F456527
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 506 | 273 | 507 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10072146|Ga0157379_100721463 |
| Length | 240 |
| Sequence | VWLCVVLGGPHAAFKLIPGGLGRGARATRTDFSYTVAGMTPKSANLVRCSWPGNPLAIRYHDEEWGSPQHDDLVLFEFLILEGAQAGLSWDTILQKRENYRAALDGFNPERIVRYDRRKLKSLLGNPGIIRNRLKIESTVRNASAFLQTQKEFGSFDAYIWRFVGGKPRVNAWRPGERVPASTPESDAMSKDLKKRGFNFVGSTICYAFMQATGMVNDHNVKCFRYAQLTKSAIKRSQAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 121 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.52 |
| Rhizosphere | 92.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1011365 | 3300001978 | Unclassified | 900 |
| 2 | JGI24743J22301_10000293 | 3300001991 | Bacteria | 5422 |
| 3 | JGI24738J21930_10038615 | 3300002075 | Unclassified | 970 |
| 4 | JGI24738J21930_10054479 | 3300002075 | Unclassified | 817 |
| 5 | JGI24033J26618_1006334 | 3300002155 | Bacteria | 1326 |
| 6 | JGI24034J26672_10002026 | 3300002239 | Bacteria | 2749 |
| 7 | rootH1_10024035 | 3300003316 | Bacteria | 8072 |
| 8 | rootH1_10024035 | 3300003323 | Bacteria | 75545 |
| 9 | Ga0065704_10004392 | 3300005289 | Unclassified | 3627 |
| 10 | Ga0065704_10296464 | 3300005289 | Bacteria | 892 |
| 11 | Ga0065715_10116360 | 3300005293 | Bacteria | 2384 |
| 12 | Ga0065707_10014157 | 3300005295 | Unclassified | 2066 |
| 13 | Ga0065707_10115750 | 3300005295 | Bacteria | 2257 |
| 14 | Ga0070658_10063359 | 3300005327 | Bacteria | 3014 |
| 15 | Ga0070683_100007493 | 3300005329 | Bacteria | 9224 |
| 16 | Ga0070690_100104267 | 3300005330 | Bacteria | 1883 |
| 17 | Ga0070670_100020760 | 3300005331 | Bacteria | 5647 |
| 18 | Ga0070670_100033325 | 3300005331 | Bacteria | 4436 |
| 19 | Ga0070677_10004665 | 3300005333 | Bacteria | 4485 |
| 20 | Ga0070666_10284686 | 3300005335 | Bacteria | 1175 |
| 21 | Ga0070666_10313917 | 3300005335 | Unclassified | 1117 |
| 22 | Ga0070682_100037463 | 3300005337 | Bacteria | 2969 |
| 23 | Ga0068868_100011209 | 3300005338 | Bacteria | 6528 |
| 24 | Ga0068868_100031743 | 3300005338 | Bacteria | 4060 |
| 25 | Ga0068868_100055714 | 3300005338 | Bacteria | 3120 |
| 26 | Ga0068868_100070039 | 3300005338 | Bacteria | 2796 |
| 27 | Ga0070660_100011061 | 3300005339 | Bacteria | 6398 |
| 28 | Ga0070689_100007514 | 3300005340 | Bacteria | 7627 |
| 29 | Ga0070687_100006117 | 3300005343 | Bacteria | 4915 |
| 30 | Ga0070661_100159243 | 3300005344 | Bacteria | 1709 |
| 31 | Ga0070668_100004857 | 3300005347 | Bacteria | 9958 |
| 32 | Ga0070669_100002184 | 3300005353 | Bacteria | 14162 |
| 33 | Ga0070675_100006210 | 3300005354 | Bacteria | 9164 |
| 34 | Ga0070671_100140064 | 3300005355 | Bacteria | 2041 |
| 35 | Ga0070674_100001002 | 3300005356 | Bacteria | 14730 |
| 36 | Ga0070673_100063181 | 3300005364 | Bacteria | 2945 |
| 37 | Ga0070688_100000618 | 3300005365 | Bacteria | 17777 |
| 38 | Ga0070688_100026891 | 3300005365 | Bacteria | 3423 |
| 39 | Ga0070659_100012377 | 3300005366 | Bacteria | 6326 |
| 40 | Ga0070709_10277867 | 3300005434 | Bacteria | 1216 |
| 41 | Ga0070714_100009459 | 3300005435 | Bacteria | 7664 |
| 42 | Ga0070714_100048131 | 3300005435 | Bacteria | 3625 |
| 43 | Ga0070714_100050229 | 3300005435 | Bacteria | 3552 |
| 44 | Ga0070714_100249108 | 3300005435 | Bacteria | 1642 |
| 45 | Ga0070713_100003033 | 3300005436 | Bacteria | 11033 |
| 46 | Ga0070713_100005047 | 3300005436 | Bacteria | 8976 |
| 47 | Ga0070713_100014086 | 3300005436 | Bacteria | 5922 |
| 48 | Ga0070713_100126931 | 3300005436 | Bacteria | 2245 |
| 49 | Ga0070713_100414360 | 3300005436 | Bacteria | 1260 |
| 50 | Ga0070710_10036205 | 3300005437 | Bacteria | 2697 |
| 51 | Ga0070710_10161514 | 3300005437 | Bacteria | 1390 |
| 52 | Ga0070711_100000088 | 3300005439 | Bacteria | 50242 |
| 53 | Ga0070708_100000372 | 3300005445 | Bacteria | 33949 |
| 54 | Ga0070708_100045053 | 3300005445 | Bacteria | 3884 |
| 55 | Ga0070708_100140285 | 3300005445 | Bacteria | 2241 |
| 56 | Ga0070708_100262237 | 3300005445 | Bacteria | 1624 |
| 57 | Ga0070663_100215516 | 3300005455 | Bacteria | 1505 |
| 58 | Ga0070678_100031605 | 3300005456 | Bacteria | 3655 |
| 59 | Ga0070662_100028109 | 3300005457 | Bacteria | 3911 |
| 60 | Ga0070662_100045611 | 3300005457 | Bacteria | 3146 |
| 61 | Ga0070681_10282368 | 3300005458 | Bacteria | 1571 |
| 62 | Ga0070681_10586987 | 3300005458 | Bacteria | 1028 |
| 63 | Ga0068867_100068604 | 3300005459 | Bacteria | 2646 |
| 64 | Ga0068867_100097363 | 3300005459 | Bacteria | 2242 |
| 65 | Ga0068867_100310260 | 3300005459 | Bacteria | 1303 |
| 66 | Ga0070685_10004460 | 3300005466 | Bacteria | 7079 |
| 67 | Ga0070685_10191446 | 3300005466 | Bacteria | 1323 |
| 68 | Ga0070706_100011146 | 3300005467 | Bacteria | 8345 |
| 69 | Ga0070706_100014149 | 3300005467 | Bacteria | 7373 |
| 70 | Ga0070706_100034560 | 3300005467 | Bacteria | 4670 |
| 71 | Ga0070706_100035747 | 3300005467 | Bacteria | 4587 |
| 72 | Ga0070707_100032068 | 3300005468 | Bacteria | 5005 |
| 73 | Ga0070707_100053877 | 3300005468 | Bacteria | 3856 |
| 74 | Ga0070707_100429417 | 3300005468 | Bacteria | 1282 |
| 75 | Ga0070698_100003025 | 3300005471 | Bacteria | 18536 |
| 76 | Ga0070698_100141468 | 3300005471 | Bacteria | 2357 |
| 77 | Ga0070698_100411869 | 3300005471 | Bacteria | 1286 |
| 78 | Ga0070698_100628867 | 3300005471 | Bacteria | 1014 |
| 79 | Ga0070699_100001645 | 3300005518 | Bacteria | 20397 |
| 80 | Ga0070699_100027284 | 3300005518 | Bacteria | 4927 |
| 81 | Ga0070699_100097457 | 3300005518 | Bacteria | 2576 |
| 82 | Ga0070679_100081066 | 3300005530 | Bacteria | 3234 |
| 83 | Ga0070679_100150299 | 3300005530 | Bacteria | 2306 |
| 84 | Ga0070684_100001860 | 3300005535 | Bacteria | 15457 |
| 85 | Ga0070697_100001000 | 3300005536 | Bacteria | 21314 |
| 86 | Ga0070697_100001970 | 3300005536 | Bacteria | 15701 |
| 87 | Ga0070697_100143837 | 3300005536 | Bacteria | 2006 |
| 88 | Ga0070697_100750157 | 3300005536 | Bacteria | 863 |
| 89 | Ga0070697_101204151 | 3300005536 | Bacteria | 675 |
| 90 | Ga0068853_100191802 | 3300005539 | Bacteria | 1857 |
| 91 | Ga0068853_100321261 | 3300005539 | Bacteria | 1435 |
| 92 | Ga0070672_100245973 | 3300005543 | Bacteria | 1505 |
| 93 | Ga0070695_100502080 | 3300005545 | Bacteria | 938 |
| 94 | Ga0070693_100096541 | 3300005547 | Bacteria | 1792 |
| 95 | Ga0070693_100252817 | 3300005547 | Unclassified | 1169 |
| 96 | Ga0068855_100022413 | 3300005563 | Bacteria | 7570 |
| 97 | Ga0068855_100378380 | 3300005563 | Bacteria | 1555 |
| 98 | Ga0068855_100424747 | 3300005563 | Bacteria | 1453 |
| 99 | Ga0068855_100632156 | 3300005563 | Bacteria | 1151 |
| 100 | Ga0070664_100009579 | 3300005564 | Bacteria | 7856 |
| 101 | Ga0070664_100183003 | 3300005564 | Bacteria | 1863 |
| 102 | Ga0068857_100003629 | 3300005577 | Bacteria | 12931 |
| 103 | Ga0068854_100093594 | 3300005578 | Bacteria | 2240 |
| 104 | Ga0068854_100131227 | 3300005578 | Bacteria | 1914 |
| 105 | Ga0068856_100012749 | 3300005614 | Bacteria | 8138 |
| 106 | Ga0068856_100261225 | 3300005614 | Bacteria | 1747 |
| 107 | Ga0068856_101094457 | 3300005614 | Bacteria | 814 |
| 108 | Ga0070702_100143575 | 3300005615 | Bacteria | 1523 |
| 109 | Ga0070702_100174134 | 3300005615 | Bacteria | 1402 |
| 110 | Ga0068852_100029544 | 3300005616 | Bacteria | 4505 |
| 111 | Ga0068852_100307740 | 3300005616 | Bacteria | 1535 |
| 112 | Ga0068859_100014872 | 3300005617 | Bacteria | 7815 |
| 113 | Ga0068859_100627285 | 3300005617 | Bacteria | 1167 |
| 114 | Ga0068864_100288990 | 3300005618 | Bacteria | 1532 |
| 115 | Ga0068864_100501834 | 3300005618 | Bacteria | 1167 |
| 116 | Ga0068864_100586170 | 3300005618 | Bacteria | 1081 |
| 117 | Ga0068864_100868575 | 3300005618 | Bacteria | 889 |
| 118 | Ga0068866_10005774 | 3300005718 | Bacteria | 5131 |
| 119 | Ga0068866_10405716 | 3300005718 | Bacteria | 880 |
| 120 | Ga0068861_100030010 | 3300005719 | Bacteria | 3982 |
| 121 | Ga0068851_10001293 | 3300005834 | Bacteria | 10917 |
| 122 | Ga0068870_10065757 | 3300005840 | Bacteria | 1962 |
| 123 | Ga0068863_100212440 | 3300005841 | Bacteria | 1863 |
| 124 | Ga0068863_100560552 | 3300005841 | Bacteria | 1129 |
| 125 | Ga0068863_100975050 | 3300005841 | Bacteria | 850 |
| 126 | Ga0068863_101092855 | 3300005841 | Bacteria | 802 |
| 127 | Ga0068863_101147225 | 3300005841 | Bacteria | 782 |
| 128 | Ga0068858_100034480 | 3300005842 | Bacteria | 4695 |
| 129 | Ga0068858_100089967 | 3300005842 | Bacteria | 2856 |
| 130 | Ga0068860_100215427 | 3300005843 | Bacteria | 1863 |
| 131 | Ga0068860_101525515 | 3300005843 | Bacteria | 690 |
| 132 | Ga0068862_100139313 | 3300005844 | Bacteria | 2152 |
| 133 | Ga0081538_10106523 | 3300005981 | Bacteria | 1391 |
| 134 | Ga0070717_10159030 | 3300006028 | Bacteria | 1959 |
