metagRoot

F456504

General Info

Members	Datasets	Scaffolds	Average Seq Length
506	221	506	264

Family's Representative Sequence

Representative Sequence	3300006237\|Ga0097621_100441530\|Ga0097621_1004415302
Length	286
Sequence	VSDSELPVTIPPKRERGARRSRARQIVAARLEKLEDLSISKLVPSTLTLLGLCSGATAIRYAVMEQWQIAVTCVVFAMIFDVLDGRAARMLGADTRFGAQLDSLADLVSFGVAPGVIMYTWSLSRMGTAGWIATLIFCACSAIRLARFNVQSVRDEGASKSNPYFTGLPTPAAACMMLLPMLISFQWDGALVREPWVAGTMIAITSALMVSRLPTPSVKHMRLSREHRFLAGVCGGILVMLLVIWPWATLTIGLLIYVATIPVAAVVHHPAAKHERAAASRKINPA

Samples

	Sample ID	Description	Type	Environment
1	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
2	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
3	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
6	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
7	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
8	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
9	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
10	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
11	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
12	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
13	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
14	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
15	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
16	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
17	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
18	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
19	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
20	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
21	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
22	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
23	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
24	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
25	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
26	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
27	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
28	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
29	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
30	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
31	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
32	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
33	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
34	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
35	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
36	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
37	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
38	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
39	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
40	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
41	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
42	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
43	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
44	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
45	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
46	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
47	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
48	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
49	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
50	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
51	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
52	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
53	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
54	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
55	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
56	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
57	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
58	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
59	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
60	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
61	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
62	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
63	3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Metagenome	Rhizosphere
64	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
65	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
66	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
67	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
68	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
69	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
70	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
71	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
72	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
73	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
74	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
75	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
76	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
77	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
78	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
79	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
80	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
81	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
82	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
83	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
130	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
131	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
132	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
133	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
134	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
135	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
136	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
137	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
138	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
139	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
140	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
141	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
142	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
143	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
144	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
145	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
146	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
147	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
148	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
149	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
150	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
151	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
152	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
153	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
154	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
155	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
156	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
157	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
158	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
159	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
160	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
161	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
162	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
163	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
164	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
165	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
166	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
167	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
168	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
169	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
170	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
171	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
172	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
173	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
174	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
175	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
176	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
177	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
178	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
179	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
180	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
181	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
182	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
183	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
184	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
185	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
186	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
187	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
188	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
189	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
190	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
191	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
192	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
193	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
194	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
195	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
196	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
197	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
198	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
199	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
200	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
201	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
202	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
203	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
204	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
205	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
206	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
207	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
208	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
211	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
212	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
213	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
214	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
215	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
216	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
217	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
218	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
219	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
220	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
221	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.37
Nodule	0
Rhizoplane	0.59
Rhizosphere	94.66
Stem	0
Stem Tuber	0
Unclassified	2.37

