI25159J45721_1003928 3300002987 Bacteria 5077
9 JGI25165J46597_1000639 3300003214 Bacteria 29032
10 JGI25165J46597_1001009 3300003214 Bacteria 18657
11 JGI25165J46597_1011001 3300003214 Bacteria 1303
12 JGI25165J46597_1015833 3300003214 Bacteria 1014
13 JGI25165J46597_1025441 3300003214 Bacteria 767
14 rootH2_10037901 3300003320 Bacteria 1704
15 rootH2_10044307 3300003320 Bacteria 2391
16 rootH2_10067834 3300003320 Bacteria 1976
17 rootH2_10120970 3300003320 Bacteria 1288
18 rootH1_10050700 3300003323 Bacteria 1860
19 rootH1_10099566 3300003323 Bacteria 2153
20 rootH1_10241800 3300003323 Bacteria 1421
21 JGI25160J50197_1000052 3300003354 Bacteria 127795
22 JGI25161J50226_1000005 3300003374 Bacteria 292548
23 JGI25161J50226_1000113 3300003374 Bacteria 63092
24 Ga0055540_1001764 3300003792 Bacteria 12339
25 Ga0055543_1000035 3300004625 Bacteria 127833
26 Ga0065165_1000253 3300005262 Bacteria 92969
27 Ga0070658_10003333 3300005327 Bacteria 13260
28 Ga0070658_10066909 3300005327 Bacteria 2935
29 Ga0070658_10310195 3300005327 Bacteria 1346
30 Ga0070676_10101375 3300005328 Bacteria 1779
31 Ga0070676_10171423 3300005328 Bacteria 1404
32 Ga0070683_100346380 3300005329 Bacteria 1415
33 Ga0068868_100924641 3300005338 Bacteria 794
34 Ga0070660_100012650 3300005339 Bacteria 6031
35 Ga0070660_100149030 3300005339 Bacteria 1880
36 Ga0070660_100420435 3300005339 Bacteria 1107
37 Ga0070661_100002175 3300005344 Bacteria 13495
38 Ga0070661_100044743 3300005344 Bacteria 3235
39 Ga0070661_100172034 3300005344 Bacteria 1645
40 Ga0070661_100901948 3300005344 Bacteria 730
41 Ga0070668_100342702 3300005347 Bacteria 1263
42 Ga0070674_100013689 3300005356 Bacteria 5020
43 Ga0070674_100147161 3300005356 Bacteria 1774
44 Ga0070674_101642039 3300005356 Bacteria 580
45 Ga0070673_100035107 3300005364 Bacteria 3800
46 Ga0070659_100006686 3300005366 Bacteria 8336
47 Ga0070663_100356172 3300005455 Bacteria 1186
48 Ga0070678_100839209 3300005456 Bacteria 836
49 Ga0070662_100300456 3300005457 Bacteria 1304
50 Ga0068867_100267246 3300005459 Bacteria 1397
51 Ga0070679_100933114 3300005530 Bacteria 812
52 Ga0068853_100000752 3300005539 Bacteria 22475
53 Ga0068853_100003754 3300005539 Bacteria 11652
54 Ga0068853_100049258 3300005539 Bacteria 3620
55 Ga0068853_100138386 3300005539 Bacteria 2184
56 Ga0070672_100148695 3300005543 Bacteria 1937
57 Ga0070672_100551001 3300005543 Bacteria 1001
58 Ga0070686_100005599 3300005544 Bacteria 6959
59 Ga0070665_100426028 3300005548 Bacteria 1336
60 Ga0070665_100755218 3300005548 Bacteria 986
61 Ga0070665_100926658 3300005548 Bacteria 884
62 Ga0068855_100042614 3300005563 Bacteria 5377
63 Ga0068855_100297210 3300005563 Bacteria 1789
64 Ga0068855_100559816 3300005563 Bacteria 1237
65 Ga0070664_100167601 3300005564 Bacteria 1947
66 Ga0070664_101368858 3300005564 Bacteria 669
67 Ga0068857_100117628 3300005577 Bacteria 2392
68 Ga0068857_100259347 3300005577 Bacteria 1595
69 Ga0068857_100340723 3300005577 Bacteria 1387
70 Ga0068857_101299990 3300005577 Bacteria 706
71 Ga0068854_100012747 3300005578 Bacteria 5504
72 Ga0068854_100176163 3300005578 Bacteria 1667
73 Ga0068854_101127644 3300005578 Bacteria 700
74 Ga0068856_100013451 3300005614 Bacteria 7920
75 Ga0068856_100042150 3300005614 Bacteria 4490
76 Ga0068856_100071587 3300005614 Bacteria 3432
77 Ga0068856_100099984 3300005614 Bacteria 2892
78 Ga0068856_100213533 3300005614 Bacteria 1945
79 Ga0068852_100013606 3300005616 Bacteria 6229
80 Ga0068852_100031137 3300005616 Bacteria 4398
81 Ga0068852_100067077 3300005616 Bacteria 3136
82 Ga0068852_100187857 3300005616 Bacteria 1947
83 Ga0068852_100548375 3300005616 Bacteria 1156
84 Ga0068851_10003875 3300005834 Bacteria 6697
85 Ga0068851_10046556 3300005834 Bacteria 2194
86 Ga0068851_10072832 3300005834 Bacteria 1781
87 Ga0068863_100589873 3300005841 Bacteria 1099
88 Ga0081455_10111954 3300005937 Bacteria 2168
89 Ga0081538_10025268 3300005981 Bacteria 4194
90 Ga0075365_10213639 3300006038 Bacteria 1353
91 Ga0075365_10416546 3300006038 Bacteria 948
92 Ga0075368_10008514 3300006042 Bacteria 3656
93 Ga0075368_10041467 3300006042 Bacteria 1808
94 Ga0075363_100133666 3300006048 Bacteria 1393
95 Ga0075364_10050243 3300006051 Bacteria 2722
96 Ga0075367_10036164 3300006178 Bacteria 2862
97 Ga0075367_10042984 3300006178 Bacteria 2646
98 Ga0075367_10222234 3300006178 Bacteria 1182
99 Ga0075369_10151421 3300006186 Bacteria 1061
100 Ga0075369_10223398 3300006186 Bacteria 872