| 135 | Ga0070717_10186710 | 3300006028 | Bacteria | 1810 |
| 136 | Ga0070717_10288270 | 3300006028 | Bacteria | 1457 |
| 137 | Ga0070717_10342789 | 3300006028 | Bacteria | 1335 |
| 138 | Ga0070717_10503490 | 3300006028 | Bacteria | 1095 |
| 139 | Ga0070715_10011542 | 3300006163 | Bacteria | 3185 |
| 140 | Ga0070716_100012833 | 3300006173 | Bacteria | 4258 |
| 141 | Ga0070716_100039961 | 3300006173 | Bacteria | 2607 |
| 142 | Ga0070716_100351720 | 3300006173 | Unclassified | 1043 |
| 143 | Ga0070716_100703760 | 3300006173 | Bacteria | 772 |
| 144 | Ga0070712_100001023 | 3300006175 | Bacteria | 16868 |
| 145 | Ga0070712_100037626 | 3300006175 | Bacteria | 3300 |
| 146 | Ga0097621_100002942 | 3300006237 | Bacteria | 11702 |
| 147 | Ga0097621_100003025 | 3300006237 | Bacteria | 11549 |
| 148 | Ga0097621_100127536 | 3300006237 | Bacteria | 2162 |
| 149 | Ga0097621_100169529 | 3300006237 | Bacteria | 1881 |
| 150 | Ga0097621_100198573 | 3300006237 | Bacteria | 1740 |
| 151 | Ga0068871_100005057 | 3300006358 | Bacteria | 9209 |
| 152 | Ga0068871_100134300 | 3300006358 | Bacteria | 2100 |
| 153 | Ga0068871_101172486 | 3300006358 | Bacteria | 720 |
| 154 | Ga0075428_100470396 | 3300006844 | Bacteria | 1346 |
| 155 | Ga0075430_100059460 | 3300006846 | Bacteria | 3213 |
| 156 | Ga0075431_100200094 | 3300006847 | Bacteria | 2044 |
| 157 | Ga0075433_10061476 | 3300006852 | Bacteria | 3290 |
| 158 | Ga0075433_10208223 | 3300006852 | Bacteria | 1738 |
| 159 | Ga0075433_10239252 | 3300006852 | Bacteria | 1612 |
| 160 | Ga0075434_100029506 | 3300006871 | Bacteria | 5398 |
| 161 | Ga0075434_100056456 | 3300006871 | Bacteria | 3902 |
| 162 | Ga0075434_100928863 | 3300006871 | Bacteria | 885 |
| 163 | Ga0075434_100945974 | 3300006871 | Bacteria | 876 |
| 164 | Ga0068865_100014699 | 3300006881 | Bacteria | 4980 |
| 165 | Ga0075436_100125810 | 3300006914 | Bacteria | 1796 |
| 166 | Ga0075436_100321267 | 3300006914 | Bacteria | 1112 |
| 167 | Ga0097620_100014872 | 3300006931 | Bacteria | 7815 |
| 168 | Ga0097620_100627238 | 3300006931 | Bacteria | 1167 |
| 169 | Ga0075435_100041786 | 3300007076 | Bacteria | 3666 |
| 170 | Ga0075435_100289109 | 3300007076 | Bacteria | 1400 |
| 171 | Ga0075435_100303677 | 3300007076 | Bacteria | 1365 |
| 172 | Ga0099794_10215525 | 3300007265 | Bacteria | 985 |
| 173 | Ga0099795_10184031 | 3300007788 | Bacteria | 874 |
| 174 | Ga0105240_10138512 | 3300009093 | Bacteria | 2912 |
| 175 | Ga0105240_10139423 | 3300009093 | Bacteria | 2900 |
| 176 | Ga0105240_10272894 | 3300009093 | Bacteria | 1946 |
| 177 | Ga0105240_10611337 | 3300009093 | Unclassified | 1199 |
| 178 | Ga0105245_10011327 | 3300009098 | Bacteria | 7765 |
| 179 | Ga0105245_10036717 | 3300009098 | Bacteria | 4354 |
| 180 | Ga0105245_10161933 | 3300009098 | Bacteria | 2124 |
| 181 | Ga0105245_10479720 | 3300009098 | Bacteria | 1257 |
| 182 | Ga0105247_10002094 | 3300009101 | Bacteria | 13797 |
| 183 | Ga0105247_10258786 | 3300009101 | Bacteria | 1192 |
| 184 | Ga0114129_10016072 | 3300009147 | Bacteria | 10647 |
| 185 | Ga0114129_10130655 | 3300009147 | Bacteria | 3449 |
| 186 | Ga0114129_10270317 | 3300009147 | Bacteria | 2274 |
| 187 | Ga0114129_10823997 | 3300009147 | Bacteria | 1182 |
| 188 | Ga0105241_10011865 | 3300009174 | Bacteria | 6402 |
| 189 | Ga0105241_10026094 | 3300009174 | Bacteria | 4346 |
| 190 | Ga0105241_10428352 | 3300009174 | Bacteria | 1166 |
| 191 | Ga0105242_10017421 | 3300009176 | Bacteria | 5599 |
| 192 | Ga0105242_10019497 | 3300009176 | Bacteria | 5315 |
| 193 | Ga0105242_10056543 | 3300009176 | Bacteria | 3211 |
| 194 | Ga0105248_10053100 | 3300009177 | Bacteria | 4548 |
| 195 | Ga0105248_10067707 | 3300009177 | Bacteria | 4009 |
| 196 | Ga0105248_10974855 | 3300009177 | Bacteria | 957 |
| 197 | Ga0105248_11423632 | 3300009177 | Bacteria | 784 |
| 198 | Ga0105237_10200491 | 3300009545 | Bacteria | 1995 |
| 199 | Ga0105237_10292693 | 3300009545 | Bacteria | 1631 |
| 200 | Ga0105238_10120868 | 3300009551 | Bacteria | 2598 |
| 201 | Ga0105249_10009154 | 3300009553 | Bacteria | 8659 |
| 202 | Ga0105249_10163504 | 3300009553 | Bacteria | 2153 |
| 203 | Ga0105249_10229856 | 3300009553 | Bacteria | 1829 |
| 204 | Ga0099796_10013153 | 3300010159 | Bacteria | 2356 |
| 205 | Ga0105239_10004244 | 3300010375 | Bacteria | 17209 |
| 206 | Ga0105239_10039817 | 3300010375 | Bacteria | 5149 |
| 207 | Ga0105246_10006082 | 3300011119 | Bacteria | 7364 |
| 208 | Ga0157373_10037404 | 3300013100 | Bacteria | 3479 |
| 209 | Ga0157373_10065793 | 3300013100 | Bacteria | 2565 |
| 210 | Ga0157371_10007472 | 3300013102 | Bacteria | 8844 |
| 211 | Ga0157370_10374437 | 3300013104 | Bacteria | 1312 |
| 212 | Ga0157370_10396412 | 3300013104 | Bacteria | 1271 |
| 213 | Ga0157369_10008874 | 3300013105 | Bacteria | 11517 |
| 214 | Ga0157369_10647107 | 3300013105 | Bacteria | 1090 |
| 215 | Ga0157374_10009612 | 3300013296 | Bacteria | 8307 |
| 216 | Ga0157374_10129214 | 3300013296 | Bacteria | 2444 |
| 217 | Ga0157374_10547261 | 3300013296 | Bacteria | 1165 |
| 218 | Ga0157374_10678244 | 3300013296 | Bacteria | 1043 |
| 219 | Ga0157374_10800591 | 3300013296 | Bacteria | 958 |
| 220 | Ga0157378_10001446 | 3300013297 | Bacteria | 21385 |
| 221 | Ga0157378_10003132 | 3300013297 | Bacteria | 14698 |
| 222 | Ga0157378_10034794 | 3300013297 | Bacteria | 4455 |
| 223 | Ga0157378_10203194 | 3300013297 | Bacteria | 1875 |
| 224 | Ga0157378_10362598 | 3300013297 | Bacteria | 1418 |
| 225 | Ga0163162_10072102 | 3300013306 | Bacteria | 3508 |
| 226 | Ga0163162_10375724 | 3300013306 | Bacteria | 1554 |
| 227 | Ga0163162_10905856 | 3300013306 | Bacteria | 995 |
| 228 | Ga0157372_10009715 | 3300013307 | Bacteria | 10231 |
| 229 | Ga0157375_10058244 | 3300013308 | Bacteria | 3821 |
| 230 | Ga0157375_10240499 | 3300013308 | Bacteria | 1970 |
| 231 | Ga0157375_10537279 | 3300013308 | Bacteria | 1331 |
| 232 | Ga0163163_10001263 | 3300014325 | Bacteria | 21347 |
| 233 | Ga0163163_10073698 | 3300014325 | Bacteria | 3405 |
| 234 | Ga0163163_10427379 | 3300014325 | Bacteria | 1384 |
| 235 | Ga0163163_11327650 | 3300014325 | Bacteria | 781 |
| 236 | Ga0157380_10016601 | 3300014326 | Bacteria | 5434 |
| 237 | Ga0182008_10143790 | 3300014497 | Bacteria | 1194 |
| 238 | Ga0157377_10000395 | 3300014745 | Bacteria | 18883 |
| 239 | Ga0157379_10010509 | 3300014968 | Bacteria | 8069 |
| 240 | Ga0157379_10072146 | 3300014968 | Bacteria | 3089 |
| 241 | Ga0157379_10143664 | 3300014968 | Bacteria | 2152 |
| 242 | Ga0157379_10393568 | 3300014968 | Bacteria | 1273 |
| 243 | Ga0157379_10859857 | 3300014968 | Bacteria | 859 |
| 244 | Ga0157376_10015792 | 3300014969 | Bacteria | 5713 |
| 245 | Ga0157376_10589341 | 3300014969 | Bacteria | 1105 |
| 246 | Ga0182006_1045441 | 3300015261 | Bacteria | 1709 |
| 247 | Ga0182007_10054360 | 3300015262 | Bacteria | 1317 |
| 248 | Ga0163161_10010982 | 3300017792 | Bacteria | 6275 |
| 249 | Ga0206353_11610671 | 3300020082 | Bacteria | 3579 |
| 250 | Ga0224569_104478 | 3300022732 | Bacteria | 1055 |
| 251 | Ga0228598_1000500 | 3300024227 | Bacteria | 8100 |
| 252 | Ga0228598_1031093 | 3300024227 | Bacteria | 1051 |
| 253 | Ga0207697_10000518 | 3300025315 | Bacteria | 21729 |
| 254 | Ga0207692_10056376 | 3300025898 | Bacteria | 2015 |
| 255 | Ga0207692_10070927 | 3300025898 | Bacteria | 1835 |
| 256 | Ga0207642_10139704 | 3300025899 | Bacteria | 1275 |
| 257 | Ga0207642_10212981 | 3300025899 | Bacteria | 1075 |
| 258 | Ga0207710_10025813 | 3300025900 | Bacteria | 2537 |
| 259 | Ga0207688_10025189 | 3300025901 | Bacteria | 3266 |
| 260 | Ga0207680_10001286 | 3300025903 | Bacteria | 11881 |
| 261 | Ga0207647_10004047 | 3300025904 | Bacteria | 10920 |
| 262 | Ga0207699_10007868 | 3300025906 | Bacteria | 5227 |
| 263 | Ga0207699_10111524 | 3300025906 | Bacteria | 1754 |
| 264 | Ga0207645_10000351 | 3300025907 | Bacteria | 38347 |
| 265 | Ga0207643_10001192 | 3300025908 | Bacteria | 15359 |
| 266 | Ga0207705_10270407 | 3300025909 | Unclassified | 1299 |
| 267 | Ga0207684_10000343 | 3300025910 | Bacteria | 64775 |
| 268 | Ga0207684_10024334 | 3300025910 | Bacteria | 5164 |
| 269 | Ga0207684_10034425 | 3300025910 | Bacteria | 4304 |
| 270 | Ga0207684_10116985 | 3300025910 | Bacteria | 2284 |
| 271 | Ga0207707_10002986 | 3300025912 | Bacteria | 15042 |
| 272 | Ga0207707_10026135 | 3300025912 | Bacteria | 5105 |
| 273 | Ga0207707_10052522 | 3300025912 | Bacteria | 3548 |
| 274 | Ga0207707_10414335 | 3300025912 | Bacteria | 1156 |
| 275 | Ga0207695_10003555 | 3300025913 | Bacteria | 21825 |
| 276 | Ga0207695_10116775 | 3300025913 | Bacteria | 2642 |
| 277 | Ga0207695_10354910 | 3300025913 | Bacteria | 1353 |
| 278 | Ga0207693_10000235 | 3300025915 | Bacteria | 50962 |