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25165J46597_1000035	3300003214	Bacteria	290723
2	rootH2_10144299	3300003320	Unclassified	1255
3	Ga0070658_10004316	3300005327	Bacteria	11613
4	Ga0070658_10005364	3300005327	Bacteria	10406
5	Ga0070658_10028211	3300005327	Bacteria	4506
6	Ga0070658_10115002	3300005327	Unclassified	2232
7	Ga0070683_100044039	3300005329	Bacteria	4114
8	Ga0070683_100074022	3300005329	Bacteria	3181
9	Ga0070670_100045600	3300005331	Bacteria	3769
10	Ga0068869_100002261	3300005334	Bacteria	11587
11	Ga0068869_100101557	3300005334	Bacteria	2176
12	Ga0070666_10000521	3300005335	Bacteria	23281
13	Ga0070666_10018890	3300005335	Bacteria	4441
14	Ga0070666_10064310	3300005335	Bacteria	2488
15	Ga0070666_10297532	3300005335	Bacteria	1149
16	Ga0070680_100000849	3300005336	Bacteria	21649
17	Ga0070680_100080237	3300005336	Bacteria	2691
18	Ga0070680_100084253	3300005336	Bacteria	2625
19	Ga0070680_100242282	3300005336	Bacteria	1524
20	Ga0068868_100053237	3300005338	Bacteria	3188
21	Ga0068868_100112375	3300005338	Bacteria	2214
22	Ga0070660_100015192	3300005339	Bacteria	5553
23	Ga0070660_100016414	3300005339	Bacteria	5373
24	Ga0070661_100040843	3300005344	Bacteria	3385
25	Ga0070661_100084774	3300005344	Bacteria	2341
26	Ga0070675_100134027	3300005354	Bacteria	2113
27	Ga0070674_100057649	3300005356	Bacteria	2697
28	Ga0070673_100005963	3300005364	Bacteria	7878
29	Ga0070673_100082829	3300005364	Bacteria	2605
30	Ga0070673_100084259	3300005364	Bacteria	2585
31	Ga0070659_100019976	3300005366	Bacteria	5085
32	Ga0070667_100020806	3300005367	Bacteria	5449
33	Ga0070667_100072282	3300005367	Bacteria	2939
34	Ga0070709_10000183	3300005434	Bacteria	39793
35	Ga0070709_10185728	3300005434	Bacteria	1463
36	Ga0070713_100000006	3300005436	Bacteria	190565
37	Ga0070713_100066783	3300005436	Bacteria	3025
38	Ga0070713_100251566	3300005436	Bacteria	1612
39	Ga0070711_100031300	3300005439	Bacteria	3532
40	Ga0070711_100458119	3300005439	Unclassified	1045
41	Ga0070705_100159925	3300005440	Bacteria	1504
42	Ga0070678_100006712	3300005456	Bacteria	6778
43	Ga0070678_100217316	3300005456	Bacteria	1587
44	Ga0070678_100340297	3300005456	Bacteria	1287
45	Ga0070662_100025835	3300005457	Bacteria	4060
46	Ga0070681_10000002	3300005458	Bacteria	821814
47	Ga0070681_10096526	3300005458	Bacteria	2903
48	Ga0070681_10137868	3300005458	Bacteria	2370
49	Ga0068867_100010521	3300005459	Bacteria	6527
50	Ga0068867_100188102	3300005459	Bacteria	1646
51	Ga0070699_100068024	3300005518	Bacteria	3093
52	Ga0070679_100000329	3300005530	Bacteria	40248
53	Ga0070679_100094266	3300005530	Bacteria	2980
54	Ga0070679_100248362	3300005530	Bacteria	1736
55	Ga0070679_100322243	3300005530	Bacteria	1495
56	Ga0070684_100063665	3300005535	Bacteria	3233
57	Ga0068853_100000227	3300005539	Bacteria	39895
58	Ga0068853_100441085	3300005539	Unclassified	1223
59	Ga0068853_100605243	3300005539	Bacteria	1041
60	Ga0070696_100263270	3300005546	Bacteria	1308
61	Ga0070693_100033297	3300005547	Bacteria	2843
62	Ga0070693_100114699	3300005547	Bacteria	1663
63	Ga0070693_100132825	3300005547	Unclassified	1558
64	Ga0070665_100000322	3300005548	Bacteria	73995
65	Ga0070665_100010517	3300005548	Bacteria	9362
66	Ga0070665_100014236	3300005548	Bacteria	7990
67	Ga0070665_100024946	3300005548	Bacteria	6027
68	Ga0070665_100029172	3300005548	Bacteria	5552
69	Ga0070665_100413544	3300005548	Unclassified	1357
70	Ga0068855_100000038	3300005563	Bacteria	157738
71	Ga0068855_100024817	3300005563	Bacteria	7172
72	Ga0068855_100026689	3300005563	Bacteria	6911
73	Ga0068855_100030126	3300005563	Bacteria	6490
74	Ga0068855_100040691	3300005563	Bacteria	5514
75	Ga0068855_100094757	3300005563	Bacteria	3442
76	Ga0068855_100155637	3300005563	Bacteria	2597
77	Ga0068855_100198085	3300005563	Bacteria	2262
78	Ga0068855_100521009	3300005563	Bacteria	1290
79	Ga0068857_100000077	3300005577	Bacteria	56916
80	Ga0068857_100115270	3300005577	Bacteria	2417
81	Ga0068857_100121304	3300005577	Bacteria	2354
82	Ga0068854_100046594	3300005578	Bacteria	3087
83	Ga0068856_100000071	3300005614	Bacteria	95174
84	Ga0068856_100012178	3300005614	Bacteria	8334
85	Ga0068856_100301343	3300005614	Bacteria	1620
86	Ga0068852_100005165	3300005616	Bacteria	9308
87	Ga0068852_100047727	3300005616	Bacteria	3655
88	Ga0068852_100107227	3300005616	Bacteria	2534
89	Ga0068852_100389631	3300005616	Bacteria	1368
90	Ga0068866_10071324	3300005718	Bacteria	1837
91	Ga0068861_100221081	3300005719	Bacteria	1601
92	Ga0068870_10023315	3300005840	Bacteria	3051
93	Ga0068863_100073544	3300005841	Bacteria	3234
94	Ga0068858_100004340	3300005842	Bacteria	13920
95	Ga0068858_100031925	3300005842	Bacteria	4892
96	Ga0068858_100124901	3300005842	Bacteria	2408
97	Ga0068860_100094961	3300005843	Unclassified	2842
98	Ga0068860_100722595	3300005843	Unclassified	1007
99	Ga0068862_100306493	3300005844	Bacteria	1462
100	Ga0070716_100011524	3300006173	Bacteria	4452
101	Ga0070712_100000071	3300006175	Bacteria	52255
102	Ga0070712_100000393	3300006175	Bacteria	24898
103	Ga0097621_100000270	3300006237	Bacteria	35158
104	Ga0097621_100441530	3300006237	Bacteria	1171
105	Ga0097621_100539662	3300006237	Bacteria	1060
106	Ga0097621_100548457	3300006237	Unclassified	1052
107	Ga0068871_100000525	3300006358	Bacteria	26274
108	Ga0068871_100035583	3300006358	Bacteria	3958
109	Ga0068871_100264458	3300006358	Unclassified	1501
110	Ga0075434_100161712	3300006871	Bacteria	2259
111	Ga0068865_100033745	3300006881	Bacteria	3428
112	Ga0075436_100000062	3300006914	Bacteria	64424
113	Ga0075436_100028665	3300006914	Bacteria	3829
114	Ga0075435_100097271	3300007076	Bacteria	2435
115	Ga0099795_10044692	3300007788	Unclassified	1590
116	Ga0105240_10000890	3300009093	Bacteria	53588
117	Ga0105240_10004965	3300009093	Bacteria	19993
118	Ga0105240_10017847	3300009093	Bacteria	9548
119	Ga0105240_10023969	3300009093	Bacteria	8061
120	Ga0105240_10037958	3300009093	Bacteria	6185
121	Ga0105240_10069242	3300009093	Bacteria	4369
122	Ga0105240_10160546	3300009093	Bacteria	2670
123	Ga0105240_10514379	3300009093	Bacteria	1329
124	Ga0105245_10016274	3300009098	Bacteria	6484
125	Ga0105247_10028048	3300009101	Bacteria	3405
126	Ga0105247_10237636	3300009101	Bacteria	1240
127	Ga0105243_10029837	3300009148	Bacteria	4196
128	Ga0105241_10010749	3300009174	Bacteria	6718
129	Ga0105241_10024394	3300009174	Bacteria	4490
130	Ga0105241_10026164	3300009174	Bacteria	4339
131	Ga0105241_10188128	3300009174	Bacteria	1717
132	Ga0105241_10296585	3300009174	Bacteria	1386
133	Ga0105242_10020268	3300009176	Bacteria	5213
134	Ga0105242_10026202	3300009176	Bacteria	4620
135	Ga0105242_10146690	3300009176	Bacteria	2053
136	Ga0105242_10158201	3300009176	Bacteria	1981
137	Ga0105248_10000001	3300009177	Bacteria	1881304
138	Ga0105248_10054097	3300009177	Bacteria	4501
139	Ga0105237_10002022	3300009545	Bacteria	25784
140	Ga0105237_10033352	3300009545	Bacteria	5216
141	Ga0105237_10061055	3300009545	Bacteria	3770
142	Ga0105237_10109204	3300009545	Bacteria	2758
143	Ga0105237_10293810	3300009545	Bacteria	1628
144	Ga0105238_10003174	3300009551	Bacteria	16387
145	Ga0105238_10091813	3300009551	Bacteria	3024
146	Ga0105238_10269138	3300009551	Unclassified	1684
147	Ga0105249_10012462	3300009553	Bacteria	7495
148	Ga0105028_111457	3300009993	Unclassified	935
149	Ga0105239_10007069	3300010375	Bacteria	12921
150	Ga0105239_10030326	3300010375	Bacteria	5945
151	Ga0105239_10042280	3300010375	Bacteria	4994
152	Ga0105239_10072634	3300010375	Bacteria	3783
153	Ga0105239_10085724	3300010375	Bacteria	3472
154	Ga0105239_10120557	3300010375	Bacteria	2912
155	Ga0105239_10149454	3300010375	Bacteria	2607
156	Ga0105239_10348496	3300010375	Bacteria	1672
157	Ga0105246_10028163	3300011119	Bacteria	3689
158	Ga0105246_10028843	3300011119	Bacteria	3648
159	Ga0105246_10160905	3300011119	Bacteria	1710
160	Ga0157373_10004423	3300013100	Bacteria	10584
161	Ga0157371_10296295	3300013102	Unclassified	1170
162	Ga0157370_10002358	3300013104	Bacteria	22779
163	Ga0157370_10140819	3300013104	Bacteria	2247
164	Ga0157370_10188591	3300013104	Bacteria	1914
165	Ga0157369_10003752	3300013105	Bacteria	18053
166	Ga0157369_10020187	3300013105	Bacteria	7451
167	Ga0157369_10094941	3300013105	Bacteria	3183
168	Ga0157369_10141074	3300013105	Bacteria	2550
169	Ga0157369_10287630	3300013105	Bacteria	1711
170	Ga0157369_10359609	3300013105	Bacteria	1512
171	Ga0157374_10014709	3300013296	Bacteria	6852
172	Ga0157378_10033160	3300013297	Bacteria	4564
173	Ga0157378_10084643	3300013297	Bacteria	2872
174	Ga0157378_10154042	3300013297	Bacteria	2143
175	Ga0157378_10228743	3300013297	Bacteria	1771
176	Ga0157378_10443045	3300013297	Bacteria	1288
177	Ga0163162_10020714	3300013306	Bacteria	6463
178	Ga0163162_10315897	3300013306	Bacteria	1695
179	Ga0163162_10864571	3300013306	Unclassified	1019
180	Ga0157372_10012509	3300013307	Bacteria	9043
181	Ga0157372_10056462	3300013307	Bacteria	4387
182	Ga0157375_10014735	3300013308	Bacteria	6987
183	Ga0163163_10006800	3300014325	Bacteria	10031
184	Ga0163163_10013811	3300014325	Bacteria	7407
185	Ga0163163_10053184	3300014325	Bacteria	3997
186	Ga0163163_10084177	3300014325	Bacteria	3186
187	Ga0157379_10000600	3300014968	Bacteria	29076
188	Ga0157379_10004744	3300014968	Bacteria	11671