101 Ga0075366_10156478 3300006195 Bacteria 1380
102 Ga0075366_10175758 3300006195 Bacteria 1300
103 Ga0075370_10171222 3300006353 Bacteria 1276
104 Ga0075430_100324334 3300006846 Bacteria 1273
105 Ga0099826_10005187 3300006948 Bacteria 9285
106 Ga0075435_101808863 3300007076 Bacteria 536
107 Ga0105240_10000032 3300009093 Bacteria 283907
108 Ga0105240_10150610 3300009093 Bacteria 2771
109 Ga0105240_10309167 3300009093 Bacteria 1805
110 Ga0105240_12112226 3300009093 Bacteria 585
111 Ga0111539_10866809 3300009094 Bacteria 1050
112 Ga0105245_10600524 3300009098 Bacteria 1127
113 Ga0114129_11589138 3300009147 Bacteria 801
114 Ga0105243_10105644 3300009148 Bacteria 2346
115 Ga0105241_10075358 3300009174 Bacteria 2629
116 Ga0105242_10949197 3300009176 Bacteria 864
117 Ga0105237_10039537 3300009545 Bacteria 4761
118 Ga0105237_10586660 3300009545 Bacteria 1121
119 Ga0105237_11274909 3300009545 Bacteria 741
120 Ga0105238_10096952 3300009551 Bacteria 2935
121 Ga0105238_10135087 3300009551 Bacteria 2444
122 Ga0105028_104029 3300009993 Bacteria 1533
123 Ga0105239_10007520 3300010375 Bacteria 12494
124 Ga0105239_10065377 3300010375 Bacteria 3994
125 Ga0105239_10318554 3300010375 Bacteria 1753
126 Ga0105239_10404281 3300010375 Bacteria 1545
127 Ga0105246_10496654 3300011119 Bacteria 1035
128 Ga0105246_11891084 3300011119 Bacteria 573
129 Ga0157371_10009137 3300013102 Bacteria 7830
130 Ga0157370_10000986 3300013104 Bacteria 35999
131 Ga0157370_11043653 3300013104 Bacteria 739
132 Ga0157369_10311720 3300013105 Bacteria 1636
133 Ga0157369_10353330 3300013105 Bacteria 1526
134 Ga0157369_10389073 3300013105 Bacteria 1447
135 Ga0163162_12149941 3300013306 Bacteria 640
136 Ga0157372_10290413 3300013307 Bacteria 1902
137 Ga0157377_10529365 3300014745 Bacteria 829
138 Ga0182007_10001216 3300015262 Bacteria 13977
139 Ga0182007_10130020 3300015262 Bacteria 846
140 Ga0182005_1007200 3300015265 Bacteria 3352
141 Ga0163161_10997576 3300017792 Bacteria 715
142 Ga0209435_100042 3300025206 Bacteria 105563
143 Ga0209760_109870 3300025207 Bacteria 636
144 Ga0209672_113207 3300025228 Bacteria 998
145 Ga0209437_100033 3300025233 Bacteria 512520
146 Ga0209437_100075 3300025233 Bacteria 297202
147 Ga0209646_1000145 3300025246 Bacteria 105563
148 Ga0209646_1036541 3300025246 Bacteria 636
149 Ga0209026_1000160 3300025250 Bacteria 105563
150 Ga0209677_109167 3300025253 Bacteria 1812
151 Ga0209148_1002908 3300025254 Bacteria 5217
152 Ga0209759_1000177 3300025256 Bacteria 105563
153 Ga0209233_1000056 3300025261 Bacteria 438104
154 Ga0209233_1000064 3300025261 Bacteria 392156
155 Ga0209233_1000209 3300025261 Bacteria 115124
156 Ga0209455_1011152 3300025272 Bacteria 2231
157 Ga0209673_1001371 3300025273 Bacteria 23980
158 Ga0209130_1000018 3300025284 Bacteria 388301
159 Ga0209676_1033493 3300025292 Bacteria 1529
160 Ga0209050_1006882 3300025298 Bacteria 6594
161 Ga0207426_1000044 3300025302 Bacteria 428043
162 Ga0209051_1000514 3300025303 Bacteria 48877
163 Ga0209257_1003433 3300025304 Bacteria 13603
164 Ga0207656_10001464 3300025321 Bacteria 7825
165 Ga0207656_10106089 3300025321 Bacteria 1293
166 Ga0207645_10041069 3300025907 Bacteria 2962
167 Ga0207705_10369218 3300025909 Bacteria 1107
168 Ga0207654_10677641 3300025911 Bacteria 740
169 Ga0207695_10000024 3300025913 Bacteria 632311
170 Ga0207695_10516580 3300025913 Bacteria 1076
171 Ga0207671_10000548 3300025914 Bacteria 50646
172 Ga0207657_10021947 3300025919 Bacteria 5994
173 Ga0207657_10026978 3300025919 Bacteria 5267
174 Ga0207649_10003100 3300025920 Bacteria 9118
175 Ga0207649_10038038 3300025920 Bacteria 2911
176 Ga0207649_10232126 3300025920 Bacteria 1320
177 Ga0207690_10227503 3300025932 Bacteria 1430
178 Ga0207690_10458381 3300025932 Bacteria 1026
179 Ga0207706_10656947 3300025933 Bacteria 898
180 Ga0207670_10851107 3300025936 Bacteria 762
181 Ga0207669_10560577 3300025937 Bacteria 923
182 Ga0207669_11474941 3300025937 Bacteria 580
183 Ga0207704_10121566 3300025938 Bacteria 1788
184 Ga0207704_10575076 3300025938 Bacteria 919
185 Ga0207691_10949539 3300025940 Bacteria 719
186 Ga0207679_11491354 3300025945 Bacteria 620
187 Ga0207667_10585032 3300025949 Bacteria 1126
188 Ga0207667_10966489 3300025949 Bacteria 840
189 Ga0207651_10862448 3300025960 Bacteria 805
190 Ga0207668_10386918 3300025972 Bacteria 1179
191 Ga0207640_10009219 3300025981 Bacteria 5518
192 Ga0207640_10204161 3300025981 Bacteria 1500
193 Ga0207640_10226325 3300025981 Bacteria 1435