| 279 | Ga0207693_10000917 | 3300025915 | Bacteria | 26443 |
| 280 | Ga0207693_10215247 | 3300025915 | Bacteria | 1510 |
| 281 | Ga0207663_10011339 | 3300025916 | Bacteria | 4784 |
| 282 | Ga0207663_10108409 | 3300025916 | Bacteria | 1880 |
| 283 | Ga0207663_10186270 | 3300025916 | Bacteria | 1486 |
| 284 | Ga0207660_10126061 | 3300025917 | Unclassified | 1944 |
| 285 | Ga0207662_10009503 | 3300025918 | Bacteria | 5355 |
| 286 | Ga0207657_10004756 | 3300025919 | Bacteria | 14337 |
| 287 | Ga0207649_10000928 | 3300025920 | Bacteria | 18426 |
| 288 | Ga0207649_10097644 | 3300025920 | Bacteria | 1937 |
| 289 | Ga0207652_10168724 | 3300025921 | Bacteria | 1963 |
| 290 | Ga0207646_10000566 | 3300025922 | Bacteria | 48722 |
| 291 | Ga0207646_10199650 | 3300025922 | Bacteria | 1806 |
| 292 | Ga0207681_10006380 | 3300025923 | Bacteria | 7240 |
| 293 | Ga0207694_10000373 | 3300025924 | Bacteria | 41710 |
| 294 | Ga0207694_10067120 | 3300025924 | Bacteria | 2800 |
| 295 | Ga0207650_10000059 | 3300025925 | Bacteria | 151427 |
| 296 | Ga0207650_10686686 | 3300025925 | Bacteria | 864 |
| 297 | Ga0207659_10007240 | 3300025926 | Bacteria | 6817 |
| 298 | Ga0207687_10122961 | 3300025927 | Bacteria | 1943 |
| 299 | Ga0207687_10144991 | 3300025927 | Bacteria | 1805 |
| 300 | Ga0207700_10051984 | 3300025928 | Bacteria | 3061 |
| 301 | Ga0207700_10062960 | 3300025928 | Bacteria | 2819 |
| 302 | Ga0207700_10149593 | 3300025928 | Bacteria | 1928 |
| 303 | Ga0207700_10318179 | 3300025928 | Unclassified | 1348 |
| 304 | Ga0207664_10031786 | 3300025929 | Bacteria | 4042 |
| 305 | Ga0207664_10080151 | 3300025929 | Bacteria | 2653 |
| 306 | Ga0207644_10002945 | 3300025931 | Bacteria | 10965 |
| 307 | Ga0207644_10717888 | 3300025931 | Bacteria | 834 |
| 308 | Ga0207690_10039695 | 3300025932 | Bacteria | 3072 |
| 309 | Ga0207706_10002202 | 3300025933 | Bacteria | 18999 |
| 310 | Ga0207706_10013693 | 3300025933 | Bacteria | 7361 |
| 311 | Ga0207686_10009371 | 3300025934 | Bacteria | 5310 |
| 312 | Ga0207686_10153171 | 3300025934 | Bacteria | 1607 |
| 313 | Ga0207670_10317864 | 3300025936 | Unclassified | 1224 |
| 314 | Ga0207669_10037058 | 3300025937 | Bacteria | 2794 |
| 315 | Ga0207669_10215404 | 3300025937 | Bacteria | 1405 |
| 316 | Ga0207704_10003936 | 3300025938 | Bacteria | 6751 |
| 317 | Ga0207665_10012740 | 3300025939 | Bacteria | 5529 |
| 318 | Ga0207665_10013558 | 3300025939 | Bacteria | 5361 |
| 319 | Ga0207665_10019479 | 3300025939 | Bacteria | 4461 |
| 320 | Ga0207665_10062347 | 3300025939 | Bacteria | 2530 |
| 321 | Ga0207691_10002027 | 3300025940 | Bacteria | 19823 |
| 322 | Ga0207691_10657861 | 3300025940 | Bacteria | 885 |
| 323 | Ga0207711_10003820 | 3300025941 | Bacteria | 12956 |
| 324 | Ga0207711_10084342 | 3300025941 | Bacteria | 2781 |
| 325 | Ga0207711_10236252 | 3300025941 | Bacteria | 1675 |
| 326 | Ga0207689_10464124 | 3300025942 | Unclassified | 1059 |
| 327 | Ga0207661_10000352 | 3300025944 | Bacteria | 29636 |
| 328 | Ga0207679_10000039 | 3300025945 | Bacteria | 127661 |
| 329 | Ga0207679_10278763 | 3300025945 | Bacteria | 1433 |
| 330 | Ga0207667_10151991 | 3300025949 | Bacteria | 2382 |
| 331 | Ga0207712_10149179 | 3300025961 | Bacteria | 1804 |
| 332 | Ga0207712_10449391 | 3300025961 | Unclassified | 1093 |
| 333 | Ga0207668_10665411 | 3300025972 | Unclassified | 912 |
| 334 | Ga0207640_10199569 | 3300025981 | Bacteria | 1515 |
| 335 | Ga0207640_10616722 | 3300025981 | Bacteria | 920 |
| 336 | Ga0207658_10003811 | 3300025986 | Bacteria | 10616 |
| 337 | Ga0207677_10022187 | 3300026023 | Bacteria | 3897 |
| 338 | Ga0207677_10022240 | 3300026023 | Bacteria | 3893 |
| 339 | Ga0207677_10042875 | 3300026023 | Bacteria | 3004 |
| 340 | Ga0207703_10003512 | 3300026035 | Bacteria | 13111 |
| 341 | Ga0207703_10107745 | 3300026035 | Bacteria | 2372 |
| 342 | Ga0207639_10020333 | 3300026041 | Bacteria | 4750 |
| 343 | Ga0207639_10040122 | 3300026041 | Bacteria | 3492 |
| 344 | Ga0207639_10050254 | 3300026041 | Unclassified | 3166 |
| 345 | Ga0207678_10001428 | 3300026067 | Bacteria | 21910 |
| 346 | Ga0207678_10012262 | 3300026067 | Bacteria | 7526 |
| 347 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 348 | Ga0207648_10000420 | 3300026089 | Bacteria | 46606 |
| 349 | Ga0207648_10095946 | 3300026089 | Bacteria | 2595 |
| 350 | Ga0207648_10154398 | 3300026089 | Bacteria | 2026 |
| 351 | Ga0207648_10198181 | 3300026089 | Bacteria | 1781 |
| 352 | Ga0207676_10000104 | 3300026095 | Bacteria | 74872 |
| 353 | Ga0207676_10010310 | 3300026095 | Bacteria | 6654 |
| 354 | Ga0207676_10184284 | 3300026095 | Bacteria | 1831 |
| 355 | Ga0207674_10000604 | 3300026116 | Bacteria | 47244 |
| 356 | Ga0207674_10048267 | 3300026116 | Bacteria | 4358 |
| 357 | Ga0207675_100025053 | 3300026118 | Bacteria | 5552 |
| 358 | Ga0207675_100451770 | 3300026118 | Bacteria | 1273 |
| 359 | Ga0207683_10000726 | 3300026121 | Bacteria | 29917 |
| 360 | Ga0207698_10129371 | 3300026142 | Bacteria | 2154 |
| 361 | Ga0209588_1028186 | 3300027671 | Bacteria | 1787 |
| 362 | Ga0209971_1014569 | 3300027682 | Bacteria | 1864 |
| 363 | Ga0268266_10004403 | 3300028379 | Bacteria | 13498 |
| 364 | Ga0268266_10407088 | 3300028379 | Bacteria | 1287 |
| 365 | Ga0268265_10028564 | 3300028380 | Bacteria | 3994 |
| 366 | Ga0268264_11206053 | 3300028381 | Unclassified | 766 |
| 367 | Ga0268264_11236497 | 3300028381 | Bacteria | 757 |
| 368 | Ga0265334_10027748 | 3300028573 | Bacteria | 2278 |
| 369 | Ga0265338_10009983 | 3300028800 | Bacteria | 11226 |
| 370 | Ga0265338_10018073 | 3300028800 | Bacteria | 7565 |
| 371 | Ga0265324_10025469 | 3300029957 | Bacteria | 2097 |
| 372 | Ga0265324_10068170 | 3300029957 | Bacteria | 1213 |
| 373 | Ga0265762_1000054 | 3300030760 | Bacteria | 14200 |
| 374 | Ga0265325_10177884 | 3300031241 | Bacteria | 992 |
| 375 | Ga0265340_10002940 | 3300031247 | Bacteria | 9706 |
| 376 | Ga0265339_10003616 | 3300031249 | Bacteria | 10790 |
| 377 | Ga0265339_10039467 | 3300031249 | Bacteria | 2628 |
| 378 | Ga0265316_10017341 | 3300031344 | Bacteria | 6229 |
| 379 | Ga0265316_10044782 | 3300031344 | Bacteria | 3517 |
| 380 | Ga0265316_10067485 | 3300031344 | Bacteria | 2766 |
| 381 | Ga0265313_10084322 | 3300031595 | Bacteria | 1438 |
| 382 | Ga0265314_10054191 | 3300031711 | Bacteria | 2776 |
| 383 | Ga0265342_10077720 | 3300031712 | Bacteria | 1921 |
| 384 | Ga0307406_10054824 | 3300031901 | Bacteria | 2546 |
| 385 | Ga0307406_10083263 | 3300031901 | Bacteria | 2133 |
| 386 | Ga0307406_10813718 | 3300031901 | Bacteria | 789 |
| 387 | Ga0307412_10484035 | 3300031911 | Bacteria | 1027 |
| 388 | Ga0307416_100737355 | 3300032002 | Bacteria | 1077 |
| 389 | Ga0307415_100204175 | 3300032126 | Bacteria | 1571 |
| 390 | Ga0316214_1015830 | 3300033545 | Bacteria | 1041 |
| 391 | Ga0373926_0135321 | 3300035083 | Bacteria | 935 |
| 392 | Ga0373923_0074198 | 3300035111 | Bacteria | 1466 |
| 393 | Ga0373936_0007973 | 3300035113 | Bacteria | 3980 |
| 394 | Ga0373945_0040414 | 3300035116 | Bacteria | 1684 |
| 395 | Ga0373956_0107317 | 3300035119 | Bacteria | 1298 |
| 396 | Ga0373943_0589193 | 3300035170 | Bacteria | 654 |
| 397 | Ga0373955_0001911 | 3300035172 | Bacteria | 8994 |
| 398 | Ga0373955_0348459 | 3300035172 | Bacteria | 897 |
| 399 | Ga0373924_0023551 | 3300035410 | Bacteria | 2418 |
| 400 | Ga0373931_0079635 | 3300035691 | Bacteria | 1805 |
| 401 | Ga0373927_0185106 | 3300035695 | Bacteria | 1366 |
| 402 | Ga0373933_0094760 | 3300035724 | Bacteria | 1846 |
| 403 | Ga0373947_0019871 | 3300035725 | Bacteria | 3877 |
| 404 | Ga0373947_0178513 | 3300035725 | Bacteria | 1381 |
| 405 | Ga0373937_0002384 | 3300036401 | Bacteria | 15640 |
| 406 | Ga0373937_0189818 | 3300036401 | Bacteria | 1930 |
| 407 | Ga0373937_0342679 | 3300036401 | Bacteria | 1415 |
| 408 | Ga0373925_0018793 | 3300037068 | Bacteria | 5023 |
| 409 | Ga0373925_0022953 | 3300037068 | Bacteria | 4553 |
| 410 | Ga0436364_0478514 | 3300037853 | Bacteria | 578677 |
| 411 | Ga0395901_0085256 | 3300038443 | Bacteria | 3302 |
| 412 | Ga0436363_1034869 | 3300039450 | Unclassified | 1428 |
| 413 | Ga0436363_1104128 | 3300039450 | Bacteria | 1026 |
| 414 | Ga0451807_1173178 | 3300041486 | Unclassified | 1763 |
| 415 | Ga0451853_1364154 | 3300041512 | Bacteria | 853 |
| 416 | Ga0453684_0431164 | 3300044712 | Bacteria | 1471 |
| 417 | Ga0453684_0745605 | 3300044712 | Bacteria | 1060 |
| 418 | Ga0495629_0115632 | 3300046459 | Bacteria | 1869 |
| 419 | Ga0495629_0284187 | 3300046459 | Bacteria | 1135 |
| 420 | Ga0495653_0174966 | 3300046463 | Bacteria | 1478 |
| 421 | Ga0495580_0002574 | 3300046472 | Bacteria | 15779 |
| 422 | Ga0495580_0016659 | 3300046472 | Bacteria | 5515 |