189	Ga0157379_10005547	3300014968	Bacteria	10842
190	Ga0157379_10009357	3300014968	Bacteria	8536
191	Ga0157379_10010289	3300014968	Bacteria	8147
192	Ga0157379_10202486	3300014968	Bacteria	1795
193	Ga0157379_10221535	3300014968	Bacteria	1714
194	Ga0157376_10156461	3300014969	Bacteria	2061
195	Ga0182007_10067701	3300015262	Bacteria	1169
196	Ga0163161_10024051	3300017792	Bacteria	4300
197	Ga0213874_10002111	3300021377	Bacteria	4216
198	Ga0213876_10000131	3300021384	Bacteria	81694
199	Ga0209233_1000006	3300025261	Bacteria	1473685
200	Ga0209233_1006720	3300025261	Bacteria	3687
201	Ga0207688_10070795	3300025901	Bacteria	1979
202	Ga0207680_10006552	3300025903	Bacteria	5642
203	Ga0207680_10060135	3300025903	Bacteria	2311
204	Ga0207680_10350021	3300025903	Bacteria	1038
205	Ga0207680_10366597	3300025903	Bacteria	1014
206	Ga0207699_10000152	3300025906	Bacteria	44191
207	Ga0207699_10020227	3300025906	Bacteria	3562
208	Ga0207643_10096511	3300025908	Bacteria	1729
209	Ga0207705_10017747	3300025909	Bacteria	5090
210	Ga0207705_10030639	3300025909	Bacteria	3838
211	Ga0207705_10165696	3300025909	Bacteria	1662
212	Ga0207705_10337617	3300025909	Bacteria	1159
213	Ga0207654_10023189	3300025911	Bacteria	3321
214	Ga0207654_10118104	3300025911	Unclassified	1661
215	Ga0207707_10000002	3300025912	Bacteria	1142054
216	Ga0207707_10036996	3300025912	Bacteria	4265
217	Ga0207707_10132911	3300025912	Bacteria	2176
218	Ga0207707_10274690	3300025912	Bacteria	1460
219	Ga0207695_10000012	3300025913	Bacteria	840961
220	Ga0207695_10003980	3300025913	Bacteria	20388
221	Ga0207695_10023928	3300025913	Bacteria	6890
222	Ga0207695_10026184	3300025913	Bacteria	6511
223	Ga0207695_10029778	3300025913	Bacteria	6024
224	Ga0207695_10073593	3300025913	Bacteria	3481
225	Ga0207695_10210948	3300025913	Bacteria	1853
226	Ga0207695_10288794	3300025913	Bacteria	1533
227	Ga0207695_10476825	3300025913	Bacteria	1130
228	Ga0207671_10038383	3300025914	Bacteria	3550
229	Ga0207671_10078661	3300025914	Bacteria	2470
230	Ga0207671_10186908	3300025914	Bacteria	1614
231	Ga0207671_10189122	3300025914	Bacteria	1605
232	Ga0207671_10219151	3300025914	Bacteria	1490
233	Ga0207671_10254376	3300025914	Bacteria	1381
234	Ga0207693_10000340	3300025915	Bacteria	43054
235	Ga0207693_10000643	3300025915	Bacteria	31316
236	Ga0207663_10005603	3300025916	Bacteria	6341
237	Ga0207663_10132653	3300025916	Bacteria	1723
238	Ga0207660_10000527	3300025917	Bacteria	25551
239	Ga0207660_10082143	3300025917	Bacteria	2370
240	Ga0207660_10378620	3300025917	Bacteria	1137
241	Ga0207657_10008394	3300025919	Bacteria	10484
242	Ga0207657_10015169	3300025919	Bacteria	7481
243	Ga0207649_10121174	3300025920	Bacteria	1764
244	Ga0207649_10424848	3300025920	Unclassified	999
245	Ga0207652_10000197	3300025921	Bacteria	63525
246	Ga0207652_10108177	3300025921	Unclassified	2463
247	Ga0207694_10000006	3300025924	Bacteria	631109
248	Ga0207694_10013250	3300025924	Bacteria	6209
249	Ga0207694_10031401	3300025924	Bacteria	4057
250	Ga0207694_10201256	3300025924	Bacteria	1620
251	Ga0207694_10250615	3300025924	Bacteria	1449
252	Ga0207687_10042183	3300025927	Bacteria	3137
253	Ga0207700_10000020	3300025928	Bacteria	176182
254	Ga0207700_10080018	3300025928	Bacteria	2547
255	Ga0207690_10081830	3300025932	Bacteria	2257
256	Ga0207690_10658273	3300025932	Bacteria	859
257	Ga0207706_10043417	3300025933	Bacteria	3983
258	Ga0207686_10018882	3300025934	Bacteria	3910
259	Ga0207686_10087142	3300025934	Bacteria	2053
260	Ga0207686_10133402	3300025934	Bacteria	1706
261	Ga0207709_10089405	3300025935	Bacteria	2008
262	Ga0207704_10017496	3300025938	Bacteria	3718
263	Ga0207665_10030061	3300025939	Bacteria	3590
264	Ga0207711_10000001	3300025941	Bacteria	1325674
265	Ga0207711_10045012	3300025941	Bacteria	3770
266	Ga0207689_10006649	3300025942	Bacteria	10196
267	Ga0207689_10045327	3300025942	Bacteria	3636
268	Ga0207661_10010606	3300025944	Bacteria	6639
269	Ga0207667_10000106	3300025949	Bacteria	133162
270	Ga0207667_10003419	3300025949	Bacteria	19597
271	Ga0207667_10053522	3300025949	Bacteria	4247
272	Ga0207667_10113386	3300025949	Bacteria	2795
273	Ga0207667_10203300	3300025949	Unclassified	2031
274	Ga0207667_10366421	3300025949	Bacteria	1469
275	Ga0207651_10004225	3300025960	Bacteria	7201
276	Ga0207651_10341308	3300025960	Bacteria	1258
277	Ga0207712_10061187	3300025961	Bacteria	2672
278	Ga0207668_10351394	3300025972	Bacteria	1233
279	Ga0207658_10081303	3300025986	Bacteria	2484
280	Ga0207658_10120705	3300025986	Bacteria	2089
281	Ga0207677_10053455	3300026023	Bacteria	2749
282	Ga0207677_10496473	3300026023	Unclassified	1054
283	Ga0207703_10002997	3300026035	Bacteria	14319
284	Ga0207703_10012983	3300026035	Bacteria	6490
285	Ga0207639_10000590	3300026041	Bacteria	24988
286	Ga0207639_10033844	3300026041	Bacteria	3773
287	Ga0207639_10085618	3300026041	Bacteria	2507
288	Ga0207702_10000021	3300026078	Bacteria	196115
289	Ga0207702_10003069	3300026078	Bacteria	15522
290	Ga0207702_10019924	3300026078	Bacteria	5557
291	Ga0207702_10082104	3300026078	Bacteria	2802
292	Ga0207702_10186805	3300026078	Bacteria	1912
293	Ga0207641_10082362	3300026088	Bacteria	2795
294	Ga0207641_10429212	3300026088	Unclassified	1274
295	Ga0207648_10005046	3300026089	Bacteria	13391
296	Ga0207648_10374803	3300026089	Bacteria	1286
297	Ga0207676_10419074	3300026095	Unclassified	1255
298	Ga0207674_10000275	3300026116	Bacteria	64784
299	Ga0207674_10039324	3300026116	Bacteria	4904
300	Ga0207674_10061215	3300026116	Bacteria	3804
301	Ga0207674_10110538	3300026116	Bacteria	2723
302	Ga0207675_100279388	3300026118	Bacteria	1622
303	Ga0207683_10005654	3300026121	Bacteria	10720
304	Ga0207683_10017878	3300026121	Bacteria	6046
305	Ga0207683_10249567	3300026121	Bacteria	1619
306	Ga0207698_10005325	3300026142	Bacteria	7932
307	Ga0207698_10009289	3300026142	Bacteria	6259
308	Ga0207698_10009712	3300026142	Bacteria	6143
309	Ga0207698_10204159	3300026142	Bacteria	1772
310	Ga0268266_10000364	3300028379	Bacteria	70331
311	Ga0268266_10051624	3300028379	Bacteria	3530
312	Ga0268266_10054107	3300028379	Bacteria	3449
313	Ga0268266_10075523	3300028379	Bacteria	2927
314	Ga0268266_10117275	3300028379	Bacteria	2365
315	Ga0268265_10663664	3300028380	Bacteria	1004
316	Ga0268264_10072797	3300028381	Bacteria	2915
317	Ga0268264_10396443	3300028381	Bacteria	1325
318	Ga0265318_10000264	3300028577	Bacteria	45521
319	Ga0307517_10122661	3300028786	Bacteria	1913
320	Ga0265338_10000011	3300028800	Bacteria	433370
321	Ga0265338_10006897	3300028800	Bacteria	14289
322	Ga0265338_10055025	3300028800	Bacteria	3543
323	Ga0265330_10047313	3300031235	Unclassified	1893
324	Ga0265332_10012985	3300031238	Bacteria	3693
325	Ga0265325_10000017	3300031241	Bacteria	130284
326	Ga0265325_10001517	3300031241	Bacteria	16311
327	Ga0265325_10010365	3300031241	Bacteria	5400
328	Ga0265340_10016314	3300031247	Bacteria	3848
329	Ga0265340_10050332	3300031247	Bacteria	2021
330	Ga0265339_10002923	3300031249	Bacteria	12080
331	Ga0265339_10054428	3300031249	Bacteria	2173
332	Ga0265339_10080109	3300031249	Bacteria	1727
333	Ga0265331_10002150	3300031250	Bacteria	13548
334	Ga0265331_10017113	3300031250	Bacteria	3789
335	Ga0265331_10054651	3300031250	Bacteria	1901
336	Ga0265331_10093034	3300031250	Bacteria	1392
337	Ga0265316_10013722	3300031344	Bacteria	7181
338	Ga0265316_10161904	3300031344	Bacteria	1672
339	Ga0265316_10166936	3300031344	Bacteria	1644
340	Ga0265316_10196207	3300031344	Bacteria	1498
341	Ga0307513_10130404	3300031456	Bacteria	2461
342	Ga0265313_10003340	3300031595	Bacteria	13113
343	Ga0265313_10008086	3300031595	Bacteria	7043
344	Ga0265313_10124314	3300031595	Bacteria	1123
345	Ga0265314_10037016	3300031711	Bacteria	3539
346	Ga0265314_10053026	3300031711	Bacteria	2815
347	Ga0265314_10089259	3300031711	Unclassified	2011
348	Ga0265314_10111015	3300031711	Bacteria	1743
349	Ga0265314_10166876	3300031711	Bacteria	1333
350	Ga0265342_10024863	3300031712	Bacteria	3774
351	Ga0265342_10133368	3300031712	Bacteria	1390
352	Ga0307516_10089170	3300031730	Bacteria	2915
353	Ga0307516_10092402	3300031730	Bacteria	2853
354	Ga0307516_10149398	3300031730	Bacteria	2099
355	Ga0373932_0016624	3300035112	Bacteria	1879
356	Ga0373954_0059537	3300035118	Bacteria	1800
357	Ga0373935_0076402	3300035692	Bacteria	2169
358	Ga0373933_0058036	3300035724	Bacteria	2327
359	Ga0373947_0462730	3300035725	Bacteria	860
360	Ga0373937_0001553	3300036401	Bacteria	19287
361	Ga0373937_0021914	3300036401	Bacteria	5736
362	Ga0373937_0188268	3300036401	Bacteria	1939
363	Ga0373937_0320680	3300036401	Bacteria	1466
364	Ga0373937_0330017	3300036401	Bacteria	1444
365	Ga0373937_0674864	3300036401	Bacteria	979
366	Ga0373925_0004508	3300037068	Bacteria	10523
367	Ga0395900_0158953	3300037418	Bacteria	2306
368	Ga0395900_0319464	3300037418	Bacteria	1533
369	Ga0395898_0031183	3300037466	Bacteria	5329
370	Ga0395898_0037359	3300037466	Bacteria	4818
371	Ga0395901_0098409	3300038443	Bacteria	3067
372	Ga0436365_0583194	3300039437	Bacteria	93933
373	Ga0436365_0953174	3300039437	Bacteria	2294
374	Ga0436361_0834326	3300039447	Bacteria	1116
375	Ga0436363_0714677	3300039450	Bacteria	6923
376	Ga0466957_0155033	3300044842	Bacteria	1484
377	Ga0495650_0093960	3300046471	Bacteria	1136
378	Ga0495580_0127701	3300046472	Unclassified	1765