194 Ga0207677_10265064 3300026023 Bacteria 1402
195 Ga0207677_11120675 3300026023 Bacteria 718
196 Ga0207639_10000897 3300026041 Bacteria 20194
197 Ga0207639_10005546 3300026041 Bacteria 8532
198 Ga0207639_10175819 3300026041 Bacteria 1817
199 Ga0207678_10090746 3300026067 Bacteria 2611
200 Ga0207702_10047089 3300026078 Bacteria 3632
201 Ga0207702_10367053 3300026078 Bacteria 1381
202 Ga0207641_12038616 3300026088 Bacteria 575
203 Ga0207648_10114266 3300026089 Bacteria 2372
204 Ga0207674_10003842 3300026116 Bacteria 18310
205 Ga0207674_10332972 3300026116 Bacteria 1468
206 Ga0207674_10480731 3300026116 Bacteria 1201
207 Ga0207683_10751736 3300026121 Bacteria 905
208 Ga0207698_10019025 3300026142 Bacteria 4691
209 Ga0207698_10071975 3300026142 Bacteria 2746
210 Ga0207698_10195038 3300026142 Bacteria 1808
211 Ga0209371_1006525 3300027312 Bacteria 4299
212 Ga0209974_10075760 3300027876 Bacteria 1152
213 Ga0268266_10483489 3300028379 Bacteria 1181
214 Ga0268265_11591857 3300028380 Bacteria 658
215 Ga0307515_10035625 3300028794 Bacteria 8086
216 Ga0307515_10117469 3300028794 Bacteria 3044
217 Ga0268256_1022574 3300030500 Bacteria 1647
218 Ga0316181_1269488 3300030744 Bacteria 4214
219 Ga0265328_10095552 3300031239 Bacteria 1099
220 Ga0307513_10188946 3300031456 Bacteria 1914
221 Ga0307516_10129543 3300031730 Bacteria 2304
222 Ga0307405_10464329 3300031731 Bacteria 1007
223 Ga0307410_11714686 3300031852 Bacteria 557
224 Ga0307416_101331781 3300032002 Bacteria 824
225 Ga0307416_102030921 3300032002 Bacteria 677
226 Ga0307414_10017936 3300032004 Bacteria 4342
227 Ga0307414_10871538 3300032004 Bacteria 824
228 Ga0307414_11436604 3300032004 Bacteria 641
229 Ga0307411_10494598 3300032005 Bacteria 1033
230 Ga0373939_0127794 3300035114 Bacteria 904
231 Ga0373946_0069517 3300035171 Bacteria 1517
232 Ga0373927_0000258 3300035695 Bacteria 41757
233 Ga0373947_0450345 3300035725 Bacteria 872
234 Ga0373925_0007934 3300037068 Bacteria 7731
235 Ga0395899_0026755 3300037312 Bacteria 4352
236 Ga0395899_0059121 3300037312 Bacteria 2825
237 Ga0395900_0179313 3300037418 Bacteria 2153
238 Ga0395900_0300896 3300037418 Bacteria 1590
239 Ga0395900_1702489 3300037418 Bacteria 541
240 Ga0395898_0217146 3300037466 Bacteria 1824
241 Ga0395898_0908482 3300037466 Bacteria 818
242 Ga0395905_0000711 3300037471 Bacteria 44086
243 Ga0395905_0031019 3300037471 Bacteria 5034
244 Ga0395905_0287634 3300037471 Bacteria 1530
245 Ga0395901_0132730 3300038443 Bacteria 2616
246 Ga0395901_0319153 3300038443 Bacteria 1608
247 Ga0395901_0366973 3300038443 Bacteria 1483
248 Ga0395901_0819044 3300038443 Bacteria 918
249 Ga0395901_0998189 3300038443 Bacteria 813
250 Ga0439465_0023455 3300041413 Bacteria 1942
251 Ga0439465_0030175 3300041413 Bacteria 1724
252 Ga0439465_0119546 3300041413 Bacteria 923
253 Ga0439432_074229 3300042006 Bacteria 1035
254 Ga0450901_003202 3300042533 Bacteria 1717
255 Ga0466966_0084793 3300044684 Bacteria 1970
256 Ga0466963_0090414 3300044694 Bacteria 2084
257 Ga0466970_0017342 3300044765 Bacteria 3720
258 Ga0466959_0131540 3300045049 Bacteria 1773
259 Ga0451576_0255127 3300045051 Bacteria 1833
260 Ga0466967_0357624 3300045976 Bacteria 1414
261 Ga0466967_0991189 3300045976 Bacteria 837
262 Ga0495638_0000353 3300046460 Bacteria 57451
263 Ga0495638_0028176 3300046460 Bacteria 3629
264 Ga0495638_0250416 3300046460 Bacteria 977
265 Ga0495605_0007427 3300046474 Bacteria 6219
266 Ga0495662_0071406 3300046476 Bacteria 1682
267 Ga0495585_0006433 3300046492 Bacteria 7289
268 Ga0495607_0117518 3300046501 Bacteria 1401
269 Ga0495616_0048406 3300046513 Bacteria 2136
270 Ga0495620_0126082 3300046515 Bacteria 1007
271 Ga0495632_0048475 3300046519 Bacteria 2103
272 Ga0495643_0048443 3300046522 Bacteria 2297
273 Ga0495652_0193514 3300046529 Bacteria 1550
274 Ga0495640_0228747 3300046533 Bacteria 1170
275 Ga0495609_0018530 3300046538 Bacteria 3225
276 Ga0495633_0012154 3300046558 Bacteria 4593
277 Ga0495668_0012552 3300046616 Bacteria 5023
278 Ga0495634_0119420 3300046642 Bacteria 1689
279 Ga0495611_0017639 3300046648 Bacteria 3056
280 Ga0495625_0001623 3300046660 Bacteria 26508
281 Ga0495625_0347891 3300046660 Bacteria 938
282 Ga0495657_0358220 3300046675 Bacteria 862
283 Ga0495658_0244119 3300046683 Bacteria 1128
284 Ga0495670_0129337 3300046691 Bacteria 1316
285 Ga0495600_0044014 3300046809 Bacteria 2912
286 Ga0495660_0033898 3300046810 Bacteria 2860
287 Ga0495660_0096574 3300046810 Bacteria 1527
288 Ga0495604_0168308 3300047317 Bacteria 1543