| 423 | Ga0495580_0162797 | 3300046472 | Bacteria | 1544 |
| 424 | Ga0495582_0001652 | 3300046473 | Bacteria | 12577 |
| 425 | Ga0495639_0074505 | 3300046475 | Bacteria | 1573 |
| 426 | Ga0495662_0282625 | 3300046476 | Bacteria | 817 |
| 427 | Ga0495664_0468215 | 3300046477 | Bacteria | 754 |
| 428 | Ga0495630_0002261 | 3300046517 | Bacteria | 13411 |
| 429 | Ga0495630_0035927 | 3300046517 | Bacteria | 3704 |
| 430 | Ga0495665_0041486 | 3300046531 | Bacteria | 2450 |
| 431 | Ga0495665_0143922 | 3300046531 | Bacteria | 1245 |
| 432 | Ga0495640_0103137 | 3300046533 | Bacteria | 1871 |
| 433 | Ga0495645_0040763 | 3300046543 | Bacteria | 3386 |
| 434 | Ga0495667_0044371 | 3300046559 | Bacteria | 2945 |
| 435 | Ga0495588_0388387 | 3300046674 | Bacteria | 733 |
| 436 | Ga0495599_0024973 | 3300046678 | Bacteria | 3738 |
| 437 | Ga0495658_0022331 | 3300046683 | Bacteria | 3345 |
| 438 | Ga0495613_0092847 | 3300046689 | Bacteria | 2185 |
| 439 | Ga0495613_0428979 | 3300046689 | Bacteria | 898 |
| 440 | Ga0495624_0214132 | 3300046690 | Bacteria | 1168 |
| 441 | Ga0495604_0432944 | 3300047317 | Bacteria | 862 |
| 442 | Ga0495674_0027723 | 3300047319 | Bacteria | 5172 |
| 443 | Ga0495684_0015204 | 3300047471 | Bacteria | 5927 |
| 444 | Ga0495684_0251055 | 3300047471 | Bacteria | 1287 |
| 445 | Ga0495602_0009589 | 3300048088 | Bacteria | 10064 |
| 446 | Ga0495602_0166657 | 3300048088 | Bacteria | 1714 |
| 447 | Ga0496100_0094863 | 3300048903 | Bacteria | 2044 |
| 448 | Ga0496100_0169131 | 3300048903 | Bacteria | 1572 |
| 449 | Ga0496100_0276717 | 3300048903 | Bacteria | 1250 |
| 450 | Ga0496101_0007762 | 3300048904 | Bacteria | 6973 |
| 451 | Ga0496101_0492645 | 3300048904 | Bacteria | 968 |
| 452 | Ga0496102_0008957 | 3300048905 | Bacteria | 8584 |
| 453 | Ga0496102_0622053 | 3300048905 | Bacteria | 1003 |
| 454 | Ga0496102_0834322 | 3300048905 | Bacteria | 844 |
| 455 | Ga0496103_0002761 | 3300048906 | Bacteria | 10929 |
| 456 | Ga0496104_0016605 | 3300048907 | Bacteria | 6690 |
| 457 | Ga0496104_0019128 | 3300048907 | Bacteria | 6261 |
| 458 | Ga0496104_0316433 | 3300048907 | Unclassified | 1474 |
| 459 | Ga0496105_0062761 | 3300048908 | Bacteria | 3066 |
| 460 | Ga0496105_0475092 | 3300048908 | Bacteria | 984 |
| 461 | Ga0496106_0177283 | 3300048909 | Bacteria | 1691 |
| 462 | Ga0496107_0036181 | 3300048910 | Bacteria | 3541 |
| 463 | Ga0496107_0064042 | 3300048910 | Bacteria | 2665 |
| 464 | Ga0496108_0000539 | 3300048911 | Bacteria | 29583 |
| 465 | Ga0496109_0000099 | 3300048912 | Bacteria | 89901 |
| 466 | Ga0496109_0377147 | 3300048912 | Bacteria | 1340 |
| 467 | Ga0496110_1124946 | 3300048913 | Bacteria | 694 |
| 468 | Ga0496111_0007248 | 3300048914 | Bacteria | 7256 |
| 469 | Ga0496112_0000043 | 3300048915 | Bacteria | 87684 |
| 470 | Ga0496112_0004735 | 3300048915 | Bacteria | 11593 |
| 471 | Ga0496112_0142622 | 3300048915 | Bacteria | 2365 |
| 472 | Ga0496112_0521693 | 3300048915 | Bacteria | 1123 |
| 473 | Ga0496112_0675114 | 3300048915 | Bacteria | 962 |
| 474 | Ga0496113_0000107 | 3300048916 | Bacteria | 35660 |
| 475 | Ga0496114_0040815 | 3300048917 | Bacteria | 3843 |
| 476 | Ga0496114_0887149 | 3300048917 | Bacteria | 773 |
| 477 | Ga0496115_0000641 | 3300048918 | Bacteria | 26296 |
| 478 | Ga0496115_0459348 | 3300048918 | Bacteria | 1027 |
| 479 | Ga0501047_0282593 | 3300049581 | Bacteria | 1504 |
| 480 | Ga0501067_0221463 | 3300049583 | Bacteria | 1054 |
| 481 | Ga0501230_001699 | 3300049667 | Bacteria | 2676 |
| 482 | Ga0501080_0146801 | 3300049742 | Bacteria | 2180 |
| 483 | Ga0501044_0000119 | 3300049823 | Bacteria | 95213 |
| 484 | Ga0501044_0029160 | 3300049823 | Bacteria | 5820 |
| 485 | nmdc:mga05p37_119627_c1 | 3300050507 | Bacteria | 3236 |
| 486 | nmdc:mga05p37_218789_c1 | 3300050507 | Bacteria | 2299 |
| 487 | nmdc:mga05p37_32696_c1 | 3300050507 | Bacteria | 6364 |
| 488 | nmdc:mga0qj67_55737_c1 | 3300050509 | Bacteria | 3132 |
| 489 | nmdc:mga0n895_159551_c1 | 3300050512 | Bacteria | 2286 |
| 490 | nmdc:mga0n895_26612_c1 | 3300050512 | Bacteria | 5481 |
| 491 | nmdc:mga0n895_57981_c1 | 3300050512 | Bacteria | 3818 |
| 492 | nmdc:mga0n895_717297_c1 | 3300050512 | Bacteria | 995 |
| 493 | nmdc:mga0n895_801306_c1 | 3300050512 | Bacteria | 932 |
| 494 | nmdc:mga0rr50_14356_c1 | 3300050513 | Bacteria | 5193 |
| 495 | nmdc:mga0rr50_36361_c1 | 3300050513 | Bacteria | 3545 |
| 496 | nmdc:mga0rr50_457092_c1 | 3300050513 | Bacteria | 1083 |
| 497 | nmdc:mga08x19_5242_c1 | 3300050514 | Bacteria | 7672 |
| 498 | nmdc:mga0a205_29175_c2 | 3300050515 | Bacteria | 4060 |
| 499 | nmdc:mga0a205_40967_c1 | 3300050515 | Bacteria | 4460 |
| 500 | nmdc:mga0a205_702902_c1 | 3300050515 | Bacteria | 861 |
| 501 | Ga0495601_0029076 | 3300053077 | Bacteria | 3426 |
| 502 | Ga0495601_0178125 | 3300053077 | Bacteria | 1390 |
| 503 | Ga0495612_0368099 | 3300053078 | Bacteria | 650 |
| 504 | Ga0495619_0092197 | 3300053085 | Bacteria | 2052 |
| 505 | Ga0495619_0229566 | 3300053085 | Bacteria | 1286 |
| 506 | Ga0501084_0789782 | 3300054114 | Bacteria | 800 |
| 507 | Ga0501082_0080996 | 3300060353 | Bacteria | 2802 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028573 | Ga0265334_10027748 | Ga0265334_100277482 | 183 |
| 2 | 3300031247 | Ga0265340_10002940 | Ga0265340_100029407 | 183 |
| 3 | 3300031344 | Ga0265316_10044782 | Ga0265316_100447822 | 183 |
| 4 | 3300031595 | Ga0265313_10084322 | Ga0265313_100843222 | 183 |
| 5 | 3300035111 | Ga0373923_0074198 | Ga0373923_0074198_55_633 | 186 |
| 6 | 3300035119 | Ga0373956_0107317 | Ga0373956_0107317_418_996 | 186 |
| 7 | 3300035172 | Ga0373955_0001911 | Ga0373955_0001911_2091_2669 | 186 |
| 8 | 3300035724 | Ga0373933_0094760 | Ga0373933_0094760_16_594 | 186 |
| 9 | 3300036401 | Ga0373937_0002384 | Ga0373937_0002384_5037_5615 | 186 |
| 10 | 3300048088 | Ga0495602_0009589 | Ga0495602_0009589_7634_8212 | 186 |
| 11 | 3300005471 | Ga0070698_100628867 | Ga0070698_1006288673 | 187 |
| 12 | 3300026067 | Ga0207678_10012262 | Ga0207678_100122628 | 187 |
| 13 | 3300005331 | Ga0070670_100020760 | Ga0070670_1000207602 | 188 |
| 14 | 3300005365 | Ga0070688_100026891 | Ga0070688_1000268915 | 188 |
| 15 | 3300005466 | Ga0070685_10191446 | Ga0070685_101914462 | 188 |
| 16 | 3300005617 | Ga0068859_100014872 | Ga0068859_1000148728 | 188 |
| 17 | 3300006931 | Ga0097620_100014872 | Ga0097620_1000148722 | 188 |
| 18 | 3300009093 | Ga0105240_10272894 | Ga0105240_102728942 | 188 |
| 19 | 3300009551 | Ga0105238_10120868 | Ga0105238_101208684 | 188 |
| 20 | 3300025924 | Ga0207694_10067120 | Ga0207694_100671202 | 188 |
| 21 | 3300025925 | Ga0207650_10686686 | Ga0207650_106866862 | 188 |
| 22 | 3300029957 | Ga0265324_10025469 | Ga0265324_100254692 | 188 |
| 23 | 3300041512 | Ga0451853_1364154 | Ga0451853_1364154_49_642 | 188 |
| 24 | 3300005618 | Ga0068864_100868575 | Ga0068864_1008685752 | 189 |
| 25 | 3300005457 | Ga0070662_100028109 | Ga0070662_1000281095 | 190 |
| 26 | 3300005530 | Ga0070679_100150299 | Ga0070679_1001502994 | 190 |
| 27 | 3300005536 | Ga0070697_100750157 | Ga0070697_1007501572 | 190 |
| 28 | 3300005564 | Ga0070664_100009579 | Ga0070664_1000095795 | 190 |
| 29 | 3300006871 | Ga0075434_100928863 | Ga0075434_1009288632 | 190 |
| 30 | 3300006914 | Ga0075436_100321267 | Ga0075436_1003212672 | 190 |
| 31 | 3300009147 | Ga0114129_10130655 | Ga0114129_101306554 | 190 |
| 32 | 3300014325 | Ga0163163_11327650 | Ga0163163_113276501 | 190 |
| 33 | 3300024227 | Ga0228598_1031093 | Ga0228598_10310932 | 190 |
| 34 | 3300025920 | Ga0207649_10097644 | Ga0207649_100976443 | 190 |
| 35 | 3300025933 | Ga0207706_10013693 | Ga0207706_100136935 | 190 |
| 36 | 3300025981 | Ga0207640_10199569 | Ga0207640_101995691 | 190 |
| 37 | 3300026041 | Ga0207639_10050254 | Ga0207639_100502545 | 190 |
| 38 | 3300026116 | Ga0207674_10048267 | Ga0207674_100482676 | 190 |
| 39 | 3300031901 | Ga0307406_10083263 | Ga0307406_100832633 | 190 |
| 40 | 3300031911 | Ga0307412_10484035 | Ga0307412_104840352 | 190 |
| 41 | 3300032002 | Ga0307416_100737355 | Ga0307416_1007373552 | 190 |
| 42 | 3300032126 | Ga0307415_100204175 | Ga0307415_1002041752 | 190 |
| 43 | 3300041486 | Ga0451807_1173178 | Ga0451807_1173178_963_1577 | 190 |
| 44 | 3300048915 | Ga0496112_0675114 | Ga0496112_0675114_17_613 | 190 |
| 45 | 3300050507 | nmdc:mga05p37_218789_c1 | nmdc:mga05p37_218789_c1_1333_1929 | 190 |
| 46 | 3300005445 | Ga0070708_100045053 | Ga0070708_1000450532 | 191 |
| 47 | 3300005467 | Ga0070706_100034560 | Ga0070706_1000345603 | 191 |
| 48 | 3300005518 | Ga0070699_100027284 | Ga0070699_1000272845 | 191 |
| 49 | 3300005536 | Ga0070697_100143837 | Ga0070697_1001438372 | 191 |
| 50 | 3300007265 | Ga0099794_10215525 | Ga0099794_102155252 | 191 |