379	Ga0495664_0235162	3300046477	Bacteria	1108
380	Ga0495585_0117124	3300046492	Bacteria	1412
381	Ga0495585_0118095	3300046492	Bacteria	1405
382	Ga0495583_0046746	3300046506	Bacteria	1995
383	Ga0495606_0043360	3300046507	Bacteria	3001
384	Ga0495628_0245338	3300046516	Unclassified	1339
385	Ga0495648_0059063	3300046524	Bacteria	2290
386	Ga0495652_0107902	3300046529	Bacteria	2245
387	Ga0495665_0084787	3300046531	Unclassified	1665
388	Ga0495587_0250448	3300046536	Bacteria	996
389	Ga0495609_0007942	3300046538	Bacteria	5243
390	Ga0495621_0016789	3300046539	Bacteria	2356
391	Ga0495645_0060640	3300046543	Bacteria	2742
392	Ga0495622_0022786	3300046557	Bacteria	2918
393	Ga0495625_0043550	3300046660	Bacteria	3255
394	Ga0495657_0092451	3300046675	Bacteria	1938
395	Ga0495599_0298606	3300046678	Unclassified	973
396	Ga0495649_0218900	3300046694	Bacteria	985
397	Ga0495675_0138783	3300047444	Bacteria	1508
398	Ga0495684_0106193	3300047471	Bacteria	2122
399	Ga0495602_0118105	3300048088	Bacteria	2140
400	Ga0495602_0131037	3300048088	Bacteria	2000
401	Ga0495602_0431976	3300048088	Bacteria	933
402	Ga0496100_0281830	3300048903	Bacteria	1239
403	Ga0496106_0109262	3300048909	Bacteria	2152
404	Ga0496111_0249981	3300048914	Unclassified	1316
405	Ga0496121_0001329	3300048924	Bacteria	42366
406	Ga0495682_0003750	3300049460	Bacteria	6684
407	Ga0501031_0001913	3300049568	Bacteria	13123
408	Ga0501031_0103190	3300049568	Bacteria	1861
409	Ga0501032_0006653	3300049569	Bacteria	8484
410	Ga0501032_0037146	3300049569	Bacteria	3322
411	Ga0501032_0159079	3300049569	Bacteria	1483
412	Ga0501033_0012847	3300049570	Bacteria	6385
413	Ga0501033_0022922	3300049570	Bacteria	4707
414	Ga0501033_0375609	3300049570	Bacteria	993
415	Ga0501034_0031913	3300049571	Bacteria	5351
416	Ga0501034_0032375	3300049571	Bacteria	5311
417	Ga0501034_0051652	3300049571	Bacteria	4145
418	Ga0501034_0252733	3300049571	Bacteria	1707
419	Ga0501036_0000888	3300049572	Bacteria	22365
420	Ga0501037_0011047	3300049573	Bacteria	6641
421	Ga0501037_0024146	3300049573	Bacteria	4495
422	Ga0501037_0087780	3300049573	Bacteria	2251
423	Ga0501038_0062751	3300049574	Bacteria	3174
424	Ga0501038_0064127	3300049574	Bacteria	3133
425	Ga0501039_0003802	3300049575	Bacteria	11342
426	Ga0501042_0005559	3300049578	Bacteria	8126
427	Ga0501043_0009516	3300049579	Bacteria	7619
428	Ga0501043_0033800	3300049579	Bacteria	4023
429	Ga0501043_0263584	3300049579	Bacteria	1324
430	Ga0501046_0002524	3300049580	Bacteria	17124
431	Ga0501046_0164141	3300049580	Bacteria	1669
432	Ga0501047_0002279	3300049581	Bacteria	18363
433	Ga0501047_0010631	3300049581	Bacteria	8701
434	Ga0501047_0031578	3300049581	Bacteria	5108
435	Ga0501047_0033345	3300049581	Bacteria	4970
436	Ga0501047_0046465	3300049581	Bacteria	4196
437	Ga0501047_0134837	3300049581	Bacteria	2349
438	Ga0501047_0209619	3300049581	Bacteria	1807
439	Ga0501047_0395015	3300049581	Bacteria	1216
440	Ga0501048_0001258	3300049582	Bacteria	19155
441	Ga0501048_0092711	3300049582	Bacteria	2130
442	Ga0501067_0007876	3300049583	Bacteria	5920
443	Ga0501067_0009867	3300049583	Bacteria	5287
444	Ga0501067_0059684	3300049583	Bacteria	2111
445	Ga0501068_0134900	3300049584	Bacteria	1545
446	Ga0501069_0008203	3300049585	Bacteria	5484
447	Ga0501070_0013628	3300049586	Bacteria	6851
448	Ga0501070_0084220	3300049586	Bacteria	2632
449	Ga0501070_0155752	3300049586	Unclassified	1884
450	Ga0501072_0002008	3300049588	Bacteria	15161
451	Ga0501072_0055369	3300049588	Bacteria	3126
452	Ga0501073_0010463	3300049589	Bacteria	6802
453	Ga0501073_0046399	3300049589	Bacteria	3056
454	Ga0501073_0064330	3300049589	Bacteria	2558
455	Ga0501073_0168651	3300049589	Bacteria	1516
456	Ga0501073_0404948	3300049589	Bacteria	942
457	Ga0501074_0012944	3300049590	Bacteria	6065
458	Ga0501074_0030955	3300049590	Bacteria	3877
459	Ga0501079_0001237	3300049741	Bacteria	17901
460	Ga0501079_0007890	3300049741	Bacteria	8066
461	Ga0501079_0145751	3300049741	Bacteria	1845
462	Ga0501080_0007419	3300049742	Bacteria	9895
463	Ga0501080_0030420	3300049742	Bacteria	5030
464	Ga0501080_0033709	3300049742	Bacteria	4780
465	Ga0501080_0045573	3300049742	Bacteria	4082
466	Ga0501080_0078736	3300049742	Bacteria	3065
467	Ga0501083_0037998	3300049744	Bacteria	3274
468	Ga0501083_0049025	3300049744	Bacteria	2849
469	Ga0501083_0240388	3300049744	Bacteria	1179
470	Ga0501035_0002097	3300049822	Bacteria	19833
471	Ga0501035_0011536	3300049822	Bacteria	8189
472	Ga0501035_0011950	3300049822	Bacteria	8033
473	Ga0501035_0021265	3300049822	Bacteria	5964
474	Ga0501035_0023448	3300049822	Bacteria	5660
475	Ga0501035_0050174	3300049822	Bacteria	3740
476	Ga0501044_0016136	3300049823	Bacteria	8028
477	Ga0501044_0038856	3300049823	Bacteria	4969
478	Ga0501044_0041104	3300049823	Bacteria	4814
479	Ga0501044_0067923	3300049823	Bacteria	3631
480	Ga0501044_0080370	3300049823	Bacteria	3302
481	Ga0501044_0095577	3300049823	Bacteria	2994
482	Ga0501044_0098331	3300049823	Bacteria	2946
483	Ga0501044_0117142	3300049823	Bacteria	2668
484	nmdc:mga0n895_117578_c1	3300050512	Unclassified	2678
485	nmdc:mga0n895_146038_c1	3300050512	Bacteria	2395
486	nmdc:mga0rr50_11762_c1	3300050513	Bacteria	5617
487	nmdc:mga0rr50_43241_c1	3300050513	Bacteria	3295
488	nmdc:mga08x19_149453_c1	3300050514	Unclassified	1581
489	nmdc:mga08x19_19978_c1	3300050514	Bacteria	4120
490	nmdc:mga08x19_37_c1	3300050514	Bacteria	163624
491	Ga0500635_0085573	3300053080	Bacteria	1139
492	Ga0500643_000017	3300053087	Bacteria	305781
493	Ga0500555_014671	3300053103	Bacteria	2259
494	Ga0500555_057916	3300053103	Bacteria	1048
495	Ga0500595_000989	3300053119	Bacteria	15954
496	Ga0500595_001075	3300053119	Bacteria	15152
497	Ga0500655_001582	3300053133	Bacteria	4301
498	Ga0500573_0000055	3300053140	Bacteria	82259
499	Ga0500619_002728	3300053154	Bacteria	3465
500	Ga0501084_0000155	3300054114	Bacteria	52649
501	Ga0501084_0003714	3300054114	Bacteria	12396
502	Ga0501084_0026475	3300054114	Bacteria	4840
503	Ga0501084_0117366	3300054114	Bacteria	2237
504	Ga0501084_0153556	3300054114	Bacteria	1941
505	Ga0501082_0005520	3300060353	Bacteria	10976
506	Ga0501082_0153484	3300060353	Bacteria	2001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005436	Ga0070713_100066783	Ga0070713_1000667832	233
2	3300005439	Ga0070711_100031300	Ga0070711_1000313004	233
3	3300005547	Ga0070693_100132825	Ga0070693_1001328252	233
4	3300005842	Ga0068858_100004340	Ga0068858_1000043409	233
5	3300005843	Ga0068860_100094961	Ga0068860_1000949614	233
6	3300006237	Ga0097621_100548457	Ga0097621_1005484572	233
7	3300014968	Ga0157379_10000600	Ga0157379_1000060025	233
8	3300014968	Ga0157379_10005547	Ga0157379_1000554712	233
9	3300015262	Ga0182007_10067701	Ga0182007_100677012	233
10	3300025916	Ga0207663_10005603	Ga0207663_100056032	233
11	3300025928	Ga0207700_10080018	Ga0207700_100800182	233
12	3300026035	Ga0207703_10002997	Ga0207703_100029979	233
13	3300035725	Ga0373947_0462730	Ga0373947_0462730_33_779	233
14	3300036401	Ga0373937_0001553	Ga0373937_0001553_3024_3770	233
15	3300037068	Ga0373925_0004508	Ga0373925_0004508_5710_6456	233
16	3300048903	Ga0496100_0281830	Ga0496100_0281830_301_1047	233
17	3300048914	Ga0496111_0249981	Ga0496111_0249981_361_1107	233
18	3300035118	Ga0373954_0059537	Ga0373954_0059537_991_1737	234
19	3300035724	Ga0373933_0058036	Ga0373933_0058036_996_1742	234
20	3300036401	Ga0373937_0021914	Ga0373937_0021914_4760_5506	234
21	3300048088	Ga0495602_0131037	Ga0495602_0131037_901_1647	234
22	3300054114	Ga0501084_0000155	Ga0501084_0000155_27458_28300	238
23	3300005434	Ga0070709_10000183	Ga0070709_1000018339	239
24	3300005436	Ga0070713_100000006	Ga0070713_10000000630	239
25	3300005440	Ga0070705_100159925	Ga0070705_1001599252	239
26	3300005614	Ga0068856_100000071	Ga0068856_10000007165	239
27	3300006173	Ga0070716_100011524	Ga0070716_1000115244	239
28	3300006175	Ga0070712_100000393	Ga0070712_10000039322	239
29	3300006871	Ga0075434_100161712	Ga0075434_1001617123	239
30	3300006914	Ga0075436_100000062	Ga0075436_10000006253	239
31	3300025906	Ga0207699_10000152	Ga0207699_1000015235	239
32	3300025915	Ga0207693_10000643	Ga0207693_1000064321	239
33	3300025928	Ga0207700_10000020	Ga0207700_10000020142	239
34	3300025939	Ga0207665_10030061	Ga0207665_100300615	239
35	3300026078	Ga0207702_10000021	Ga0207702_1000002157	239
36	3300048909	Ga0496106_0109262	Ga0496106_0109262_610_1356	239
37	3300049589	Ga0501073_0404948	Ga0501073_0404948_16_768	239
38	3300050512	nmdc:mga0n895_146038_c1	nmdc:mga0n895_146038_c1_1216_1962	239
39	3300050513	nmdc:mga0rr50_11762_c1	nmdc:mga0rr50_11762_c1_182_928	239
40	3300050514	nmdc:mga08x19_37_c1	nmdc:mga08x19_37_c1_101075_101821	239
41	3300036401	Ga0373937_0674864	Ga0373937_0674864_49_849	242
42	3300046543	Ga0495645_0060640	Ga0495645_0060640_1985_2731	242
43	3300005335	Ga0070666_10000521	Ga0070666_100005212	243
44	3300005367	Ga0070667_100020806	Ga0070667_1000208065	243
45	3300005548	Ga0070665_100413544	Ga0070665_1004135441	243
46	3300005563	Ga0068855_100024817	Ga0068855_1000248179	243
47	3300006175	Ga0070712_100000071	Ga0070712_10000007111	243
48	3300025903	Ga0207680_10006552	Ga0207680_100065523	243
49	3300025915	Ga0207693_10000340	Ga0207693_1000034025	243
50	3300025949	Ga0207667_10203300	Ga0207667_102033002	243