289 Ga0495672_0011740 3300047320 Bacteria 6160
290 Ga0495681_0226891 3300047470 Bacteria 747
291 Ga0495686_0177868 3300047472 Bacteria 1234
292 Ga0495626_0129124 3300048091 Bacteria 1081
293 Ga0496100_0141968 3300048903 Bacteria 1703
294 Ga0496101_0033649 3300048904 Bacteria 3616
295 Ga0496101_0585820 3300048904 Bacteria 882
296 Ga0496102_0137185 3300048905 Bacteria 2292
297 Ga0496103_0382553 3300048906 Bacteria 904
298 Ga0496110_0909504 3300048913 Bacteria 786
299 Ga0496115_0008714 3300048918 Bacteria 7518
300 Ga0496116_0007220 3300048919 Bacteria 9912
301 Ga0496116_0017175 3300048919 Bacteria 5629
302 Ga0496116_0054584 3300048919 Bacteria 2631
303 Ga0496117_0061050 3300048920 Bacteria 2593
304 Ga0496117_0108356 3300048920 Bacteria 1738
305 Ga0496118_0046838 3300048921 Bacteria 3358
306 Ga0496119_0063712 3300048922 Bacteria 2191
307 Ga0496119_0381403 3300048922 Bacteria 676
308 Ga0496120_0038012 3300048923 Bacteria 2851
309 Ga0496120_0105546 3300048923 Bacteria 1481
310 Ga0496121_0001632 3300048924 Bacteria 37117
311 Ga0496121_0069860 3300048924 Bacteria 2832
312 Ga0496121_0119176 3300048924 Bacteria 1996
313 Ga0496121_0135130 3300048924 Bacteria 1839
314 Ga0496121_0413976 3300048924 Bacteria 879
315 Ga0496122_0032451 3300048925 Bacteria 4318
316 Ga0496122_0039080 3300048925 Bacteria 3789
317 Ga0496122_0045097 3300048925 Bacteria 3431
318 Ga0496122_0257488 3300048925 Bacteria 971
319 Ga0496123_0030918 3300048926 Bacteria 3909
320 Ga0496123_0060922 3300048926 Bacteria 2429
321 Ga0496123_0419162 3300048926 Bacteria 604
322 Ga0496124_0035244 3300048927 Bacteria 4380
323 Ga0496124_0098897 3300048927 Bacteria 2366
324 Ga0496124_0316877 3300048927 Bacteria 1119
325 Ga0496125_0000719 3300048928 Bacteria 54794
326 Ga0496125_0248126 3300048928 Bacteria 1125
327 Ga0496126_0042355 3300048929 Bacteria 4206
328 Ga0496126_0186128 3300048929 Bacteria 1761
329 Ga0495682_0234137 3300049460 Bacteria 650
330 Ga0501031_0046500 3300049568 Bacteria 2830
331 Ga0501031_0047506 3300049568 Bacteria 2798
332 Ga0501032_0058134 3300049569 Bacteria 2596
333 Ga0501032_0120304 3300049569 Bacteria 1736
334 Ga0501032_0141492 3300049569 Bacteria 1584
335 Ga0501033_0000145 3300049570 Bacteria 68524
336 Ga0501033_0062783 3300049570 Bacteria 2735
337 Ga0501033_0171940 3300049570 Bacteria 1556
338 Ga0501033_0340955 3300049570 Bacteria 1051
339 Ga0501034_0044043 3300049571 Bacteria 4514
340 Ga0501034_0051140 3300049571 Bacteria 4166
341 Ga0501034_0056712 3300049571 Bacteria 3940
342 Ga0501034_0177251 3300049571 Bacteria 2097
343 Ga0501034_0220711 3300049571 Bacteria 1848
344 Ga0501034_0344377 3300049571 Bacteria 1420
345 Ga0501034_0349307 3300049571 Bacteria 1407
346 Ga0501036_0038779 3300049572 Bacteria 4033
347 Ga0501036_0058851 3300049572 Bacteria 3256
348 Ga0501036_0079947 3300049572 Bacteria 2764
349 Ga0501036_0446064 3300049572 Bacteria 1078
350 Ga0501037_0043998 3300049573 Bacteria 3281
351 Ga0501038_0054399 3300049574 Bacteria 3443
352 Ga0501038_0068064 3300049574 Bacteria 3028
353 Ga0501038_0130419 3300049574 Bacteria 2064
354 Ga0501038_0513893 3300049574 Bacteria 915
355 Ga0501039_0056906 3300049575 Bacteria 3029
356 Ga0501039_0654032 3300049575 Bacteria 823
357 Ga0501039_1006091 3300049575 Bacteria 648
358 Ga0501040_0009924 3300049576 Bacteria 6215
359 Ga0501040_0481754 3300049576 Bacteria 894
360 Ga0501041_0012713 3300049577 Bacteria 4988
361 Ga0501042_0154562 3300049578 Bacteria 1655
362 Ga0501042_0217968 3300049578 Bacteria 1376
363 Ga0501043_0052724 3300049579 Bacteria 3194
364 Ga0501043_0228192 3300049579 Bacteria 1439
365 Ga0501043_0281328 3300049579 Bacteria 1275
366 Ga0501046_0015296 3300049580 Bacteria 6452
367 Ga0501046_0178320 3300049580 Bacteria 1590
368 Ga0501046_0328644 3300049580 Bacteria 1113
369 Ga0501047_0116801 3300049581 Bacteria 2549
370 Ga0501047_0316608 3300049581 Bacteria 1401
371 Ga0501048_0070754 3300049582 Bacteria 2463
372 Ga0501068_0015830 3300049584 Bacteria 4341
373 Ga0501070_0116928 3300049586 Bacteria 2202
374 Ga0501070_0352389 3300049586 Bacteria 1194
375 Ga0501070_1198520 3300049586 Bacteria 583
376 Ga0501071_0021489 3300049587 Bacteria 4495
377 Ga0501071_0309847 3300049587 Bacteria 1198
378 Ga0501071_0563446 3300049587 Bacteria 875
379 Ga0501072_0054171 3300049588 Bacteria 3159
380 Ga0501072_0351424 3300049588 Bacteria 1170
381 Ga0501074_0324365 3300049590 Bacteria 1093
382 Ga0501075_0129761 3300049591 Bacteria 1920
383 Ga0501075_0491637 3300049591 Bacteria 936