| 51 | 3300025910 | Ga0207684_10116985 | Ga0207684_101169853 | 191 |
| 52 | 3300036401 | Ga0373937_0342679 | Ga0373937_0342679_819_1400 | 191 |
| 53 | 3300038443 | Ga0395901_0085256 | Ga0395901_0085256_2618_3205 | 191 |
| 54 | 3300049583 | Ga0501067_0221463 | Ga0501067_0221463_210_809 | 191 |
| 55 | 3300005289 | Ga0065704_10004392 | Ga0065704_100043923 | 192 |
| 56 | 3300005295 | Ga0065707_10115750 | Ga0065707_101157502 | 192 |
| 57 | 3300005435 | Ga0070714_100249108 | Ga0070714_1002491082 | 192 |
| 58 | 3300005539 | Ga0068853_100191802 | Ga0068853_1001918024 | 192 |
| 59 | 3300005563 | Ga0068855_100424747 | Ga0068855_1004247473 | 192 |
| 60 | 3300005563 | Ga0068855_100632156 | Ga0068855_1006321562 | 192 |
| 61 | 3300005578 | Ga0068854_100131227 | Ga0068854_1001312273 | 192 |
| 62 | 3300005616 | Ga0068852_100307740 | Ga0068852_1003077402 | 192 |
| 63 | 3300009093 | Ga0105240_10611337 | Ga0105240_106113372 | 192 |
| 64 | 3300009147 | Ga0114129_10270317 | Ga0114129_102703173 | 192 |
| 65 | 3300009174 | Ga0105241_10428352 | Ga0105241_104283522 | 192 |
| 66 | 3300013100 | Ga0157373_10065793 | Ga0157373_100657934 | 192 |
| 67 | 3300013104 | Ga0157370_10374437 | Ga0157370_103744373 | 192 |
| 68 | 3300013104 | Ga0157370_10396412 | Ga0157370_103964122 | 192 |
| 69 | 3300013105 | Ga0157369_10647107 | Ga0157369_106471071 | 192 |
| 70 | 3300013296 | Ga0157374_10129214 | Ga0157374_101292143 | 192 |
| 71 | 3300020082 | Ga0206353_11610671 | Ga0206353_116106714 | 192 |
| 72 | 3300025913 | Ga0207695_10003555 | Ga0207695_1000355520 | 192 |
| 73 | 3300025917 | Ga0207660_10126061 | Ga0207660_101260614 | 192 |
| 74 | 3300025939 | Ga0207665_10062347 | Ga0207665_100623473 | 192 |
| 75 | 3300025940 | Ga0207691_10657861 | Ga0207691_106578611 | 192 |
| 76 | 3300025981 | Ga0207640_10616722 | Ga0207640_106167222 | 192 |
| 77 | 3300027682 | Ga0209971_1014569 | Ga0209971_10145692 | 192 |
| 78 | 3300031901 | Ga0307406_10813718 | Ga0307406_108137181 | 192 |
| 79 | 3300046476 | Ga0495662_0282625 | Ga0495662_0282625_77_667 | 192 |
| 80 | 3300046517 | Ga0495630_0002261 | Ga0495630_0002261_7199_7789 | 192 |
| 81 | 3300047471 | Ga0495684_0015204 | Ga0495684_0015204_3511_4101 | 192 |
| 82 | 3300050514 | nmdc:mga08x19_5242_c1 | nmdc:mga08x19_5242_c1_1206_1811 | 192 |
| 83 | 3300005435 | Ga0070714_100050229 | Ga0070714_1000502292 | 193 |
| 84 | 3300005436 | Ga0070713_100005047 | Ga0070713_1000050474 | 193 |
| 85 | 3300005436 | Ga0070713_100414360 | Ga0070713_1004143602 | 193 |
| 86 | 3300005467 | Ga0070706_100035747 | Ga0070706_1000357472 | 193 |
| 87 | 3300005468 | Ga0070707_100053877 | Ga0070707_1000538774 | 193 |
| 88 | 3300005518 | Ga0070699_100097457 | Ga0070699_1000974573 | 193 |
| 89 | 3300005536 | Ga0070697_101204151 | Ga0070697_1012041511 | 193 |
| 90 | 3300005539 | Ga0068853_100321261 | Ga0068853_1003212612 | 193 |
| 91 | 3300005981 | Ga0081538_10106523 | Ga0081538_101065231 | 193 |
| 92 | 3300006028 | Ga0070717_10186710 | Ga0070717_101867102 | 193 |
| 93 | 3300006028 | Ga0070717_10342789 | Ga0070717_103427892 | 193 |
| 94 | 3300006173 | Ga0070716_100039961 | Ga0070716_1000399612 | 193 |
| 95 | 3300006173 | Ga0070716_100351720 | Ga0070716_1003517201 | 193 |
| 96 | 3300006175 | Ga0070712_100001023 | Ga0070712_1000010233 | 193 |
| 97 | 3300006358 | Ga0068871_101172486 | Ga0068871_1011724861 | 193 |
| 98 | 3300006844 | Ga0075428_100470396 | Ga0075428_1004703962 | 193 |
| 99 | 3300006847 | Ga0075431_100200094 | Ga0075431_1002000943 | 193 |
| 100 | 3300009147 | Ga0114129_10823997 | Ga0114129_108239973 | 193 |
| 101 | 3300014968 | Ga0157379_10859857 | Ga0157379_108598572 | 193 |
| 102 | 3300025906 | Ga0207699_10007868 | Ga0207699_100078686 | 193 |
| 103 | 3300025910 | Ga0207684_10024334 | Ga0207684_100243343 | 193 |
| 104 | 3300025915 | Ga0207693_10000235 | Ga0207693_100002357 | 193 |
| 105 | 3300025916 | Ga0207663_10011339 | Ga0207663_100113395 | 193 |
| 106 | 3300025922 | Ga0207646_10199650 | Ga0207646_101996502 | 193 |
| 107 | 3300025928 | Ga0207700_10051984 | Ga0207700_100519842 | 193 |
| 108 | 3300025928 | Ga0207700_10318179 | Ga0207700_103181792 | 193 |
| 109 | 3300025939 | Ga0207665_10013558 | Ga0207665_100135582 | 193 |
| 110 | 3300026041 | Ga0207639_10040122 | Ga0207639_100401222 | 193 |
| 111 | 3300027671 | Ga0209588_1028186 | Ga0209588_10281862 | 193 |
| 112 | 3300028800 | Ga0265338_10009983 | Ga0265338_100099836 | 193 |
| 113 | 3300029957 | Ga0265324_10068170 | Ga0265324_100681702 | 193 |
| 114 | 3300031249 | Ga0265339_10003616 | Ga0265339_100036166 | 193 |
| 115 | 3300031344 | Ga0265316_10017341 | Ga0265316_100173418 | 193 |
| 116 | 3300031711 | Ga0265314_10054191 | Ga0265314_100541913 | 193 |
| 117 | 3300033545 | Ga0316214_1015830 | Ga0316214_10158301 | 193 |
| 118 | 3300035083 | Ga0373926_0135321 | Ga0373926_0135321_240_854 | 193 |
| 119 | 3300035113 | Ga0373936_0007973 | Ga0373936_0007973_1207_1794 | 193 |
| 120 | 3300035116 | Ga0373945_0040414 | Ga0373945_0040414_10_624 | 193 |
| 121 | 3300035170 | Ga0373943_0589193 | Ga0373943_0589193_46_633 | 193 |
| 122 | 3300035172 | Ga0373955_0348459 | Ga0373955_0348459_18_605 | 193 |
| 123 | 3300035410 | Ga0373924_0023551 | Ga0373924_0023551_562_1149 | 193 |
| 124 | 3300035695 | Ga0373927_0185106 | Ga0373927_0185106_672_1286 | 193 |
| 125 | 3300035725 | Ga0373947_0019871 | Ga0373947_0019871_1290_1904 | 193 |
| 126 | 3300035725 | Ga0373947_0178513 | Ga0373947_0178513_170_757 | 193 |
| 127 | 3300037068 | Ga0373925_0018793 | Ga0373925_0018793_1966_2580 | 193 |
| 128 | 3300046459 | Ga0495629_0115632 | Ga0495629_0115632_666_1280 | 193 |
| 129 | 3300046472 | Ga0495580_0002574 | Ga0495580_0002574_4479_5093 | 193 |
| 130 | 3300046473 | Ga0495582_0001652 | Ga0495582_0001652_3381_3995 | 193 |
| 131 | 3300046475 | Ga0495639_0074505 | Ga0495639_0074505_145_759 | 193 |
| 132 | 3300046477 | Ga0495664_0468215 | Ga0495664_0468215_63_650 | 193 |
| 133 | 3300046517 | Ga0495630_0035927 | Ga0495630_0035927_2042_2629 | 193 |
| 134 | 3300046531 | Ga0495665_0041486 | Ga0495665_0041486_832_1446 | 193 |
| 135 | 3300046533 | Ga0495640_0103137 | Ga0495640_0103137_560_1147 | 193 |
| 136 | 3300046674 | Ga0495588_0388387 | Ga0495588_0388387_11_625 | 193 |
| 137 | 3300046683 | Ga0495658_0022331 | Ga0495658_0022331_1952_2566 | 193 |
| 138 | 3300046689 | Ga0495613_0428979 | Ga0495613_0428979_113_727 | 193 |
| 139 | 3300047319 | Ga0495674_0027723 | Ga0495674_0027723_801_1388 | 193 |
| 140 | 3300047471 | Ga0495684_0251055 | Ga0495684_0251055_115_702 | 193 |
| 141 | 3300048903 | Ga0496100_0276717 | Ga0496100_0276717_422_1009 | 193 |
| 142 | 3300048907 | Ga0496104_0019128 | Ga0496104_0019128_2102_2689 | 193 |
| 143 | 3300048908 | Ga0496105_0475092 | Ga0496105_0475092_370_957 | 193 |
| 144 | 3300048918 | Ga0496115_0459348 | Ga0496115_0459348_237_824 | 193 |
| 145 | 3300049823 | Ga0501044_0029160 | Ga0501044_0029160_4183_4764 | 193 |
| 146 | 3300050507 | nmdc:mga05p37_119627_c1 | nmdc:mga05p37_119627_c1_407_988 | 193 |
| 147 | 3300050512 | nmdc:mga0n895_801306_c1 | nmdc:mga0n895_801306_c1_237_845 | 193 |
| 148 | 3300053077 | Ga0495601_0029076 | Ga0495601_0029076_1626_2213 | 193 |
| 149 | 3300053085 | Ga0495619_0092197 | Ga0495619_0092197_1051_1638 | 193 |
| 150 | 3300005445 | Ga0070708_100262237 | Ga0070708_1002622372 | 194 |
| 151 | 3300005468 | Ga0070707_100429417 | Ga0070707_1004294172 | 194 |
| 152 | 3300005618 | Ga0068864_100586170 | Ga0068864_1005861701 | 194 |
| 153 | 3300006846 | Ga0075430_100059460 | Ga0075430_1000594602 | 194 |
| 154 | 3300028800 | Ga0265338_10018073 | Ga0265338_100180737 | 194 |
| 155 | 3300031241 | Ga0265325_10177884 | Ga0265325_101778842 | 194 |
| 156 | 3300031249 | Ga0265339_10039467 | Ga0265339_100394674 | 194 |
| 157 | 3300031344 | Ga0265316_10067485 | Ga0265316_100674852 | 194 |
| 158 | 3300037853 | Ga0436364_0478514 | Ga0436364_0478514_36404_37036 | 194 |
| 159 | 3300039450 | Ga0436363_1034869 | Ga0436363_1034869_85_699 | 194 |
| 160 | 3300044712 | Ga0453684_0431164 | Ga0453684_0431164_591_1178 | 194 |
| 161 | 3300044712 | Ga0453684_0745605 | Ga0453684_0745605_94_696 | 194 |
| 162 | 3300050509 | nmdc:mga0qj67_55737_c1 | nmdc:mga0qj67_55737_c1_1608_2195 | 194 |
| 163 | 3300003323 | rootH1_10024035 | rootH1_1002403541 | 195 |
| 164 | 3300005435 | Ga0070714_100009459 | Ga0070714_1000094596 | 195 |
| 165 | 3300005435 | Ga0070714_100048131 | Ga0070714_1000481312 | 195 |
| 166 | 3300005436 | Ga0070713_100003033 | Ga0070713_1000030333 | 195 |
| 167 | 3300005436 | Ga0070713_100014086 | Ga0070713_1000140863 | 195 |
| 168 | 3300005437 | Ga0070710_10036205 | Ga0070710_100362052 | 195 |
| 169 | 3300005467 | Ga0070706_100011146 | Ga0070706_1000111462 | 195 |
| 170 | 3300005471 | Ga0070698_100141468 | Ga0070698_1001414681 | 195 |