51	3300009101	Ga0105247_10028048	Ga0105247_100280483	244
52	3300010375	Ga0105239_10042280	Ga0105239_100422803	244
53	3300010375	Ga0105239_10149454	Ga0105239_101494544	244
54	3300031249	Ga0265339_10080109	Ga0265339_100801093	244
55	3300031711	Ga0265314_10053026	Ga0265314_100530261	244
56	3300031712	Ga0265342_10024863	Ga0265342_100248633	244
57	3300046477	Ga0495664_0235162	Ga0495664_0235162_31_831	244
58	3300046529	Ga0495652_0107902	Ga0495652_0107902_1292_2092	244
59	3300046536	Ga0495587_0250448	Ga0495587_0250448_175_975	244
60	3300049569	Ga0501032_0037146	Ga0501032_0037146_525_1364	245
61	3300049571	Ga0501034_0051652	Ga0501034_0051652_2842_3681	245
62	3300049581	Ga0501047_0134837	Ga0501047_0134837_629_1468	245
63	3300049582	Ga0501048_0092711	Ga0501048_0092711_856_1695	245
64	3300049583	Ga0501067_0059684	Ga0501067_0059684_737_1576	245
65	3300049590	Ga0501074_0012944	Ga0501074_0012944_4598_5437	245
66	3300049741	Ga0501079_0001237	Ga0501079_0001237_14634_15473	245
67	3300049742	Ga0501080_0030420	Ga0501080_0030420_526_1365	245
68	3300049823	Ga0501044_0038856	Ga0501044_0038856_3521_4360	245
69	3300054114	Ga0501084_0117366	Ga0501084_0117366_662_1501	245
70	3300060353	Ga0501082_0153484	Ga0501082_0153484_517_1356	245
71	3300009176	Ga0105242_10146690	Ga0105242_101466902	246
72	3300025934	Ga0207686_10087142	Ga0207686_100871422	246
73	3300036401	Ga0373937_0188268	Ga0373937_0188268_102_851	247
74	3300047471	Ga0495684_0106193	Ga0495684_0106193_1113_1862	247
75	3300005336	Ga0070680_100242282	Ga0070680_1002422822	248
76	3300005434	Ga0070709_10185728	Ga0070709_101857282	248
77	3300005518	Ga0070699_100068024	Ga0070699_1000680244	248
78	3300005530	Ga0070679_100322243	Ga0070679_1003222432	248
79	3300005539	Ga0068853_100441085	Ga0068853_1004410852	248
80	3300005547	Ga0070693_100033297	Ga0070693_1000332972	248
81	3300007076	Ga0075435_100097271	Ga0075435_1000972714	248
82	3300009093	Ga0105240_10023969	Ga0105240_100239696	248
83	3300013105	Ga0157369_10020187	Ga0157369_100201875	248
84	3300026142	Ga0207698_10009289	Ga0207698_100092898	248
85	3300028800	Ga0265338_10055025	Ga0265338_100550252	248
86	3300031241	Ga0265325_10001517	Ga0265325_1000151710	248
87	3300031250	Ga0265331_10017113	Ga0265331_100171134	248
88	3300031344	Ga0265316_10013722	Ga0265316_100137229	248
89	3300031344	Ga0265316_10166936	Ga0265316_101669362	248
90	3300031595	Ga0265313_10003340	Ga0265313_100033407	248
91	3300035112	Ga0373932_0016624	Ga0373932_0016624_977_1723	248
92	3300035692	Ga0373935_0076402	Ga0373935_0076402_568_1314	248
93	3300036401	Ga0373937_0320680	Ga0373937_0320680_608_1414	248
94	3300036401	Ga0373937_0330017	Ga0373937_0330017_634_1380	248
95	3300049460	Ga0495682_0003750	Ga0495682_0003750_1955_2776	248
96	3300050512	nmdc:mga0n895_117578_c1	nmdc:mga0n895_117578_c1_1754_2500	248
97	3300050513	nmdc:mga0rr50_43241_c1	nmdc:mga0rr50_43241_c1_326_1072	248
98	3300050514	nmdc:mga08x19_149453_c1	nmdc:mga08x19_149453_c1_246_992	248
99	3300053133	Ga0500655_001582	Ga0500655_001582_2702_3523	248
100	3300005563	Ga0068855_100000038	Ga0068855_100000038113	249
101	3300005616	Ga0068852_100047727	Ga0068852_1000477274	249
102	3300005616	Ga0068852_100389631	Ga0068852_1003896312	249
103	3300013297	Ga0157378_10033160	Ga0157378_100331605	249
104	3300025913	Ga0207695_10000012	Ga0207695_10000012607	249
105	3300025914	Ga0207671_10254376	Ga0207671_102543761	249
106	3300025924	Ga0207694_10000006	Ga0207694_1000000657	249
107	3300025949	Ga0207667_10000106	Ga0207667_1000010653	249
108	3300026142	Ga0207698_10009712	Ga0207698_100097124	249
109	3300031247	Ga0265340_10016314	Ga0265340_100163145	249
110	3300031730	Ga0307516_10092402	Ga0307516_100924024	249
111	3300005616	Ga0068852_100107227	Ga0068852_1001072273	250
112	3300009093	Ga0105240_10037958	Ga0105240_100379585	250
113	3300013306	Ga0163162_10864571	Ga0163162_108645712	250
114	3300025913	Ga0207695_10029778	Ga0207695_100297785	250
115	3300026142	Ga0207698_10005325	Ga0207698_100053252	250
116	3300028577	Ga0265318_10000264	Ga0265318_1000026411	250
117	3300053154	Ga0500619_002728	Ga0500619_002728_2211_3047	250
118	3300003320	rootH2_10144299	rootH2_101442992	251
119	3300005539	Ga0068853_100000227	Ga0068853_1000002275	251
120	3300009177	Ga0105248_10000001	Ga0105248_100000011396	251
121	3300025941	Ga0207711_10000001	Ga0207711_10000001476	251
122	3300026041	Ga0207639_10000590	Ga0207639_1000059020	251
123	3300049571	Ga0501034_0032375	Ga0501034_0032375_4361_5188	251
124	3300049581	Ga0501047_0002279	Ga0501047_0002279_15089_15916	251
125	3300049583	Ga0501067_0007876	Ga0501067_0007876_1323_2150	251
126	3300049586	Ga0501070_0084220	Ga0501070_0084220_1640_2437	251
127	3300049588	Ga0501072_0002008	Ga0501072_0002008_51_878	251
128	3300049589	Ga0501073_0168651	Ga0501073_0168651_20_847	251
129	3300049741	Ga0501079_0145751	Ga0501079_0145751_960_1787	251
130	3300049742	Ga0501080_0007419	Ga0501080_0007419_1747_2589	251
131	3300049822	Ga0501035_0002097	Ga0501035_0002097_11_808	251
132	3300054114	Ga0501084_0153556	Ga0501084_0153556_542_1369	251
133	3300005336	Ga0070680_100000849	Ga0070680_1000008492	252
134	3300005344	Ga0070661_100040843	Ga0070661_1000408434	252
135	3300005458	Ga0070681_10000002	Ga0070681_10000002872	252
136	3300005530	Ga0070679_100000329	Ga0070679_10000032919	252
137	3300010375	Ga0105239_10030326	Ga0105239_100303264	252
138	3300021384	Ga0213876_10000131	Ga0213876_1000013172	252
139	3300025912	Ga0207707_10000002	Ga0207707_1000000285	252
140	3300025917	Ga0207660_10000527	Ga0207660_100005279	252
141	3300025921	Ga0207652_10000197	Ga0207652_1000019719	252
142	3300028800	Ga0265338_10000011	Ga0265338_1000001150	252
143	3300028800	Ga0265338_10006897	Ga0265338_100068972	252
144	3300031241	Ga0265325_10000017	Ga0265325_1000001756	252
145	3300031249	Ga0265339_10002923	Ga0265339_100029236	252
146	3300031250	Ga0265331_10002150	Ga0265331_1000215010	252
147	3300031595	Ga0265313_10124314	Ga0265313_101243142	252
148	3300031711	Ga0265314_10037016	Ga0265314_100370165	252
149	3300039437	Ga0436365_0583194	Ga0436365_0583194_41627_42487	252
150	3300049586	Ga0501070_0155752	Ga0501070_0155752_83_925	252
151	3300005546	Ga0070696_100263270	Ga0070696_1002632702	256
152	3300021377	Ga0213874_10002111	Ga0213874_100021115	256
153	3300039450	Ga0436363_0714677	Ga0436363_0714677_3596_4447	256
154	3300047444	Ga0495675_0138783	Ga0495675_0138783_33_878	257
155	3300048088	Ga0495602_0431976	Ga0495602_0431976_52_897	257
156	3300005436	Ga0070713_100251566	Ga0070713_1002515662	258
157	3300005563	Ga0068855_100030126	Ga0068855_1000301265	258
158	3300005577	Ga0068857_100000077	Ga0068857_10000007756	258
159	3300005578	Ga0068854_100046594	Ga0068854_1000465943	258
160	3300005614	Ga0068856_100012178	Ga0068856_1000121787	258
161	3300005616	Ga0068852_100005165	Ga0068852_10000516511	258
162	3300006914	Ga0075436_100028665	Ga0075436_1000286654	258
163	3300009093	Ga0105240_10004965	Ga0105240_1000496512	258
164	3300009174	Ga0105241_10010749	Ga0105241_100107497	258
165	3300009545	Ga0105237_10002022	Ga0105237_1000202218	258
166	3300009551	Ga0105238_10003174	Ga0105238_100031749	258
167	3300010375	Ga0105239_10007069	Ga0105239_100070699	258
168	3300013100	Ga0157373_10004423	Ga0157373_100044237	258
169	3300013104	Ga0157370_10002358	Ga0157370_1000235817	258
170	3300013105	Ga0157369_10003752	Ga0157369_1000375211	258
171	3300013296	Ga0157374_10014709	Ga0157374_100147098	258
172	3300013307	Ga0157372_10056462	Ga0157372_100564626	258
173	3300014325	Ga0163163_10053184	Ga0163163_100531846	258
174	3300014968	Ga0157379_10009357	Ga0157379_100093577	258
175	3300025906	Ga0207699_10020227	Ga0207699_100202272	258
176	3300025911	Ga0207654_10023189	Ga0207654_100231892	258
177	3300025914	Ga0207671_10038383	Ga0207671_100383832	258
178	3300025924	Ga0207694_10031401	Ga0207694_100314012	258
179	3300025949	Ga0207667_10003419	Ga0207667_1000341915	258
180	3300026041	Ga0207639_10033844	Ga0207639_100338445	258
181	3300026078	Ga0207702_10003069	Ga0207702_100030697	258
182	3300026116	Ga0207674_10000275	Ga0207674_1000027535	258
183	3300050514	nmdc:mga08x19_19978_c1	nmdc:mga08x19_19978_c1_2936_3712	258
184	3300013306	Ga0163162_10315897	Ga0163162_103158972	259
185	3300007788	Ga0099795_10044692	Ga0099795_100446922	261
186	3300046472	Ga0495580_0127701	Ga0495580_0127701_483_1298	261
187	3300046531	Ga0495665_0084787	Ga0495665_0084787_836_1651	261
188	3300005718	Ga0068866_10071324	Ga0068866_100713242	262
189	3300006358	Ga0068871_100035583	Ga0068871_1000355832	262
190	3300006358	Ga0068871_100264458	Ga0068871_1002644582	262
191	3300006881	Ga0068865_100033745	Ga0068865_1000337454	262
192	3300009176	Ga0105242_10020268	Ga0105242_100202684	262
193	3300013308	Ga0157375_10014735	Ga0157375_100147356	262
194	3300017792	Ga0163161_10024051	Ga0163161_100240514	262
195	3300025934	Ga0207686_10018882	Ga0207686_100188824	262
196	3300025938	Ga0207704_10017496	Ga0207704_100174964	262
197	3300026121	Ga0207683_10005654	Ga0207683_100056548	262
198	3300031730	Ga0307516_10149398	Ga0307516_101493982	262
199	3300049581	Ga0501047_0209619	Ga0501047_0209619_240_1040	263
200	3300049742	Ga0501080_0045573	Ga0501080_0045573_1218_2018	263
201	3300049822	Ga0501035_0011536	Ga0501035_0011536_4147_4947	263
202	3300049580	Ga0501046_0164141	Ga0501046_0164141_668_1462	264