384 Ga0501075_0616908 3300049591 Bacteria 827
385 Ga0501076_0174051 3300049592 Bacteria 1754
386 Ga0501076_0623641 3300049592 Bacteria 890
387 Ga0501076_0796355 3300049592 Bacteria 780
388 Ga0501076_1108196 3300049592 Bacteria 652
389 Ga0501077_0028065 3300049593 Bacteria 3577
390 Ga0501077_0321716 3300049593 Bacteria 986
391 Ga0501077_0503202 3300049593 Bacteria 777
392 Ga0501077_0898084 3300049593 Bacteria 570
393 Ga0501079_0024990 3300049741 Bacteria 4583
394 Ga0501079_0663627 3300049741 Bacteria 821
395 Ga0501080_0029353 3300049742 Bacteria 5120
396 Ga0501080_0114993 3300049742 Bacteria 2495
397 Ga0501080_0589817 3300049742 Bacteria 987
398 Ga0501081_0054416 3300049743 Bacteria 2765
399 Ga0501083_0660837 3300049744 Bacteria 680
400 Ga0501035_0001613 3300049822 Bacteria 22812
401 Ga0501035_0015022 3300049822 Bacteria 7146
402 Ga0501035_0192437 3300049822 Bacteria 1753
403 Ga0501044_0059220 3300049823 Bacteria 3925
404 Ga0501044_0293447 3300049823 Bacteria 1557
405 Ga0501044_0394348 3300049823 Bacteria 1297
406 Ga0501044_0778541 3300049823 Bacteria 837
407 Ga0501045_0022189 3300049824 Bacteria 4543
408 Ga0501045_0104574 3300049824 Bacteria 2098
409 Ga0501045_0204317 3300049824 Bacteria 1472
410 Ga0501045_0732537 3300049824 Bacteria 729
411 Ga0501045_0908199 3300049824 Bacteria 647
412 nmdc:mga03683_126143_c1 3300050489 Bacteria 1142
413 nmdc:mga00v17_465201_c1 3300050491 Bacteria 821
414 nmdc:mga00v17_556296_c1 3300050491 Bacteria 742
415 nmdc:mga0k408_248048_c1 3300050493 Bacteria 1063
416 nmdc:mga06z11_204002_c1 3300050494 Bacteria 1149
417 nmdc:mga07m45_218968_c1 3300050496 Bacteria 1107
418 nmdc:mga07m45_71036_c1 3300050496 Bacteria 1981
419 nmdc:mga0rr50_1010881_c1 3300050513 Bacteria 708
420 Ga0500610_0064332 3300053079 Bacteria 1913
421 Ga0500578_0126314 3300053086 Bacteria 1606
422 Ga0500646_0232394 3300053090 Bacteria 643
423 Ga0500557_014653 3300053105 Bacteria 2098
424 Ga0500594_0016441 3300053118 Bacteria 1797
425 Ga0500594_0096314 3300053118 Bacteria 905
426 Ga0500595_038600 3300053119 Bacteria 1551
427 Ga0500614_022466 3300053123 Bacteria 1473
428 Ga0500559_0012903 3300053136 Bacteria 3544
429 Ga0500568_0006791 3300053139 Bacteria 5703
430 Ga0500588_0014542 3300053146 Bacteria 1997
431 Ga0500616_0000982 3300053153 Bacteria 30793
432 Ga0500616_0009948 3300053153 Bacteria 5722
433 Ga0500616_0340764 3300053153 Bacteria 612
434 Ga0500622_0089271 3300053156 Bacteria 1532
435 Ga0500634_0000030 3300053161 Bacteria 76925
436 Ga0500634_0102928 3300053161 Bacteria 1425
437 Ga0500636_0131573 3300053177 Bacteria 1393
438 Ga0500599_064326 3300053736 Bacteria 601
439 Ga0501084_0031303 3300054114 Bacteria 4449
440 Ga0501084_0288528 3300054114 Bacteria 1386
441 Ga0501084_0323469 3300054114 Bacteria 1303
442 Ga0501084_1297805 3300054114 Bacteria 610
443 Ga0501082_0044583 3300060353 Bacteria 3825
444 Ga0501082_0067585 3300060353 Bacteria 3078
445 Ga0501082_0533951 3300060353 Bacteria 1026
446 Ga0501082_0610541 3300060353 Bacteria 954
447 Ga0530510_0132587 3300061734 Bacteria 1834
448 Ga0530510_0199301 3300061734 Bacteria 1486
449 2509387731 2509276021 Bacteria 7634384
450 2511133506 2510917022 Bacteria 6504556
451 2524457886 2524023209 Bacteria 6679728
452 2530643908 2529292951 Bacteria 6916614
453 2585266189 2582581306 Bacteria 6450535
454 2585273276 2582581307 Bacteria 6597605
455 2585278891 2582581308 Bacteria 7413247
456 2585325496 2582581315 Bacteria 7318924
457 2585329651 2582581316 Bacteria 7774528
458 2585387191 2582581865 Bacteria 6644329
459 2585530688 2585427527 Bacteria 7273426
460 2585554867 2585427530 Bacteria 7383882
461 2585554868 2585427530 Bacteria 7383882
462 2585559424 2585427531 Bacteria 6992870
463 2585902094 2585427608 Bacteria 6544331
464 2585905200 2585427609 Bacteria 6667127
465 2587979685 2585428125 Bacteria 6662905
466 2616305836 2615840626 Bacteria 7921970
467 2616553921 2615840698 Bacteria 7319877
468 2644166736 2643221629 Bacteria 5850260
469 2644206224 2643221637 Bacteria 5345260
470 2644347692 2643221662 Bacteria 5851492
471 2644649871 2643221718 Bacteria 5345506
472 2671115330 2667528174 Bacteria 6435400
473 2719384845 2718217927 Bacteria 6972593
474 2721398564 2718218423 Bacteria 6438183
475 2724037377 2721755809 Bacteria 6438790
476 2793282284 2791355253 Bacteria 5171699
477 2793367834 2791355267 Bacteria 7222458
478 2819639265 2818991453 Bacteria 7181617
479 2819639266 2818991453 Bacteria 7181617