| 171 | 3300005471 | Ga0070698_100411869 | Ga0070698_1004118691 | 195 |
| 172 | 3300006028 | Ga0070717_10159030 | Ga0070717_101590301 | 195 |
| 173 | 3300006852 | Ga0075433_10239252 | Ga0075433_102392522 | 195 |
| 174 | 3300007076 | Ga0075435_100041786 | Ga0075435_1000417864 | 195 |
| 175 | 3300009147 | Ga0114129_10016072 | Ga0114129_100160728 | 195 |
| 176 | 3300014325 | Ga0163163_10427379 | Ga0163163_104273793 | 195 |
| 177 | 3300025898 | Ga0207692_10070927 | Ga0207692_100709272 | 195 |
| 178 | 3300025906 | Ga0207699_10111524 | Ga0207699_101115241 | 195 |
| 179 | 3300025910 | Ga0207684_10034425 | Ga0207684_100344252 | 195 |
| 180 | 3300025912 | Ga0207707_10026135 | Ga0207707_100261354 | 195 |
| 181 | 3300025912 | Ga0207707_10414335 | Ga0207707_104143352 | 195 |
| 182 | 3300025928 | Ga0207700_10062960 | Ga0207700_100629602 | 195 |
| 183 | 3300025928 | Ga0207700_10149593 | Ga0207700_101495933 | 195 |
| 184 | 3300025929 | Ga0207664_10031786 | Ga0207664_100317864 | 195 |
| 185 | 3300025929 | Ga0207664_10080151 | Ga0207664_100801514 | 195 |
| 186 | 3300025945 | Ga0207679_10278763 | Ga0207679_102787632 | 195 |
| 187 | 3300026095 | Ga0207676_10010310 | Ga0207676_100103102 | 195 |
| 188 | 3300026118 | Ga0207675_100451770 | Ga0207675_1004517702 | 195 |
| 189 | 3300031712 | Ga0265342_10077720 | Ga0265342_100777202 | 195 |
| 190 | 3300031901 | Ga0307406_10054824 | Ga0307406_100548245 | 195 |
| 191 | 3300046472 | Ga0495580_0162797 | Ga0495580_0162797_713_1306 | 195 |
| 192 | 3300050507 | nmdc:mga05p37_32696_c1 | nmdc:mga05p37_32696_c1_3487_4107 | 195 |
| 193 | 3300050512 | nmdc:mga0n895_159551_c1 | nmdc:mga0n895_159551_c1_1001_1621 | 195 |
| 194 | 3300050513 | nmdc:mga0rr50_36361_c1 | nmdc:mga0rr50_36361_c1_2010_2630 | 195 |
| 195 | 3300050515 | nmdc:mga0a205_702902_c1 | nmdc:mga0a205_702902_c1_200_820 | 195 |
| 196 | 3300053078 | Ga0495612_0368099 | Ga0495612_0368099_13_606 | 195 |
| 197 | 3300005335 | Ga0070666_10284686 | Ga0070666_102846861 | 196 |
| 198 | 3300005338 | Ga0068868_100031743 | Ga0068868_1000317434 | 196 |
| 199 | 3300005338 | Ga0068868_100055714 | Ga0068868_1000557145 | 196 |
| 200 | 3300005338 | Ga0068868_100070039 | Ga0068868_1000700392 | 196 |
| 201 | 3300005458 | Ga0070681_10586987 | Ga0070681_105869871 | 196 |
| 202 | 3300005459 | Ga0068867_100097363 | Ga0068867_1000973632 | 196 |
| 203 | 3300005459 | Ga0068867_100310260 | Ga0068867_1003102601 | 196 |
| 204 | 3300005563 | Ga0068855_100378380 | Ga0068855_1003783804 | 196 |
| 205 | 3300005578 | Ga0068854_100093594 | Ga0068854_1000935942 | 196 |
| 206 | 3300005614 | Ga0068856_101094457 | Ga0068856_1010944571 | 196 |
| 207 | 3300005615 | Ga0070702_100143575 | Ga0070702_1001435752 | 196 |
| 208 | 3300005618 | Ga0068864_100288990 | Ga0068864_1002889902 | 196 |
| 209 | 3300005718 | Ga0068866_10405716 | Ga0068866_104057162 | 196 |
| 210 | 3300005841 | Ga0068863_100560552 | Ga0068863_1005605522 | 196 |
| 211 | 3300005841 | Ga0068863_101092855 | Ga0068863_1010928552 | 196 |
| 212 | 3300005842 | Ga0068858_100089967 | Ga0068858_1000899672 | 196 |
| 213 | 3300006237 | Ga0097621_100002942 | Ga0097621_1000029428 | 196 |
| 214 | 3300006237 | Ga0097621_100169529 | Ga0097621_1001695291 | 196 |
| 215 | 3300006358 | Ga0068871_100005057 | Ga0068871_1000050574 | 196 |
| 216 | 3300009098 | Ga0105245_10036717 | Ga0105245_100367174 | 196 |
| 217 | 3300009176 | Ga0105242_10019497 | Ga0105242_100194974 | 196 |
| 218 | 3300009177 | Ga0105248_10053100 | Ga0105248_100531004 | 196 |
| 219 | 3300009177 | Ga0105248_10974855 | Ga0105248_109748552 | 196 |
| 220 | 3300009545 | Ga0105237_10200491 | Ga0105237_102004912 | 196 |
| 221 | 3300009545 | Ga0105237_10292693 | Ga0105237_102926933 | 196 |
| 222 | 3300009553 | Ga0105249_10163504 | Ga0105249_101635043 | 196 |
| 223 | 3300009553 | Ga0105249_10229856 | Ga0105249_102298562 | 196 |
| 224 | 3300010375 | Ga0105239_10039817 | Ga0105239_100398172 | 196 |
| 225 | 3300013296 | Ga0157374_10009612 | Ga0157374_1000961210 | 196 |
| 226 | 3300013297 | Ga0157378_10001446 | Ga0157378_100014466 | 196 |
| 227 | 3300013306 | Ga0163162_10375724 | Ga0163162_103757241 | 196 |
| 228 | 3300013308 | Ga0157375_10058244 | Ga0157375_100582446 | 196 |
| 229 | 3300013308 | Ga0157375_10240499 | Ga0157375_102404992 | 196 |
| 230 | 3300013308 | Ga0157375_10537279 | Ga0157375_105372791 | 196 |
| 231 | 3300014968 | Ga0157379_10393568 | Ga0157379_103935681 | 196 |
| 232 | 3300025899 | Ga0207642_10212981 | Ga0207642_102129811 | 196 |
| 233 | 3300025927 | Ga0207687_10144991 | Ga0207687_101449912 | 196 |
| 234 | 3300025934 | Ga0207686_10009371 | Ga0207686_100093714 | 196 |
| 235 | 3300025937 | Ga0207669_10215404 | Ga0207669_102154042 | 196 |
| 236 | 3300025941 | Ga0207711_10084342 | Ga0207711_100843422 | 196 |
| 237 | 3300025949 | Ga0207667_10151991 | Ga0207667_101519912 | 196 |
| 238 | 3300025961 | Ga0207712_10149179 | Ga0207712_101491792 | 196 |
| 239 | 3300026023 | Ga0207677_10022187 | Ga0207677_100221873 | 196 |
| 240 | 3300026023 | Ga0207677_10022240 | Ga0207677_100222402 | 196 |
| 241 | 3300026035 | Ga0207703_10107745 | Ga0207703_101077452 | 196 |
| 242 | 3300026089 | Ga0207648_10095946 | Ga0207648_100959462 | 196 |
| 243 | 3300026089 | Ga0207648_10198181 | Ga0207648_101981811 | 196 |
| 244 | 3300026095 | Ga0207676_10184284 | Ga0207676_101842842 | 196 |
| 245 | 3300030760 | Ga0265762_1000054 | Ga0265762_10000547 | 196 |
| 246 | 3300039450 | Ga0436363_1104128 | Ga0436363_1104128_199_801 | 196 |
| 247 | 3300048905 | Ga0496102_0834322 | Ga0496102_0834322_76_672 | 196 |
| 248 | 3300048913 | Ga0496110_1124946 | Ga0496110_1124946_26_616 | 196 |
| 249 | 3300048915 | Ga0496112_0004735 | Ga0496112_0004735_322_912 | 196 |
| 250 | 3300048915 | Ga0496112_0142622 | Ga0496112_0142622_549_1142 | 196 |
| 251 | 3300048917 | Ga0496114_0887149 | Ga0496114_0887149_133_723 | 196 |
| 252 | 3300007788 | Ga0099795_10184031 | Ga0099795_101840312 | 197 |
| 253 | 3300010159 | Ga0099796_10013153 | Ga0099796_100131532 | 197 |
| 254 | 3300014497 | Ga0182008_10143790 | Ga0182008_101437902 | 197 |
| 255 | 3300015261 | Ga0182006_1045441 | Ga0182006_10454412 | 197 |
| 256 | 3300015262 | Ga0182007_10054360 | Ga0182007_100543602 | 197 |
| 257 | 3300022732 | Ga0224569_104478 | Ga0224569_1044782 | 197 |
| 258 | 3300024227 | Ga0228598_1000500 | Ga0228598_10005007 | 197 |
| 259 | 3300025924 | Ga0207694_10000373 | Ga0207694_1000037329 | 197 |
| 260 | 3300005434 | Ga0070709_10277867 | Ga0070709_102778672 | 198 |
| 261 | 3300005436 | Ga0070713_100126931 | Ga0070713_1001269311 | 198 |
| 262 | 3300005439 | Ga0070711_100000088 | Ga0070711_1000000881 | 198 |
| 263 | 3300005547 | Ga0070693_100096541 | Ga0070693_1000965412 | 198 |
| 264 | 3300005841 | Ga0068863_101147225 | Ga0068863_1011472251 | 198 |
| 265 | 3300006163 | Ga0070715_10011542 | Ga0070715_100115422 | 198 |
| 266 | 3300006173 | Ga0070716_100012833 | Ga0070716_1000128331 | 198 |
| 267 | 3300006173 | Ga0070716_100703760 | Ga0070716_1007037601 | 198 |
| 268 | 3300006175 | Ga0070712_100037626 | Ga0070712_1000376263 | 198 |
| 269 | 3300006237 | Ga0097621_100198573 | Ga0097621_1001985731 | 198 |
| 270 | 3300009098 | Ga0105245_10161933 | Ga0105245_101619333 | 198 |
| 271 | 3300009101 | Ga0105247_10258786 | Ga0105247_102587861 | 198 |
| 272 | 3300009174 | Ga0105241_10026094 | Ga0105241_100260944 | 198 |
| 273 | 3300009177 | Ga0105248_11423632 | Ga0105248_114236321 | 198 |
| 274 | 3300013296 | Ga0157374_10800591 | Ga0157374_108005911 | 198 |
| 275 | 3300013297 | Ga0157378_10362598 | Ga0157378_103625981 | 198 |
| 276 | 3300013306 | Ga0163162_10905856 | Ga0163162_109058561 | 198 |
| 277 | 3300014968 | Ga0157379_10010509 | Ga0157379_100105094 | 198 |
| 278 | 3300025898 | Ga0207692_10056376 | Ga0207692_100563762 | 198 |
| 279 | 3300025915 | Ga0207693_10000917 | Ga0207693_1000091712 | 198 |
| 280 | 3300025916 | Ga0207663_10108409 | Ga0207663_101084092 | 198 |
| 281 | 3300025916 | Ga0207663_10186270 | Ga0207663_101862702 | 198 |
| 282 | 3300025927 | Ga0207687_10122961 | Ga0207687_101229612 | 198 |
| 283 | 3300025939 | Ga0207665_10012740 | Ga0207665_100127401 | 198 |
| 284 | 3300025939 | Ga0207665_10019479 | Ga0207665_100194796 | 198 |
| 285 | 3300035691 | Ga0373931_0079635 | Ga0373931_0079635_346_945 | 198 |
| 286 | 3300048904 | Ga0496101_0492645 | Ga0496101_0492645_336_935 | 198 |
| 287 | 3300048905 | Ga0496102_0008957 | Ga0496102_0008957_3105_3704 | 198 |
| 288 | 3300048906 | Ga0496103_0002761 | Ga0496103_0002761_9173_9772 | 198 |
| 289 | 3300048907 | Ga0496104_0016605 | Ga0496104_0016605_5738_6337 | 198 |
| 290 | 3300049581 | Ga0501047_0282593 | Ga0501047_0282593_179_790 | 198 |
| 291 | 3300049742 | Ga0501080_0146801 | Ga0501080_0146801_707_1318 | 198 |