203	3300049570	Ga0501033_0022922	Ga0501033_0022922_1092_1895	265
204	3300005366	Ga0070659_100019976	Ga0070659_1000199762	266
205	3300005563	Ga0068855_100026689	Ga0068855_1000266898	266
206	3300009093	Ga0105240_10000890	Ga0105240_1000089030	266
207	3300013104	Ga0157370_10188591	Ga0157370_101885912	266
208	3300014968	Ga0157379_10221535	Ga0157379_102215352	266
209	3300025909	Ga0207705_10165696	Ga0207705_101656962	266
210	3300025913	Ga0207695_10003980	Ga0207695_100039803	266
211	3300025932	Ga0207690_10081830	Ga0207690_100818302	266
212	3300025949	Ga0207667_10053522	Ga0207667_100535222	266
213	3300026041	Ga0207639_10085618	Ga0207639_100856183	266
214	3300026078	Ga0207702_10186805	Ga0207702_101868052	266
215	3300031250	Ga0265331_10093034	Ga0265331_100930342	266
216	3300031344	Ga0265316_10196207	Ga0265316_101962072	266
217	3300031711	Ga0265314_10111015	Ga0265314_101110152	266
218	3300031712	Ga0265342_10133368	Ga0265342_101333682	266
219	3300046507	Ga0495606_0043360	Ga0495606_0043360_1685_2497	266
220	3300046516	Ga0495628_0245338	Ga0495628_0245338_22_861	266
221	3300048088	Ga0495602_0118105	Ga0495602_0118105_611_1456	266
222	3300049568	Ga0501031_0001913	Ga0501031_0001913_5907_6728	266
223	3300049569	Ga0501032_0006653	Ga0501032_0006653_5956_6777	266
224	3300049570	Ga0501033_0012847	Ga0501033_0012847_2137_2958	266
225	3300049571	Ga0501034_0031913	Ga0501034_0031913_2207_3028	266
226	3300049571	Ga0501034_0252733	Ga0501034_0252733_832_1668	266
227	3300049572	Ga0501036_0000888	Ga0501036_0000888_11262_12083	266
228	3300049573	Ga0501037_0011047	Ga0501037_0011047_2265_3086	266
229	3300049574	Ga0501038_0064127	Ga0501038_0064127_774_1595	266
230	3300049575	Ga0501039_0003802	Ga0501039_0003802_5100_5921	266
231	3300049578	Ga0501042_0005559	Ga0501042_0005559_2924_3745	266
232	3300049579	Ga0501043_0033800	Ga0501043_0033800_1066_1887	266
233	3300049580	Ga0501046_0002524	Ga0501046_0002524_13506_14327	266
234	3300049581	Ga0501047_0010631	Ga0501047_0010631_3517_4338	266
235	3300049581	Ga0501047_0395015	Ga0501047_0395015_281_1117	266
236	3300049582	Ga0501048_0001258	Ga0501048_0001258_6223_7044	266
237	3300049583	Ga0501067_0009867	Ga0501067_0009867_774_1595	266
238	3300049585	Ga0501069_0008203	Ga0501069_0008203_2284_3105	266
239	3300049586	Ga0501070_0013628	Ga0501070_0013628_4492_5313	266
240	3300049588	Ga0501072_0055369	Ga0501072_0055369_693_1514	266
241	3300049589	Ga0501073_0010463	Ga0501073_0010463_5393_6214	266
242	3300049590	Ga0501074_0030955	Ga0501074_0030955_1991_2812	266
243	3300049741	Ga0501079_0007890	Ga0501079_0007890_1539_2360	266
244	3300049742	Ga0501080_0033709	Ga0501080_0033709_1708_2529	266
245	3300049744	Ga0501083_0037998	Ga0501083_0037998_841_1662	266
246	3300049822	Ga0501035_0023448	Ga0501035_0023448_1708_2529	266
247	3300049823	Ga0501044_0041104	Ga0501044_0041104_276_1112	266
248	3300049823	Ga0501044_0080370	Ga0501044_0080370_1708_2529	266
249	3300049823	Ga0501044_0117142	Ga0501044_0117142_1196_2041	266
250	3300054114	Ga0501084_0003714	Ga0501084_0003714_9124_9945	266
251	3300060353	Ga0501082_0005520	Ga0501082_0005520_3594_4415	266
252	3300005327	Ga0070658_10115002	Ga0070658_101150022	267
253	3300005335	Ga0070666_10297532	Ga0070666_102975321	267
254	3300005456	Ga0070678_100217316	Ga0070678_1002173162	267
255	3300005458	Ga0070681_10137868	Ga0070681_101378682	267
256	3300005530	Ga0070679_100094266	Ga0070679_1000942663	267
257	3300005563	Ga0068855_100155637	Ga0068855_1001556373	267
258	3300005577	Ga0068857_100115270	Ga0068857_1001152703	267
259	3300005719	Ga0068861_100221081	Ga0068861_1002210812	267
260	3300005841	Ga0068863_100073544	Ga0068863_1000735444	267
261	3300005842	Ga0068858_100031925	Ga0068858_1000319253	267
262	3300009101	Ga0105247_10237636	Ga0105247_102376362	267
263	3300009174	Ga0105241_10024394	Ga0105241_100243942	267
264	3300009177	Ga0105248_10054097	Ga0105248_100540974	267
265	3300009545	Ga0105237_10061055	Ga0105237_100610553	267
266	3300009553	Ga0105249_10012462	Ga0105249_100124623	267
267	3300010375	Ga0105239_10072634	Ga0105239_100726342	267
268	3300013102	Ga0157371_10296295	Ga0157371_102962952	267
269	3300014968	Ga0157379_10202486	Ga0157379_102024862	267
270	3300025903	Ga0207680_10366597	Ga0207680_103665971	267
271	3300025912	Ga0207707_10036996	Ga0207707_100369964	267
272	3300025914	Ga0207671_10219151	Ga0207671_102191512	267
273	3300025941	Ga0207711_10045012	Ga0207711_100450124	267
274	3300025961	Ga0207712_10061187	Ga0207712_100611872	267
275	3300026035	Ga0207703_10012983	Ga0207703_100129834	267
276	3300026088	Ga0207641_10082362	Ga0207641_100823622	267
277	3300026116	Ga0207674_10110538	Ga0207674_101105382	267
278	3300026118	Ga0207675_100279388	Ga0207675_1002793882	267
279	3300037418	Ga0395900_0319464	Ga0395900_0319464_544_1359	267
280	3300037466	Ga0395898_0031183	Ga0395898_0031183_2329_3144	267
281	3300038443	Ga0395901_0098409	Ga0395901_0098409_1560_2375	267
282	3300046471	Ga0495650_0093960	Ga0495650_0093960_125_934	267
283	3300048924	Ga0496121_0001329	Ga0496121_0001329_17855_18658	267
284	3300049570	Ga0501033_0375609	Ga0501033_0375609_85_900	267
285	3300049573	Ga0501037_0087780	Ga0501037_0087780_1143_1958	267
286	3300049579	Ga0501043_0009516	Ga0501043_0009516_4744_5559	267
287	3300049581	Ga0501047_0031578	Ga0501047_0031578_3602_4417	267
288	3300049589	Ga0501073_0046399	Ga0501073_0046399_1005_1820	267
289	3300049742	Ga0501080_0078736	Ga0501080_0078736_1917_2732	267
290	3300049744	Ga0501083_0240388	Ga0501083_0240388_174_989	267
291	3300049822	Ga0501035_0050174	Ga0501035_0050174_2171_2986	267
292	3300049823	Ga0501044_0016136	Ga0501044_0016136_5165_5980	267
293	3300003214	JGI25165J46597_1000035	JGI25165J46597_100003524	268
294	3300005327	Ga0070658_10004316	Ga0070658_100043163	268
295	3300005327	Ga0070658_10005364	Ga0070658_100053644	268
296	3300005327	Ga0070658_10028211	Ga0070658_100282113	268
297	3300005329	Ga0070683_100044039	Ga0070683_1000440395	268
298	3300005329	Ga0070683_100074022	Ga0070683_1000740224	268
299	3300005331	Ga0070670_100045600	Ga0070670_1000456004	268
300	3300005334	Ga0068869_100002261	Ga0068869_1000022614	268
301	3300005334	Ga0068869_100101557	Ga0068869_1001015572	268
302	3300005335	Ga0070666_10018890	Ga0070666_100188904	268
303	3300005335	Ga0070666_10064310	Ga0070666_100643102	268
304	3300005336	Ga0070680_100080237	Ga0070680_1000802374	268
305	3300005336	Ga0070680_100084253	Ga0070680_1000842532	268
306	3300005338	Ga0068868_100053237	Ga0068868_1000532372	268
307	3300005338	Ga0068868_100112375	Ga0068868_1001123752	268
308	3300005339	Ga0070660_100015192	Ga0070660_1000151925	268
309	3300005339	Ga0070660_100016414	Ga0070660_1000164144	268
310	3300005344	Ga0070661_100084774	Ga0070661_1000847743	268
311	3300005354	Ga0070675_100134027	Ga0070675_1001340272	268
312	3300005356	Ga0070674_100057649	Ga0070674_1000576494	268
313	3300005364	Ga0070673_100005963	Ga0070673_1000059634	268
314	3300005364	Ga0070673_100082829	Ga0070673_1000828292	268
315	3300005364	Ga0070673_100084259	Ga0070673_1000842593	268
316	3300005367	Ga0070667_100072282	Ga0070667_1000722821	268
317	3300005439	Ga0070711_100458119	Ga0070711_1004581191	268
318	3300005456	Ga0070678_100006712	Ga0070678_1000067125	268
319	3300005456	Ga0070678_100340297	Ga0070678_1003402972	268
320	3300005457	Ga0070662_100025835	Ga0070662_1000258353	268
321	3300005458	Ga0070681_10096526	Ga0070681_100965263	268
322	3300005459	Ga0068867_100010521	Ga0068867_1000105215	268
323	3300005459	Ga0068867_100188102	Ga0068867_1001881021	268
324	3300005530	Ga0070679_100248362	Ga0070679_1002483622	268
325	3300005535	Ga0070684_100063665	Ga0070684_1000636654	268
326	3300005539	Ga0068853_100605243	Ga0068853_1006052431	268
327	3300005547	Ga0070693_100114699	Ga0070693_1001146991	268
328	3300005548	Ga0070665_100000322	Ga0070665_10000032226	268
329	3300005548	Ga0070665_100010517	Ga0070665_1000105177	268
330	3300005548	Ga0070665_100014236	Ga0070665_1000142365	268
331	3300005548	Ga0070665_100024946	Ga0070665_1000249465	268
332	3300005548	Ga0070665_100029172	Ga0070665_1000291723	268
333	3300005563	Ga0068855_100040691	Ga0068855_1000406916	268
334	3300005563	Ga0068855_100094757	Ga0068855_1000947574	268
335	3300005563	Ga0068855_100198085	Ga0068855_1001980853	268
336	3300005563	Ga0068855_100521009	Ga0068855_1005210092	268
337	3300005577	Ga0068857_100121304	Ga0068857_1001213042	268
338	3300005614	Ga0068856_100301343	Ga0068856_1003013432	268
339	3300005840	Ga0068870_10023315	Ga0068870_100233154	268
340	3300005842	Ga0068858_100124901	Ga0068858_1001249013	268
341	3300005843	Ga0068860_100722595	Ga0068860_1007225952	268
342	3300005844	Ga0068862_100306493	Ga0068862_1003064931	268
343	3300006237	Ga0097621_100000270	Ga0097621_10000027010	268
344	3300006237	Ga0097621_100441530	Ga0097621_1004415302	268
345	3300006237	Ga0097621_100539662	Ga0097621_1005396622	268
346	3300006358	Ga0068871_100000525	Ga0068871_10000052514	268
347	3300009093	Ga0105240_10017847	Ga0105240_100178475	268
348	3300009093	Ga0105240_10069242	Ga0105240_100692422	268
349	3300009093	Ga0105240_10160546	Ga0105240_101605462	268
350	3300009093	Ga0105240_10514379	Ga0105240_105143791	268
351	3300009098	Ga0105245_10016274	Ga0105245_100162745	268
352	3300009148	Ga0105243_10029837	Ga0105243_100298375	268
353	3300009174	Ga0105241_10026164	Ga0105241_100261644	268