480 2838031402 2838029111 Bacteria 6603031
481 2841865492 2841864319 Bacteria 6742987
482 2842343612 2842341865 Bacteria 7003929
483 2842365232 2842363717 Bacteria 6844742
484 2842398283 2842395702 Bacteria 6780583
485 2842478003 2842475841 Bacteria 6603183
486 2842482837 2842482326 Bacteria 7212537
487 2842504812 2842502639 Bacteria 6604161
488 2842509709 2842509118 Bacteria 6850950
489 2852389052 2852387548 Bacteria 8025568
490 2919409285 2919408235 Bacteria 6149349
491 2989354193 2989349275 Bacteria 6349068
492 3005417126 3005416602 Bacteria 7064308
493 637079512 637000159 Bacteria 7596297
494 8005279564 8005275841 Bacteria 6929066
495 8005315187 8005314921 Bacteria 7072929
496 8005485645 8005484373 Bacteria 6297373
497 8005684592 8005682033 Bacteria 6726518
498 8005698808 8005695170 Bacteria 6912330
499 8018177261 8018176218 Bacteria 6896178
500 8024489769 8024486573 Bacteria 6540512
501 8046767661 8046767195 Bacteria 7547379
502 8054562118 8054558443 Bacteria 5204801
503 8056380714 8056375014 Bacteria 7006639
504 8057582219 8057575449 Bacteria 7367519
505 Ga0075369_10191276
506 JGI25155J39150_1000032
507 JGI25156J39149_1000153
508 JGI25162J39368_1000442
509 JGI25162J39368_1001722
510 JGI25154J39366_1000152
511 JGI25157J39369_1000061
512 JGI25159J45721_1003928
513 JGI25165J46597_1000639
514 JGI25165J46597_1001009
515 JGI25165J46597_1011001
516 JGI25165J46597_1015833
517 JGI25165J46597_1025441
518 rootH2_10037901
519 rootH2_10044307
520 rootH2_10067834
521 rootH2_10120970
522 rootH1_10050700
523 rootH1_10099566
524 rootH1_10241800
525 JGI25160J50197_1000052
526 JGI25161J50226_1000005
527 JGI25161J50226_1000113
528 Ga0055540_1001764
529 Ga0055543_1000035
530 Ga0065165_1000253
531 Ga0070658_10003333
532 Ga0070658_10066909
533 Ga0070658_10310195
534 Ga0070676_10101375
535 Ga0070676_10171423
536 Ga0070683_100346380
537 Ga0068868_100924641
538 Ga0070660_100012650
539 Ga0070660_100149030
540 Ga0070660_100420435
541 Ga0070661_100002175
542 Ga0070661_100044743
543 Ga0070661_100172034
544 Ga0070661_100901948
545 Ga0070668_100342702
546 Ga0070674_100013689
547 Ga0070674_100147161
548 Ga0070674_101642039
549 Ga0070673_100035107
550 Ga0070659_100006686
551 Ga0070663_100356172
552 Ga0070678_100839209
553 Ga0070662_100300456
554 Ga0068867_100267246
555 Ga0070679_100933114
556 Ga0068853_100000752
557 Ga0068853_100003754
558 Ga0068853_100049258
559 Ga0068853_100138386
560 Ga0070672_100148695
561 Ga0070672_100551001
562 Ga0070686_100005599
563 Ga0070665_100426028
564 Ga0070665_100755218
565 Ga0070665_100926658
566 Ga0068855_100042614
567 Ga0068855_100297210
568 Ga0068855_100559816
569 Ga0070664_100167601
570 Ga0070664_101368858
571 Ga0068857_100117628
572 Ga0068857_100259347
573 Ga0068857_100340723
574 Ga0068857_101299990
575 Ga0068854_100012747
576 Ga0068854_100176163
577 Ga0068854_101127644
578 Ga0068856_100013451
579 Ga0068856_100042150
580 Ga0068856_100071587
581 Ga0068856_100099984
582 Ga0068856_100213533
583 Ga0068852_100013606
584 Ga0068852_100031137
585 Ga0068852_100067077
586 Ga0068852_100187857
587 Ga0068852_100548375
588 Ga0068851_10003875
589 Ga0068851_10046556
590 Ga0068851_10072832
591 Ga0068863_100589873
592 Ga0081455_10111954
593 Ga0081538_10025268
594 Ga0075365_10213639
595 Ga0075365_10416546
596 Ga0075368_10008514
597 Ga0075368_10041467
598 Ga0075363_100133666
599 Ga0075364_10050243
600 Ga0075367_10036164
601 Ga0075367_10042984
602 Ga0075367_10222234
603 Ga0075369_10151421
604 Ga0075369_10223398
605 Ga0075366_10156478
606 Ga0075366_10175758
607 Ga0075370_10171222
608 Ga0075430_100324334
609 Ga0099826_10005187
610 Ga0075435_101808863
611 Ga0105240_10000032
612 Ga0105240_10150610
613 Ga0105240_10309167
614 Ga0105240_12112226
615 Ga0111539_10866809
616 Ga0105245_10600524
617 Ga0114129_11589138
618 Ga0105243_10105644
619 Ga0105241_10075358
620 Ga0105242_10949197
621 Ga0105237_10039537
622 Ga0105237_10586660
623 Ga0105237_11274909
624 Ga0105238_10096952
625 Ga0105238_10135087
626 Ga0105028_104029
627 Ga0105239_10007520
628 Ga0105239_10065377
629 Ga0105239_10318554
630 Ga0105239_10404281
631 Ga0105246_10496654
632 Ga0105246_11891084
633 Ga0157371_10009137
634 Ga0157370_10000986
635 Ga0157370_11043653
636 Ga0157369_10311720
637 Ga0157369_10353330
638 Ga0157369_10389073
639 Ga0163162_12149941
640 Ga0157372_10290413
641 Ga0157377_10529365
642 Ga0182007_10001216
643 Ga0182007_10130020
644 Ga0182005_1007200
645 Ga0163161_10997576
646 Ga0209435_100042
647 Ga0209760_109870
648 Ga0209672_113207