| 292 | 3300049823 | Ga0501044_0000119 | Ga0501044_0000119_73545_74156 | 198 |
| 293 | 3300054114 | Ga0501084_0789782 | Ga0501084_0789782_179_790 | 198 |
| 294 | 3300060353 | Ga0501082_0080996 | Ga0501082_0080996_1458_2069 | 198 |
| 295 | 3300005445 | Ga0070708_100140285 | Ga0070708_1001402853 | 199 |
| 296 | 3300005530 | Ga0070679_100081066 | Ga0070679_1000810663 | 199 |
| 297 | 3300005536 | Ga0070697_100001000 | Ga0070697_1000010003 | 199 |
| 298 | 3300006028 | Ga0070717_10288270 | Ga0070717_102882702 | 199 |
| 299 | 3300006852 | Ga0075433_10208223 | Ga0075433_102082232 | 199 |
| 300 | 3300006871 | Ga0075434_100029506 | Ga0075434_1000295062 | 199 |
| 301 | 3300006871 | Ga0075434_100945974 | Ga0075434_1009459741 | 199 |
| 302 | 3300006914 | Ga0075436_100125810 | Ga0075436_1001258101 | 199 |
| 303 | 3300025912 | Ga0207707_10002986 | Ga0207707_100029868 | 199 |
| 304 | 3300025921 | Ga0207652_10168724 | Ga0207652_101687241 | 199 |
| 305 | 3300046463 | Ga0495653_0174966 | Ga0495653_0174966_237_839 | 199 |
| 306 | 3300046472 | Ga0495580_0016659 | Ga0495580_0016659_1633_2232 | 199 |
| 307 | 3300046531 | Ga0495665_0143922 | Ga0495665_0143922_227_829 | 199 |
| 308 | 3300046543 | Ga0495645_0040763 | Ga0495645_0040763_1531_2133 | 199 |
| 309 | 3300046559 | Ga0495667_0044371 | Ga0495667_0044371_1640_2242 | 199 |
| 310 | 3300046678 | Ga0495599_0024973 | Ga0495599_0024973_1469_2071 | 199 |
| 311 | 3300046689 | Ga0495613_0092847 | Ga0495613_0092847_602_1204 | 199 |
| 312 | 3300046690 | Ga0495624_0214132 | Ga0495624_0214132_118_720 | 199 |
| 313 | 3300048088 | Ga0495602_0166657 | Ga0495602_0166657_402_1004 | 199 |
| 314 | 3300049667 | Ga0501230_001699 | Ga0501230_001699_249_875 | 199 |
| 315 | 3300050512 | nmdc:mga0n895_57981_c1 | nmdc:mga0n895_57981_c1_3065_3664 | 199 |
| 316 | 3300050512 | nmdc:mga0n895_717297_c1 | nmdc:mga0n895_717297_c1_271_870 | 199 |
| 317 | 3300050513 | nmdc:mga0rr50_14356_c1 | nmdc:mga0rr50_14356_c1_3317_3916 | 199 |
| 318 | 3300050515 | nmdc:mga0a205_29175_c2 | nmdc:mga0a205_29175_c2_3371_3970 | 199 |
| 319 | 3300013297 | Ga0157378_10203194 | Ga0157378_102031942 | 200 |
| 320 | 3300048905 | Ga0496102_0622053 | Ga0496102_0622053_367_978 | 200 |
| 321 | 3300005445 | Ga0070708_100000372 | Ga0070708_10000037233 | 201 |
| 322 | 3300005458 | Ga0070681_10282368 | Ga0070681_102823682 | 201 |
| 323 | 3300005467 | Ga0070706_100014149 | Ga0070706_1000141496 | 201 |
| 324 | 3300005468 | Ga0070707_100032068 | Ga0070707_1000320684 | 201 |
| 325 | 3300005471 | Ga0070698_100003025 | Ga0070698_10000302516 | 201 |
| 326 | 3300005518 | Ga0070699_100001645 | Ga0070699_10000164515 | 201 |
| 327 | 3300005536 | Ga0070697_100001970 | Ga0070697_10000197010 | 201 |
| 328 | 3300006028 | Ga0070717_10503490 | Ga0070717_105034901 | 201 |
| 329 | 3300006852 | Ga0075433_10061476 | Ga0075433_100614762 | 201 |
| 330 | 3300006871 | Ga0075434_100056456 | Ga0075434_1000564564 | 201 |
| 331 | 3300007076 | Ga0075435_100303677 | Ga0075435_1003036772 | 201 |
| 332 | 3300009176 | Ga0105242_10056543 | Ga0105242_100565433 | 201 |
| 333 | 3300025910 | Ga0207684_10000343 | Ga0207684_1000034359 | 201 |
| 334 | 3300025922 | Ga0207646_10000566 | Ga0207646_1000056625 | 201 |
| 335 | 3300026089 | Ga0207648_10154398 | Ga0207648_101543982 | 201 |
| 336 | 3300050512 | nmdc:mga0n895_26612_c1 | nmdc:mga0n895_26612_c1_3347_3973 | 201 |
| 337 | 3300050513 | nmdc:mga0rr50_457092_c1 | nmdc:mga0rr50_457092_c1_153_779 | 201 |
| 338 | 3300050515 | nmdc:mga0a205_40967_c1 | nmdc:mga0a205_40967_c1_511_1137 | 201 |
| 339 | 3300005355 | Ga0070671_100140064 | Ga0070671_1001400641 | 202 |
| 340 | 3300005437 | Ga0070710_10161514 | Ga0070710_101615141 | 202 |
| 341 | 3300005545 | Ga0070695_100502080 | Ga0070695_1005020801 | 202 |
| 342 | 3300005614 | Ga0068856_100261225 | Ga0068856_1002612252 | 202 |
| 343 | 3300005841 | Ga0068863_100975050 | Ga0068863_1009750501 | 202 |
| 344 | 3300005843 | Ga0068860_101525515 | Ga0068860_1015255151 | 202 |
| 345 | 3300006237 | Ga0097621_100003025 | Ga0097621_10000302510 | 202 |
| 346 | 3300009093 | Ga0105240_10138512 | Ga0105240_101385121 | 202 |
| 347 | 3300009093 | Ga0105240_10139423 | Ga0105240_101394234 | 202 |
| 348 | 3300009098 | Ga0105245_10479720 | Ga0105245_104797201 | 202 |
| 349 | 3300009177 | Ga0105248_10067707 | Ga0105248_100677073 | 202 |
| 350 | 3300013296 | Ga0157374_10547261 | Ga0157374_105472612 | 202 |
| 351 | 3300013296 | Ga0157374_10678244 | Ga0157374_106782442 | 202 |
| 352 | 3300013297 | Ga0157378_10003132 | Ga0157378_100031329 | 202 |
| 353 | 3300013306 | Ga0163162_10072102 | Ga0163162_100721022 | 202 |
| 354 | 3300014325 | Ga0163163_10073698 | Ga0163163_100736983 | 202 |
| 355 | 3300014968 | Ga0157379_10072146 | Ga0157379_100721463 | 202 |
| 356 | 3300014969 | Ga0157376_10015792 | Ga0157376_100157922 | 202 |
| 357 | 3300025912 | Ga0207707_10052522 | Ga0207707_100525224 | 202 |
| 358 | 3300025913 | Ga0207695_10116775 | Ga0207695_101167751 | 202 |
| 359 | 3300025913 | Ga0207695_10354910 | Ga0207695_103549102 | 202 |
| 360 | 3300025915 | Ga0207693_10215247 | Ga0207693_102152471 | 202 |
| 361 | 3300025931 | Ga0207644_10717888 | Ga0207644_107178881 | 202 |
| 362 | 3300025941 | Ga0207711_10236252 | Ga0207711_102362522 | 202 |
| 363 | 3300028379 | Ga0268266_10407088 | Ga0268266_104070882 | 202 |
| 364 | 3300028381 | Ga0268264_11236497 | Ga0268264_112364971 | 202 |
| 365 | 3300036401 | Ga0373937_0189818 | Ga0373937_0189818_1121_1729 | 202 |
| 366 | 3300037068 | Ga0373925_0022953 | Ga0373925_0022953_2468_3076 | 202 |
| 367 | 3300046459 | Ga0495629_0284187 | Ga0495629_0284187_98_706 | 202 |
| 368 | 3300047317 | Ga0495604_0432944 | Ga0495604_0432944_225_833 | 202 |
| 369 | 3300048903 | Ga0496100_0169131 | Ga0496100_0169131_282_890 | 202 |
| 370 | 3300048904 | Ga0496101_0007762 | Ga0496101_0007762_3327_3935 | 202 |
| 371 | 3300048908 | Ga0496105_0062761 | Ga0496105_0062761_1519_2127 | 202 |
| 372 | 3300048910 | Ga0496107_0064042 | Ga0496107_0064042_18_626 | 202 |
| 373 | 3300048912 | Ga0496109_0377147 | Ga0496109_0377147_519_1127 | 202 |
| 374 | 3300048915 | Ga0496112_0521693 | Ga0496112_0521693_470_1078 | 202 |
| 375 | 3300048917 | Ga0496114_0040815 | Ga0496114_0040815_631_1239 | 202 |
| 376 | 3300048918 | Ga0496115_0000641 | Ga0496115_0000641_5182_5790 | 202 |
| 377 | 3300053077 | Ga0495601_0178125 | Ga0495601_0178125_486_1094 | 202 |
| 378 | 3300053085 | Ga0495619_0229566 | Ga0495619_0229566_626_1234 | 202 |
| 379 | 3300005289 | Ga0065704_10296464 | Ga0065704_102964642 | 203 |
| 380 | 3300001978 | JGI24747J21853_1011365 | JGI24747J21853_10113652 | 206 |
| 381 | 3300001991 | JGI24743J22301_10000293 | JGI24743J22301_100002932 | 206 |
| 382 | 3300002075 | JGI24738J21930_10038615 | JGI24738J21930_100386152 | 206 |
| 383 | 3300002075 | JGI24738J21930_10054479 | JGI24738J21930_100544792 | 206 |
| 384 | 3300002155 | JGI24033J26618_1006334 | JGI24033J26618_10063342 | 206 |
| 385 | 3300002239 | JGI24034J26672_10002026 | JGI24034J26672_100020261 | 206 |
| 386 | 3300005293 | Ga0065715_10116360 | Ga0065715_101163602 | 206 |
| 387 | 3300005295 | Ga0065707_10014157 | Ga0065707_100141572 | 206 |
| 388 | 3300005327 | Ga0070658_10063359 | Ga0070658_100633595 | 206 |
| 389 | 3300005329 | Ga0070683_100007493 | Ga0070683_1000074934 | 206 |
| 390 | 3300005330 | Ga0070690_100104267 | Ga0070690_1001042672 | 206 |
| 391 | 3300005331 | Ga0070670_100033325 | Ga0070670_1000333254 | 206 |
| 392 | 3300005333 | Ga0070677_10004665 | Ga0070677_100046653 | 206 |
| 393 | 3300005335 | Ga0070666_10313917 | Ga0070666_103139171 | 206 |
| 394 | 3300005337 | Ga0070682_100037463 | Ga0070682_1000374632 | 206 |
| 395 | 3300005338 | Ga0068868_100011209 | Ga0068868_1000112097 | 206 |
| 396 | 3300005339 | Ga0070660_100011061 | Ga0070660_1000110613 | 206 |
| 397 | 3300005340 | Ga0070689_100007514 | Ga0070689_1000075142 | 206 |
| 398 | 3300005343 | Ga0070687_100006117 | Ga0070687_1000061172 | 206 |
| 399 | 3300005344 | Ga0070661_100159243 | Ga0070661_1001592431 | 206 |
| 400 | 3300005347 | Ga0070668_100004857 | Ga0070668_1000048579 | 206 |
| 401 | 3300005353 | Ga0070669_100002184 | Ga0070669_10000218410 | 206 |
| 402 | 3300005354 | Ga0070675_100006210 | Ga0070675_1000062109 | 206 |
| 403 | 3300005356 | Ga0070674_100001002 | Ga0070674_1000010024 | 206 |
| 404 | 3300005364 | Ga0070673_100063181 | Ga0070673_1000631811 | 206 |
| 405 | 3300005365 | Ga0070688_100000618 | Ga0070688_10000061811 | 206 |
| 406 | 3300005366 | Ga0070659_100012377 | Ga0070659_1000123775 | 206 |
| 407 | 3300005455 | Ga0070663_100215516 | Ga0070663_1002155162 | 206 |
| 408 | 3300005456 | Ga0070678_100031605 | Ga0070678_1000316053 | 206 |
| 409 | 3300005457 | Ga0070662_100045611 | Ga0070662_1000456113 | 206 |