354	3300009174	Ga0105241_10188128	Ga0105241_101881282	268
355	3300009174	Ga0105241_10296585	Ga0105241_102965851	268
356	3300009176	Ga0105242_10026202	Ga0105242_100262024	268
357	3300009176	Ga0105242_10158201	Ga0105242_101582013	268
358	3300009545	Ga0105237_10033352	Ga0105237_100333525	268
359	3300009545	Ga0105237_10109204	Ga0105237_101092043	268
360	3300009545	Ga0105237_10293810	Ga0105237_102938102	268
361	3300009551	Ga0105238_10091813	Ga0105238_100918133	268
362	3300009551	Ga0105238_10269138	Ga0105238_102691382	268
363	3300009993	Ga0105028_111457	Ga0105028_1114571	268
364	3300010375	Ga0105239_10085724	Ga0105239_100857242	268
365	3300010375	Ga0105239_10120557	Ga0105239_101205572	268
366	3300010375	Ga0105239_10348496	Ga0105239_103484962	268
367	3300011119	Ga0105246_10028163	Ga0105246_100281633	268
368	3300011119	Ga0105246_10028843	Ga0105246_100288432	268
369	3300011119	Ga0105246_10160905	Ga0105246_101609052	268
370	3300013104	Ga0157370_10140819	Ga0157370_101408194	268
371	3300013105	Ga0157369_10094941	Ga0157369_100949411	268
372	3300013105	Ga0157369_10141074	Ga0157369_101410744	268
373	3300013105	Ga0157369_10287630	Ga0157369_102876302	268
374	3300013105	Ga0157369_10359609	Ga0157369_103596092	268
375	3300013297	Ga0157378_10084643	Ga0157378_100846433	268
376	3300013297	Ga0157378_10154042	Ga0157378_101540422	268
377	3300013297	Ga0157378_10228743	Ga0157378_102287431	268
378	3300013297	Ga0157378_10443045	Ga0157378_104430451	268
379	3300013306	Ga0163162_10020714	Ga0163162_100207145	268
380	3300013307	Ga0157372_10012509	Ga0157372_100125095	268
381	3300014325	Ga0163163_10006800	Ga0163163_100068005	268
382	3300014325	Ga0163163_10013811	Ga0163163_100138115	268
383	3300014325	Ga0163163_10084177	Ga0163163_100841774	268
384	3300014968	Ga0157379_10004744	Ga0157379_100047446	268
385	3300014968	Ga0157379_10010289	Ga0157379_100102895	268
386	3300014969	Ga0157376_10156461	Ga0157376_101564612	268
387	3300025261	Ga0209233_1000006	Ga0209233_1000006519	268
388	3300025261	Ga0209233_1006720	Ga0209233_10067204	268
389	3300025901	Ga0207688_10070795	Ga0207688_100707953	268
390	3300025903	Ga0207680_10060135	Ga0207680_100601354	268
391	3300025903	Ga0207680_10350021	Ga0207680_103500211	268
392	3300025908	Ga0207643_10096511	Ga0207643_100965112	268
393	3300025909	Ga0207705_10017747	Ga0207705_100177475	268
394	3300025909	Ga0207705_10030639	Ga0207705_100306393	268
395	3300025909	Ga0207705_10337617	Ga0207705_103376172	268
396	3300025911	Ga0207654_10118104	Ga0207654_101181041	268
397	3300025912	Ga0207707_10132911	Ga0207707_101329113	268
398	3300025912	Ga0207707_10274690	Ga0207707_102746902	268
399	3300025913	Ga0207695_10023928	Ga0207695_100239288	268
400	3300025913	Ga0207695_10026184	Ga0207695_100261844	268
401	3300025913	Ga0207695_10073593	Ga0207695_100735933	268
402	3300025913	Ga0207695_10210948	Ga0207695_102109483	268
403	3300025913	Ga0207695_10288794	Ga0207695_102887942	268
404	3300025913	Ga0207695_10476825	Ga0207695_104768252	268
405	3300025914	Ga0207671_10078661	Ga0207671_100786612	268
406	3300025914	Ga0207671_10186908	Ga0207671_101869082	268
407	3300025914	Ga0207671_10189122	Ga0207671_101891222	268
408	3300025916	Ga0207663_10132653	Ga0207663_101326532	268
409	3300025917	Ga0207660_10082143	Ga0207660_100821433	268
410	3300025917	Ga0207660_10378620	Ga0207660_103786202	268
411	3300025919	Ga0207657_10008394	Ga0207657_100083943	268
412	3300025919	Ga0207657_10015169	Ga0207657_100151693	268
413	3300025920	Ga0207649_10121174	Ga0207649_101211742	268
414	3300025920	Ga0207649_10424848	Ga0207649_104248482	268
415	3300025921	Ga0207652_10108177	Ga0207652_101081773	268
416	3300025924	Ga0207694_10013250	Ga0207694_100132505	268
417	3300025924	Ga0207694_10201256	Ga0207694_102012562	268
418	3300025924	Ga0207694_10250615	Ga0207694_102506152	268
419	3300025927	Ga0207687_10042183	Ga0207687_100421833	268
420	3300025932	Ga0207690_10658273	Ga0207690_106582731	268
421	3300025933	Ga0207706_10043417	Ga0207706_100434173	268
422	3300025934	Ga0207686_10133402	Ga0207686_101334022	268
423	3300025935	Ga0207709_10089405	Ga0207709_100894052	268
424	3300025942	Ga0207689_10006649	Ga0207689_100066495	268
425	3300025942	Ga0207689_10045327	Ga0207689_100453274	268
426	3300025944	Ga0207661_10010606	Ga0207661_100106066	268
427	3300025949	Ga0207667_10113386	Ga0207667_101133862	268
428	3300025949	Ga0207667_10366421	Ga0207667_103664211	268
429	3300025960	Ga0207651_10004225	Ga0207651_100042254	268
430	3300025960	Ga0207651_10341308	Ga0207651_103413082	268
431	3300025972	Ga0207668_10351394	Ga0207668_103513942	268
432	3300025986	Ga0207658_10081303	Ga0207658_100813034	268
433	3300025986	Ga0207658_10120705	Ga0207658_101207051	268
434	3300026023	Ga0207677_10053455	Ga0207677_100534554	268
435	3300026023	Ga0207677_10496473	Ga0207677_104964731	268
436	3300026078	Ga0207702_10019924	Ga0207702_100199243	268
437	3300026078	Ga0207702_10082104	Ga0207702_100821043	268
438	3300026088	Ga0207641_10429212	Ga0207641_104292122	268
439	3300026089	Ga0207648_10005046	Ga0207648_100050465	268
440	3300026089	Ga0207648_10374803	Ga0207648_103748032	268
441	3300026095	Ga0207676_10419074	Ga0207676_104190742	268
442	3300026116	Ga0207674_10039324	Ga0207674_100393242	268
443	3300026116	Ga0207674_10061215	Ga0207674_100612155	268
444	3300026121	Ga0207683_10017878	Ga0207683_100178785	268
445	3300026121	Ga0207683_10249567	Ga0207683_102495672	268
446	3300026142	Ga0207698_10204159	Ga0207698_102041592	268
447	3300028379	Ga0268266_10000364	Ga0268266_1000036425	268
448	3300028379	Ga0268266_10051624	Ga0268266_100516244	268
449	3300028379	Ga0268266_10054107	Ga0268266_100541074	268
450	3300028379	Ga0268266_10075523	Ga0268266_100755234	268
451	3300028379	Ga0268266_10117275	Ga0268266_101172752	268
452	3300028380	Ga0268265_10663664	Ga0268265_106636641	268
453	3300028381	Ga0268264_10072797	Ga0268264_100727972	268
454	3300028381	Ga0268264_10396443	Ga0268264_103964432	268
455	3300028786	Ga0307517_10122661	Ga0307517_101226612	268
456	3300031235	Ga0265330_10047313	Ga0265330_100473132	268
457	3300031238	Ga0265332_10012985	Ga0265332_100129855	268
458	3300031241	Ga0265325_10010365	Ga0265325_100103652	268
459	3300031247	Ga0265340_10050332	Ga0265340_100503323	268
460	3300031249	Ga0265339_10054428	Ga0265339_100544283	268
461	3300031250	Ga0265331_10054651	Ga0265331_100546512	268
462	3300031344	Ga0265316_10161904	Ga0265316_101619042	268
463	3300031456	Ga0307513_10130404	Ga0307513_101304043	268
464	3300031595	Ga0265313_10008086	Ga0265313_100080864	268
465	3300031711	Ga0265314_10089259	Ga0265314_100892593	268
466	3300031711	Ga0265314_10166876	Ga0265314_101668761	268
467	3300031730	Ga0307516_10089170	Ga0307516_100891703	268
468	3300037418	Ga0395900_0158953	Ga0395900_0158953_464_1315	268
469	3300037466	Ga0395898_0037359	Ga0395898_0037359_1214_2065	268
470	3300039437	Ga0436365_0953174	Ga0436365_0953174_812_1630	268
471	3300039447	Ga0436361_0834326	Ga0436361_0834326_190_1023	268
472	3300044842	Ga0466957_0155033	Ga0466957_0155033_649_1467	268
473	3300046492	Ga0495585_0117124	Ga0495585_0117124_392_1198	268
474	3300046492	Ga0495585_0118095	Ga0495585_0118095_132_938	268
475	3300046506	Ga0495583_0046746	Ga0495583_0046746_50_856	268
476	3300046524	Ga0495648_0059063	Ga0495648_0059063_778_1584	268
477	3300046538	Ga0495609_0007942	Ga0495609_0007942_462_1268	268
478	3300046539	Ga0495621_0016789	Ga0495621_0016789_1440_2246	268
479	3300046557	Ga0495622_0022786	Ga0495622_0022786_1212_2018	268
480	3300046660	Ga0495625_0043550	Ga0495625_0043550_836_1645	268
481	3300046675	Ga0495657_0092451	Ga0495657_0092451_738_1544	268
482	3300046678	Ga0495599_0298606	Ga0495599_0298606_127_945	268
483	3300046694	Ga0495649_0218900	Ga0495649_0218900_97_903	268
484	3300049568	Ga0501031_0103190	Ga0501031_0103190_497_1303	268
485	3300049569	Ga0501032_0159079	Ga0501032_0159079_56_862	268
486	3300049573	Ga0501037_0024146	Ga0501037_0024146_1331_2137	268
487	3300049574	Ga0501038_0062751	Ga0501038_0062751_1947_2771	268
488	3300049579	Ga0501043_0263584	Ga0501043_0263584_288_1112	268
489	3300049581	Ga0501047_0033345	Ga0501047_0033345_4002_4814	268
490	3300049581	Ga0501047_0046465	Ga0501047_0046465_1725_2531	268
491	3300049584	Ga0501068_0134900	Ga0501068_0134900_163_972	268
492	3300049589	Ga0501073_0064330	Ga0501073_0064330_527_1336	268
493	3300049744	Ga0501083_0049025	Ga0501083_0049025_245_1054	268
494	3300049822	Ga0501035_0011950	Ga0501035_0011950_2910_3716	268
495	3300049822	Ga0501035_0021265	Ga0501035_0021265_2778_3590	268
496	3300049823	Ga0501044_0067923	Ga0501044_0067923_116_922	268
497	3300049823	Ga0501044_0095577	Ga0501044_0095577_1900_2712	268
498	3300049823	Ga0501044_0098331	Ga0501044_0098331_889_1713	268
499	3300053080	Ga0500635_0085573	Ga0500635_0085573_134_940	268
500	3300053087	Ga0500643_000017	Ga0500643_000017_90014_90823	268
501	3300053103	Ga0500555_014671	Ga0500555_014671_1317_2123	268
502	3300053103	Ga0500555_057916	Ga0500555_057916_188_997	268
503	3300053119	Ga0500595_000989	Ga0500595_000989_10530_11336	268
504	3300053119	Ga0500595_001075	Ga0500595_001075_9978_10784	268
505	3300053140	Ga0500573_0000055	Ga0500573_0000055_24423_25229	268
506	3300054114	Ga0501084_0026475	Ga0501084_0026475_3339_4148	268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

41

212

0.82 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7b1l-assembly1.cif.gz_A	crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate.	0.8333	33	261
2e2a-assembly1.cif.gz_C	asp81leu enzyme iia from the lactose specific pts from lactococcus lactis	0.7993	25	110
7b1l-assembly1.cif.gz_A	crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate.	0.7956	33	261
1e2a-assembly1.cif.gz_A	enzyme iia from the lactose specific pts from lactococcus lactis	0.7879	25	110
2e2a-assembly1.cif.gz_B	asp81leu enzyme iia from the lactose specific pts from lactococcus lactis	0.7637	23	110

ID	Description	Score	Start	End	Superfamily
af_P9WPG1_2_192_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.889	30	208	1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.8634	23	215	1.20.120.1760
af_E7F188_23_199_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.8597	20	216	1.20.120.1760
af_E7F188_23_199_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.8462	20	216	1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.8409	23	215	1.20.120.1760

ID	Description	Score	Start	End	GO Terms
AF-A0A6D0ZPL3-F1-model_v4	deleted	0.9912	29	137
AF-A0A7V3FWJ8-F1-model_v4	CDP-diacylglycerol--serine O-phosphatidyltransferase	0.98	25	132	GO:0008654 GO:0016020 GO:0016780
AF-A0A533IS59-F1-model_v4	deleted	0.9642	29	140
AF-A0A537QPP1-F1-model_v4	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase)	0.9594	28	259	GO:0003882 GO:0008444 GO:0008654 GO:0012505 GO:0016020
AF-A0A523FP67-F1-model_v4	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase)	0.9594	27	259	GO:0003882 GO:0008444 GO:0008654 GO:0012505 GO:0016020

Feature Viewer

pLDDT	pTM	Quality
79.78	0.74	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F456504

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

41

212

0.82

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map