649 Ga0209437_100033
650 Ga0209437_100075
651 Ga0209646_1000145
652 Ga0209646_1036541
653 Ga0209026_1000160
654 Ga0209677_109167
655 Ga0209148_1002908
656 Ga0209759_1000177
657 Ga0209233_1000056
658 Ga0209233_1000064
659 Ga0209233_1000209
660 Ga0209455_1011152
661 Ga0209673_1001371
662 Ga0209130_1000018
663 Ga0209676_1033493
664 Ga0209050_1006882
665 Ga0207426_1000044
666 Ga0209051_1000514
667 Ga0209257_1003433
668 Ga0207656_10001464
669 Ga0207656_10106089
670 Ga0207645_10041069
671 Ga0207705_10369218
672 Ga0207654_10677641
673 Ga0207695_10000024
674 Ga0207695_10516580
675 Ga0207671_10000548
676 Ga0207657_10021947
677 Ga0207657_10026978
678 Ga0207649_10003100
679 Ga0207649_10038038
680 Ga0207649_10232126
681 Ga0207690_10227503
682 Ga0207690_10458381
683 Ga0207706_10656947
684 Ga0207670_10851107
685 Ga0207669_10560577
686 Ga0207669_11474941
687 Ga0207704_10121566
688 Ga0207704_10575076
689 Ga0207691_10949539
690 Ga0207679_11491354
691 Ga0207667_10585032
692 Ga0207667_10966489
693 Ga0207651_10862448
694 Ga0207668_10386918
695 Ga0207640_10009219
696 Ga0207640_10204161
697 Ga0207640_10226325
698 Ga0207677_10265064
699 Ga0207677_11120675
700 Ga0207639_10000897
701 Ga0207639_10005546
702 Ga0207639_10175819
703 Ga0207678_10090746
704 Ga0207702_10047089
705 Ga0207702_10367053
706 Ga0207641_12038616
707 Ga0207648_10114266
708 Ga0207674_10003842
709 Ga0207674_10332972
710 Ga0207674_10480731
711 Ga0207683_10751736
712 Ga0207698_10019025
713 Ga0207698_10071975
714 Ga0207698_10195038
715 Ga0209371_1006525
716 Ga0209974_10075760
717 Ga0268266_10483489
718 Ga0268265_11591857
719 Ga0307515_10035625
720 Ga0307515_10117469
721 Ga0268256_1022574
722 Ga0316181_1269488
723 Ga0265328_10095552
724 Ga0307513_10188946
725 Ga0307516_10129543
726 Ga0307405_10464329
727 Ga0307410_11714686
728 Ga0307416_101331781
729 Ga0307416_102030921
730 Ga0307414_10017936
731 Ga0307414_10871538
732 Ga0307414_11436604
733 Ga0307411_10494598
734 Ga0373939_0127794
735 Ga0373946_0069517
736 Ga0373927_0000258
737 Ga0373947_0450345
738 Ga0373925_0007934
739 Ga0395899_0026755
740 Ga0395899_0059121
741 Ga0395900_0179313
742 Ga0395900_0300896
743 Ga0395900_1702489
744 Ga0395898_0217146
745 Ga0395898_0908482
746 Ga0395905_0000711
747 Ga0395905_0031019
748 Ga0395905_0287634
749 Ga0395901_0132730
750 Ga0395901_0319153
751 Ga0395901_0366973
752 Ga0395901_0819044
753 Ga0395901_0998189
754 Ga0439465_0023455
755 Ga0439465_0030175
756 Ga0439465_0119546
757 Ga0439432_074229
758 Ga0450901_003202
759 Ga0466966_0084793
760 Ga0466963_0090414
761 Ga0466970_0017342
762 Ga0466959_0131540
763 Ga0451576_0255127
764 Ga0466967_0357624
765 Ga0466967_0991189
766 Ga0495638_0000353
767 Ga0495638_0028176
768 Ga0495638_0250416
769 Ga0495605_0007427
770 Ga0495662_0071406
771 Ga0495585_0006433
772 Ga0495607_0117518
773 Ga0495616_0048406
774 Ga0495620_0126082
775 Ga0495632_0048475
776 Ga0495643_0048443
777 Ga0495652_0193514
778 Ga0495640_0228747
779 Ga0495609_0018530
780 Ga0495633_0012154
781 Ga0495668_0012552
782 Ga0495634_0119420
783 Ga0495611_0017639
784 Ga0495625_0001623
785 Ga0495625_0347891
786 Ga0495657_0358220
787 Ga0495658_0244119
788 Ga0495670_0129337
789 Ga0495600_0044014
790 Ga0495660_0033898
791 Ga0495660_0096574
792 Ga0495604_0168308
793 Ga0495672_0011740
794 Ga0495681_0226891
795 Ga0495686_0177868
796 Ga0495626_0129124
797 Ga0496100_0141968
798 Ga0496101_0033649
799 Ga0496101_0585820
800 Ga0496102_0137185
801 Ga0496103_0382553
802 Ga0496110_0909504
803 Ga0496115_0008714
804 Ga0496116_0007220
805 Ga0496116_0017175
806 Ga0496116_0054584
807 Ga0496117_0061050
808 Ga0496117_0108356
809 Ga0496118_0046838
810 Ga0496119_0063712
811 Ga0496119_0381403
812 Ga0496120_0038012
813 Ga0496120_0105546
814 Ga0496121_0001632
815 Ga0496121_0069860
816 Ga0496121_0119176
817 Ga0496121_0135130
818 Ga0496121_0413976
819 Ga0496122_0032451
820 Ga0496122_0039080
821 Ga0496122_0045097
822 Ga0496122_0257488
823 Ga0496123_0030918
824 Ga0496123_0060922
825 Ga0496123_0419162
826 Ga0496124_0035244
827 Ga0496124_0098897
828 Ga0496124_0316877
829 Ga0496125_0000719
830 Ga0496125_0248126
831 Ga0496126_0042355
832 Ga0496126_0186128
833 Ga0495682_0234137
834 Ga0501031_0046500
835 Ga0501031_0047506
836 Ga0501032_0058134
837 Ga0501032_0120304
838 Ga0501032_0141492
839 Ga0501033_0000145
840 Ga0501033_0062783
841 Ga0501033_0171940
842 Ga0501033_0340955
843 Ga0501034_0044043
844 Ga0501034_0051140
845 Ga0501034_0056712
846 Ga0501034_0177251
847 Ga0501034_0220711
848 Ga0501034_0344377
849 Ga0501034_0349307
850 Ga0501036_0038779
851 Ga0501036_0058851
852 Ga0501036_0079947
853 Ga0501036_0446064
854 Ga0501037_0043998
855 Ga0501038_0054399
856 Ga0501038_0068064
857 Ga0501038_0130419
858 Ga0501038_0513893
859 Ga0501039_0056906
860 Ga0501039_0654032
861 Ga0501039_1006091
862 Ga0501040_0009924
863 Ga0501040_0481754
864 Ga0501041_0012713
865 Ga0501042_0154562
866 Ga0501042_0217968
867 Ga0501043_0052724
868 Ga0501043_0228192
869 Ga0501043_0281328
870 Ga0501046_0015296
871 Ga0501046_0178320
872 Ga0501046_0328644
873 Ga0501047_0116801
874 Ga0501047_0316608
875 Ga0501048_0070754
876 Ga0501068_0015830
877 Ga0501070_0116928
878 Ga0501070_0352389
879 Ga0501070_1198520
880 Ga0501071_0021489
881 Ga0501071_0309847
882 Ga0501071_0563446
883 Ga0501072_0054171
884 Ga0501072_0351424
885 Ga0501074_0324365
886 Ga0501075_0129761
887 Ga0501075_0491637
888 Ga0501075_0616908
889 Ga0501076_0174051
890 Ga0501076_0623641
891 Ga0501076_0796355
892 Ga0501076_1108196
893 Ga0501077_0028065
894 Ga0501077_0321716
895 Ga0501077_0503202
896 Ga0501077_0898084
897 Ga0501079_0024990
898 Ga0501079_0663627
899 Ga0501080_0029353
900 Ga0501080_0114993
901 Ga0501080_0589817
902 Ga0501081_0054416
903 Ga0501083_0660837
904 Ga0501035_0001613
905 Ga0501035_0015022
906 Ga0501035_0192437
907 Ga0501044_0059220
908 Ga0501044_0293447
909 Ga0501044_0394348
910 Ga0501044_0778541
911 Ga0501045_0022189
912 Ga0501045_0104574
913 Ga0501045_0204317
914 Ga0501045_0732537
915 Ga0501045_0908199
916 nmdc:mga03683_126143_c1
917 nmdc:mga00v17_465201_c1
918 nmdc:mga00v17_556296_c1
919 nmdc:mga0k408_248048_c1
920 nmdc:mga06z11_204002_c1
921 nmdc:mga07m45_218968_c1
922 nmdc:mga07m45_71036_c1
923 nmdc:mga0rr50_1010881_c1
924 Ga0500610_0064332
925 Ga0500578_0126314
926 Ga0500646_0232394
927 Ga0500557_014653
928 Ga0500594_0016441
929 Ga0500594_0096314
930 Ga0500595_038600
931 Ga0500614_022466
932 Ga0500559_0012903
933 Ga0500568_0006791
934 Ga0500588_0014542
935 Ga0500616_0000982
936 Ga0500616_0009948
937 Ga0500616_0340764
938 Ga0500622_0089271
939 Ga0500634_0000030
940 Ga0500634_0102928
941 Ga0500636_0131573
942 Ga0500599_064326
943 Ga0501084_0031303
944 Ga0501084_0288528
945 Ga0501084_0323469
946 Ga0501084_1297805
947 Ga0501082_0044583
948 Ga0501082_0067585
949 Ga0501082_0533951
950 Ga0501082_0610541
951 Ga0530510_0132587
952 Ga0530510_0199301
953 2509387731
954 2511133506
955 2524457886
956 2530643908
957 2585266189
958 2585273276
959 2585278891
960 2585325496
961 2585329651
962 2585387191
963 2585530688
964 2585554867
965 2585554868
966 2585559424
967 2585902094
968 2585905200
969 2587979685
970 2616305836
971 2616553921
972 2644166736
973 2644206224
974 2644347692
975 2644649871
976 2671115330
977 2719384845
978 2721398564
979 2724037377
980 2793282284
981 2793367834
982 2819639265
983 2819639266
984 2838031402
985 2841865492
986 2842343612
987 2842365232
988 2842398283
989 2842478003
990 2842482837
991 2842504812
992 2842509709
993 2852389052
994 2919409285
995 2989354193
996 3005417126
997 637079512
998 8005279564
999 8005315187
1000 8005485645
1001 8005684592
1002 8005698808
1003 8018177261
1004 8024489769
1005 8046767661
1006 8054562118
1007 8056380714
1008 8057582219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

42

127

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.8691 60 85
4wac-assembly1.cif.gz_A crystal structure of tarm 0.8376 60 85
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8251 1 127
4x7r-assembly1.cif.gz_A crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp 0.749 60 85
7qnt-assembly1.cif.gz_AAA tarm(se) native 0.7288 59 85
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8042 4 114 3.90.1590.10
af_Q2FZM7_1_163_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7906 60 85 3.40.50.2000
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.6904 7 107 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.6833 4 114 3.90.1590.10
af_Q54EW0_1017_1103_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6645 59 87 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A7W6EJV2-F1-model_v4 deleted 0.9948 17 126
AF-A0A0K2ZKL6-F1-model_v4 CENP-V/GFA domain-containing protein 0.9918 1 92 GO:0016846
GO:0046872
AF-A0A6A8A397-F1-model_v4 GFA family protein 0.9915 1 155 GO:0016846
GO:0046872
AF-A0A5Q8CAK1-F1-model_v4 GFA family protein 0.9869 1 124 GO:0016846
GO:0046872
AF-A0A7W6D9T0-F1-model_v4 CENP-V/GFA domain-containing protein 0.9868 1 161 GO:0016846
GO:0046872

Map