| 410 | 3300005459 | Ga0068867_100068604 | Ga0068867_1000686043 | 206 |
| 411 | 3300005466 | Ga0070685_10004460 | Ga0070685_100044607 | 206 |
| 412 | 3300005535 | Ga0070684_100001860 | Ga0070684_10000186011 | 206 |
| 413 | 3300005543 | Ga0070672_100245973 | Ga0070672_1002459732 | 206 |
| 414 | 3300005547 | Ga0070693_100252817 | Ga0070693_1002528172 | 206 |
| 415 | 3300005563 | Ga0068855_100022413 | Ga0068855_1000224135 | 206 |
| 416 | 3300005564 | Ga0070664_100183003 | Ga0070664_1001830032 | 206 |
| 417 | 3300005577 | Ga0068857_100003629 | Ga0068857_10000362910 | 206 |
| 418 | 3300005614 | Ga0068856_100012749 | Ga0068856_1000127498 | 206 |
| 419 | 3300005615 | Ga0070702_100174134 | Ga0070702_1001741342 | 206 |
| 420 | 3300005616 | Ga0068852_100029544 | Ga0068852_1000295442 | 206 |
| 421 | 3300005617 | Ga0068859_100627285 | Ga0068859_1006272852 | 206 |
| 422 | 3300005618 | Ga0068864_100501834 | Ga0068864_1005018342 | 206 |
| 423 | 3300005718 | Ga0068866_10005774 | Ga0068866_100057744 | 206 |
| 424 | 3300005719 | Ga0068861_100030010 | Ga0068861_1000300103 | 206 |
| 425 | 3300005834 | Ga0068851_10001293 | Ga0068851_100012937 | 206 |
| 426 | 3300005840 | Ga0068870_10065757 | Ga0068870_100657572 | 206 |
| 427 | 3300005841 | Ga0068863_100212440 | Ga0068863_1002124401 | 206 |
| 428 | 3300005842 | Ga0068858_100034480 | Ga0068858_1000344804 | 206 |
| 429 | 3300005843 | Ga0068860_100215427 | Ga0068860_1002154271 | 206 |
| 430 | 3300005844 | Ga0068862_100139313 | Ga0068862_1001393132 | 206 |
| 431 | 3300006237 | Ga0097621_100127536 | Ga0097621_1001275361 | 206 |
| 432 | 3300006358 | Ga0068871_100134300 | Ga0068871_1001343002 | 206 |
| 433 | 3300006881 | Ga0068865_100014699 | Ga0068865_1000146994 | 206 |
| 434 | 3300006931 | Ga0097620_100627238 | Ga0097620_1006272382 | 206 |
| 435 | 3300007076 | Ga0075435_100289109 | Ga0075435_1002891092 | 206 |
| 436 | 3300009098 | Ga0105245_10011327 | Ga0105245_100113274 | 206 |
| 437 | 3300009101 | Ga0105247_10002094 | Ga0105247_100020947 | 206 |
| 438 | 3300009174 | Ga0105241_10011865 | Ga0105241_100118654 | 206 |
| 439 | 3300009176 | Ga0105242_10017421 | Ga0105242_100174213 | 206 |
| 440 | 3300009553 | Ga0105249_10009154 | Ga0105249_100091544 | 206 |
| 441 | 3300010375 | Ga0105239_10004244 | Ga0105239_100042442 | 206 |
| 442 | 3300011119 | Ga0105246_10006082 | Ga0105246_100060825 | 206 |
| 443 | 3300013100 | Ga0157373_10037404 | Ga0157373_100374042 | 206 |
| 444 | 3300013102 | Ga0157371_10007472 | Ga0157371_100074722 | 206 |
| 445 | 3300013105 | Ga0157369_10008874 | Ga0157369_100088747 | 206 |
| 446 | 3300013297 | Ga0157378_10034794 | Ga0157378_100347943 | 206 |
| 447 | 3300013307 | Ga0157372_10009715 | Ga0157372_100097154 | 206 |
| 448 | 3300014325 | Ga0163163_10001263 | Ga0163163_1000126318 | 206 |
| 449 | 3300014326 | Ga0157380_10016601 | Ga0157380_100166012 | 206 |
| 450 | 3300014745 | Ga0157377_10000395 | Ga0157377_1000039511 | 206 |
| 451 | 3300014968 | Ga0157379_10143664 | Ga0157379_101436642 | 206 |
| 452 | 3300014969 | Ga0157376_10589341 | Ga0157376_105893411 | 206 |
| 453 | 3300017792 | Ga0163161_10010982 | Ga0163161_100109824 | 206 |
| 454 | 3300025315 | Ga0207697_10000518 | Ga0207697_1000051810 | 206 |
| 455 | 3300025899 | Ga0207642_10139704 | Ga0207642_101397042 | 206 |
| 456 | 3300025900 | Ga0207710_10025813 | Ga0207710_100258132 | 206 |
| 457 | 3300025901 | Ga0207688_10025189 | Ga0207688_100251893 | 206 |
| 458 | 3300025903 | Ga0207680_10001286 | Ga0207680_100012864 | 206 |
| 459 | 3300025904 | Ga0207647_10004047 | Ga0207647_100040473 | 206 |
| 460 | 3300025907 | Ga0207645_10000351 | Ga0207645_1000035119 | 206 |
| 461 | 3300025908 | Ga0207643_10001192 | Ga0207643_100011929 | 206 |
| 462 | 3300025909 | Ga0207705_10270407 | Ga0207705_102704071 | 206 |
| 463 | 3300025918 | Ga0207662_10009503 | Ga0207662_100095034 | 206 |
| 464 | 3300025919 | Ga0207657_10004756 | Ga0207657_1000475611 | 206 |
| 465 | 3300025920 | Ga0207649_10000928 | Ga0207649_100009289 | 206 |
| 466 | 3300025923 | Ga0207681_10006380 | Ga0207681_100063802 | 206 |
| 467 | 3300025925 | Ga0207650_10000059 | Ga0207650_10000059100 | 206 |
| 468 | 3300025926 | Ga0207659_10007240 | Ga0207659_100072402 | 206 |
| 469 | 3300025931 | Ga0207644_10002945 | Ga0207644_100029451 | 206 |
| 470 | 3300025932 | Ga0207690_10039695 | Ga0207690_100396952 | 206 |
| 471 | 3300025933 | Ga0207706_10002202 | Ga0207706_100022024 | 206 |
| 472 | 3300025934 | Ga0207686_10153171 | Ga0207686_101531712 | 206 |
| 473 | 3300025936 | Ga0207670_10317864 | Ga0207670_103178642 | 206 |
| 474 | 3300025937 | Ga0207669_10037058 | Ga0207669_100370582 | 206 |
| 475 | 3300025938 | Ga0207704_10003936 | Ga0207704_100039364 | 206 |
| 476 | 3300025940 | Ga0207691_10002027 | Ga0207691_100020271 | 206 |
| 477 | 3300025941 | Ga0207711_10003820 | Ga0207711_100038203 | 206 |
| 478 | 3300025942 | Ga0207689_10464124 | Ga0207689_104641241 | 206 |
| 479 | 3300025944 | Ga0207661_10000352 | Ga0207661_100003529 | 206 |
| 480 | 3300025945 | Ga0207679_10000039 | Ga0207679_1000003943 | 206 |
| 481 | 3300025961 | Ga0207712_10449391 | Ga0207712_104493911 | 206 |
| 482 | 3300025972 | Ga0207668_10665411 | Ga0207668_106654112 | 206 |
| 483 | 3300025986 | Ga0207658_10003811 | Ga0207658_100038116 | 206 |
| 484 | 3300026023 | Ga0207677_10042875 | Ga0207677_100428751 | 206 |
| 485 | 3300026035 | Ga0207703_10003512 | Ga0207703_100035123 | 206 |
| 486 | 3300026041 | Ga0207639_10020333 | Ga0207639_100203331 | 206 |
| 487 | 3300026067 | Ga0207678_10001428 | Ga0207678_1000142822 | 206 |
| 488 | 3300026088 | Ga0207641_10000025 | Ga0207641_10000025102 | 206 |
| 489 | 3300026089 | Ga0207648_10000420 | Ga0207648_1000042021 | 206 |
| 490 | 3300026095 | Ga0207676_10000104 | Ga0207676_1000010410 | 206 |
| 491 | 3300026116 | Ga0207674_10000604 | Ga0207674_1000060412 | 206 |
| 492 | 3300026118 | Ga0207675_100025053 | Ga0207675_1000250532 | 206 |
| 493 | 3300026121 | Ga0207683_10000726 | Ga0207683_1000072610 | 206 |
| 494 | 3300026142 | Ga0207698_10129371 | Ga0207698_101293712 | 206 |
| 495 | 3300028379 | Ga0268266_10004403 | Ga0268266_100044037 | 206 |
| 496 | 3300028380 | Ga0268265_10028564 | Ga0268265_100285643 | 206 |
| 497 | 3300028381 | Ga0268264_11206053 | Ga0268264_112060532 | 206 |
| 498 | 3300048903 | Ga0496100_0094863 | Ga0496100_0094863_54_674 | 206 |
| 499 | 3300048907 | Ga0496104_0316433 | Ga0496104_0316433_277_897 | 206 |
| 500 | 3300048909 | Ga0496106_0177283 | Ga0496106_0177283_621_1241 | 206 |
| 501 | 3300048910 | Ga0496107_0036181 | Ga0496107_0036181_2187_2807 | 206 |
| 502 | 3300048911 | Ga0496108_0000539 | Ga0496108_0000539_21170_21790 | 206 |
| 503 | 3300048912 | Ga0496109_0000099 | Ga0496109_0000099_70556_71176 | 206 |
| 504 | 3300048914 | Ga0496111_0007248 | Ga0496111_0007248_2106_2726 | 206 |
| 505 | 3300048915 | Ga0496112_0000043 | Ga0496112_0000043_33037_33657 | 206 |
| 506 | 3300048916 | Ga0496113_0000107 | Ga0496113_0000107_10784_11404 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ofk-assembly1.cif.gz_A | crystal structure of 3-methyladenine dna glycosylase i (tag) | 0.978 | 11 | 188 |
| 4aia-assembly4.cif.gz_D | the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus | 0.9739 | 12 | 187 |
| 4ai4-assembly1.cif.gz_A | crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus | 0.9616 | 12 | 187 |
| 4ai5-assembly3.cif.gz_C | crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine | 0.9555 | 12 | 199 |
| 2ofk-assembly1.cif.gz_A | crystal structure of 3-methyladenine dna glycosylase i (tag) | 0.9517 | 11 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXR7_1_186_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9809 | 17 | 187 | 1.10.340.30 |
| af_C6TKE8_117_301_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9771 | 11 | 190 | 1.10.340.30 |
| af_P05100_1_187_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9765 | 11 | 193 | 1.10.340.30 |
| af_P05100_1_187_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9509 | 11 | 193 | 1.10.340.30 |
| af_C6TKE8_117_301_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.946 | 11 | 190 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T9GAR2-F1-model_v4 | deleted | 1.002 | 11 | 193 |
|
| AF-A0A1F9VRF3-F1-model_v4 | DNA-3-methyladenine glycosylase | 1 | 22 | 195 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A357VPW6-F1-model_v4 | DNA-3-methyladenine glycosylase I | 1 | 36 | 193 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A1H1N6L2-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9999 | 12 | 194 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A023BY08-F1-model_v4 | DNA-3-methyladenine glycosylase | 0.9999 | 10 | 193 |
GO:0006284
GO:0008725 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar