F456527

General Info

Members Datasets Scaffolds Average Seq Length
506 273 507 201

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10072146|Ga0157379_100721463
Length 240
Sequence VWLCVVLGGPHAAFKLIPGGLGRGARATRTDFSYTVAGMTPKSANLVRCSWPGNPLAIRYHDEEWGSPQHDDLVLFEFLILEGAQAGLSWDTILQKRENYRAALDGFNPERIVRYDRRKLKSLLGNPGIIRNRLKIESTVRNASAFLQTQKEFGSFDAYIWRFVGGKPRVNAWRPGERVPASTPESDAMSKDLKKRGFNFVGSTICYAFMQATGMVNDHNVKCFRYAQLTKSAIKRSQAT

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
121 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.52
Rhizosphere 92.29
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1011365 3300001978 Unclassified 900
2 JGI24743J22301_10000293 3300001991 Bacteria 5422
3 JGI24738J21930_10038615 3300002075 Unclassified 970
4 JGI24738J21930_10054479 3300002075 Unclassified 817
5 JGI24033J26618_1006334 3300002155 Bacteria 1326
6 JGI24034J26672_10002026 3300002239 Bacteria 2749
7 rootH1_10024035 3300003316 Bacteria 8072
8 rootH1_10024035 3300003323 Bacteria 75545
9 Ga0065704_10004392 3300005289 Unclassified 3627
10 Ga0065704_10296464 3300005289 Bacteria 892
11 Ga0065715_10116360 3300005293 Bacteria 2384
12 Ga0065707_10014157 3300005295 Unclassified 2066
13 Ga0065707_10115750 3300005295 Bacteria 2257
14 Ga0070658_10063359 3300005327 Bacteria 3014
15 Ga0070683_100007493 3300005329 Bacteria 9224
16 Ga0070690_100104267 3300005330 Bacteria 1883
17 Ga0070670_100020760 3300005331 Bacteria 5647
18 Ga0070670_100033325 3300005331 Bacteria 4436
19 Ga0070677_10004665 3300005333 Bacteria 4485
20 Ga0070666_10284686 3300005335 Bacteria 1175
21 Ga0070666_10313917 3300005335 Unclassified 1117
22 Ga0070682_100037463 3300005337 Bacteria 2969
23 Ga0068868_100011209 3300005338 Bacteria 6528
24 Ga0068868_100031743 3300005338 Bacteria 4060
25 Ga0068868_100055714 3300005338 Bacteria 3120
26 Ga0068868_100070039 3300005338 Bacteria 2796
27 Ga0070660_100011061 3300005339 Bacteria 6398
28 Ga0070689_100007514 3300005340 Bacteria 7627
29 Ga0070687_100006117 3300005343 Bacteria 4915
30 Ga0070661_100159243 3300005344 Bacteria 1709
31 Ga0070668_100004857 3300005347 Bacteria 9958
32 Ga0070669_100002184 3300005353 Bacteria 14162
33 Ga0070675_100006210 3300005354 Bacteria 9164
34 Ga0070671_100140064 3300005355 Bacteria 2041
35 Ga0070674_100001002 3300005356 Bacteria 14730
36 Ga0070673_100063181 3300005364 Bacteria 2945
37 Ga0070688_100000618 3300005365 Bacteria 17777
38 Ga0070688_100026891 3300005365 Bacteria 3423
39 Ga0070659_100012377 3300005366 Bacteria 6326
40 Ga0070709_10277867 3300005434 Bacteria 1216
41 Ga0070714_100009459 3300005435 Bacteria 7664
42 Ga0070714_100048131 3300005435 Bacteria 3625
43 Ga0070714_100050229 3300005435 Bacteria 3552
44 Ga0070714_100249108 3300005435 Bacteria 1642
45 Ga0070713_100003033 3300005436 Bacteria 11033
46 Ga0070713_100005047 3300005436 Bacteria 8976
47 Ga0070713_100014086 3300005436 Bacteria 5922
48 Ga0070713_100126931 3300005436 Bacteria 2245
49 Ga0070713_100414360 3300005436 Bacteria 1260
50 Ga0070710_10036205 3300005437 Bacteria 2697
51 Ga0070710_10161514 3300005437 Bacteria 1390
52 Ga0070711_100000088 3300005439 Bacteria 50242
53 Ga0070708_100000372 3300005445 Bacteria 33949
54 Ga0070708_100045053 3300005445 Bacteria 3884
55 Ga0070708_100140285 3300005445 Bacteria 2241
56 Ga0070708_100262237 3300005445 Bacteria 1624
57 Ga0070663_100215516 3300005455 Bacteria 1505
58 Ga0070678_100031605 3300005456 Bacteria 3655
59 Ga0070662_100028109 3300005457 Bacteria 3911
60 Ga0070662_100045611 3300005457 Bacteria 3146
61 Ga0070681_10282368 3300005458 Bacteria 1571
62 Ga0070681_10586987 3300005458 Bacteria 1028
63 Ga0068867_100068604 3300005459 Bacteria 2646
64 Ga0068867_100097363 3300005459 Bacteria 2242
65 Ga0068867_100310260 3300005459 Bacteria 1303
66 Ga0070685_10004460 3300005466 Bacteria 7079
67 Ga0070685_10191446 3300005466 Bacteria 1323
68 Ga0070706_100011146 3300005467 Bacteria 8345
69 Ga0070706_100014149 3300005467 Bacteria 7373
70 Ga0070706_100034560 3300005467 Bacteria 4670
71 Ga0070706_100035747 3300005467 Bacteria 4587
72 Ga0070707_100032068 3300005468 Bacteria 5005
73 Ga0070707_100053877 3300005468 Bacteria 3856
74 Ga0070707_100429417 3300005468 Bacteria 1282
75 Ga0070698_100003025 3300005471 Bacteria 18536
76 Ga0070698_100141468 3300005471 Bacteria 2357
77 Ga0070698_100411869 3300005471 Bacteria 1286
78 Ga0070698_100628867 3300005471 Bacteria 1014
79 Ga0070699_100001645 3300005518 Bacteria 20397
80 Ga0070699_100027284 3300005518 Bacteria 4927
81 Ga0070699_100097457 3300005518 Bacteria 2576
82 Ga0070679_100081066 3300005530 Bacteria 3234
83 Ga0070679_100150299 3300005530 Bacteria 2306
84 Ga0070684_100001860 3300005535 Bacteria 15457
85 Ga0070697_100001000 3300005536 Bacteria 21314
86 Ga0070697_100001970 3300005536 Bacteria 15701
87 Ga0070697_100143837 3300005536 Bacteria 2006
88 Ga0070697_100750157 3300005536 Bacteria 863
89 Ga0070697_101204151 3300005536 Bacteria 675
90 Ga0068853_100191802 3300005539 Bacteria 1857
91 Ga0068853_100321261 3300005539 Bacteria 1435
92 Ga0070672_100245973 3300005543 Bacteria 1505
93 Ga0070695_100502080 3300005545 Bacteria 938
94 Ga0070693_100096541 3300005547 Bacteria 1792
95 Ga0070693_100252817 3300005547 Unclassified 1169
96 Ga0068855_100022413 3300005563 Bacteria 7570
97 Ga0068855_100378380 3300005563 Bacteria 1555
98 Ga0068855_100424747 3300005563 Bacteria 1453
99 Ga0068855_100632156 3300005563 Bacteria 1151
100 Ga0070664_100009579 3300005564 Bacteria 7856
101 Ga0070664_100183003 3300005564 Bacteria 1863
102 Ga0068857_100003629 3300005577 Bacteria 12931
103 Ga0068854_100093594 3300005578 Bacteria 2240
104 Ga0068854_100131227 3300005578 Bacteria 1914
105 Ga0068856_100012749 3300005614 Bacteria 8138
106 Ga0068856_100261225 3300005614 Bacteria 1747
107 Ga0068856_101094457 3300005614 Bacteria 814
108 Ga0070702_100143575 3300005615 Bacteria 1523
109 Ga0070702_100174134 3300005615 Bacteria 1402
110 Ga0068852_100029544 3300005616 Bacteria 4505
111 Ga0068852_100307740 3300005616 Bacteria 1535
112 Ga0068859_100014872 3300005617 Bacteria 7815
113 Ga0068859_100627285 3300005617 Bacteria 1167
114 Ga0068864_100288990 3300005618 Bacteria 1532
115 Ga0068864_100501834 3300005618 Bacteria 1167
116 Ga0068864_100586170 3300005618 Bacteria 1081
117 Ga0068864_100868575 3300005618 Bacteria 889
118 Ga0068866_10005774 3300005718 Bacteria 5131
119 Ga0068866_10405716 3300005718 Bacteria 880
120 Ga0068861_100030010 3300005719 Bacteria 3982
121 Ga0068851_10001293 3300005834 Bacteria 10917
122 Ga0068870_10065757 3300005840 Bacteria 1962
123 Ga0068863_100212440 3300005841 Bacteria 1863
124 Ga0068863_100560552 3300005841 Bacteria 1129
125 Ga0068863_100975050 3300005841 Bacteria 850
126 Ga0068863_101092855 3300005841 Bacteria 802
127 Ga0068863_101147225 3300005841 Bacteria 782
128 Ga0068858_100034480 3300005842 Bacteria 4695
129 Ga0068858_100089967 3300005842 Bacteria 2856
130 Ga0068860_100215427 3300005843 Bacteria 1863
131 Ga0068860_101525515 3300005843 Bacteria 690
132 Ga0068862_100139313 3300005844 Bacteria 2152
133 Ga0081538_10106523 3300005981 Bacteria 1391
134 Ga0070717_10159030 3300006028 Bacteria 1959
135 Ga0070717_10186710 3300006028 Bacteria 1810
136 Ga0070717_10288270 3300006028 Bacteria 1457
137 Ga0070717_10342789 3300006028 Bacteria 1335
138 Ga0070717_10503490 3300006028 Bacteria 1095
139 Ga0070715_10011542 3300006163 Bacteria 3185
140 Ga0070716_100012833 3300006173 Bacteria 4258
141 Ga0070716_100039961 3300006173 Bacteria 2607
142 Ga0070716_100351720 3300006173 Unclassified 1043
143 Ga0070716_100703760 3300006173 Bacteria 772
144 Ga0070712_100001023 3300006175 Bacteria 16868
145 Ga0070712_100037626 3300006175 Bacteria 3300
146 Ga0097621_100002942 3300006237 Bacteria 11702
147 Ga0097621_100003025 3300006237 Bacteria 11549
148 Ga0097621_100127536 3300006237 Bacteria 2162
149 Ga0097621_100169529 3300006237 Bacteria 1881
150 Ga0097621_100198573 3300006237 Bacteria 1740
151 Ga0068871_100005057 3300006358 Bacteria 9209
152 Ga0068871_100134300 3300006358 Bacteria 2100
153 Ga0068871_101172486 3300006358 Bacteria 720
154 Ga0075428_100470396 3300006844 Bacteria 1346
155 Ga0075430_100059460 3300006846 Bacteria 3213
156 Ga0075431_100200094 3300006847 Bacteria 2044
157 Ga0075433_10061476 3300006852 Bacteria 3290
158 Ga0075433_10208223 3300006852 Bacteria 1738
159 Ga0075433_10239252 3300006852 Bacteria 1612
160 Ga0075434_100029506 3300006871 Bacteria 5398
161 Ga0075434_100056456 3300006871 Bacteria 3902
162 Ga0075434_100928863 3300006871 Bacteria 885
163 Ga0075434_100945974 3300006871 Bacteria 876
164 Ga0068865_100014699 3300006881 Bacteria 4980
165 Ga0075436_100125810 3300006914 Bacteria 1796
166 Ga0075436_100321267 3300006914 Bacteria 1112
167 Ga0097620_100014872 3300006931 Bacteria 7815
168 Ga0097620_100627238 3300006931 Bacteria 1167
169 Ga0075435_100041786 3300007076 Bacteria 3666
170 Ga0075435_100289109 3300007076 Bacteria 1400
171 Ga0075435_100303677 3300007076 Bacteria 1365
172 Ga0099794_10215525 3300007265 Bacteria 985
173 Ga0099795_10184031 3300007788 Bacteria 874
174 Ga0105240_10138512 3300009093 Bacteria 2912
175 Ga0105240_10139423 3300009093 Bacteria 2900
176 Ga0105240_10272894 3300009093 Bacteria 1946
177 Ga0105240_10611337 3300009093 Unclassified 1199
178 Ga0105245_10011327 3300009098 Bacteria 7765
179 Ga0105245_10036717 3300009098 Bacteria 4354
180 Ga0105245_10161933 3300009098 Bacteria 2124
181 Ga0105245_10479720 3300009098 Bacteria 1257
182 Ga0105247_10002094 3300009101 Bacteria 13797
183 Ga0105247_10258786 3300009101 Bacteria 1192
184 Ga0114129_10016072 3300009147 Bacteria 10647
185 Ga0114129_10130655 3300009147 Bacteria 3449
186 Ga0114129_10270317 3300009147 Bacteria 2274
187 Ga0114129_10823997 3300009147 Bacteria 1182
188 Ga0105241_10011865 3300009174 Bacteria 6402
189 Ga0105241_10026094 3300009174 Bacteria 4346
190 Ga0105241_10428352 3300009174 Bacteria 1166
191 Ga0105242_10017421 3300009176 Bacteria 5599
192 Ga0105242_10019497 3300009176 Bacteria 5315
193 Ga0105242_10056543 3300009176 Bacteria 3211
194 Ga0105248_10053100 3300009177 Bacteria 4548
195 Ga0105248_10067707 3300009177 Bacteria 4009
196 Ga0105248_10974855 3300009177 Bacteria 957
197 Ga0105248_11423632 3300009177 Bacteria 784
198 Ga0105237_10200491 3300009545 Bacteria 1995
199 Ga0105237_10292693 3300009545 Bacteria 1631
200 Ga0105238_10120868 3300009551 Bacteria 2598
201 Ga0105249_10009154 3300009553 Bacteria 8659
202 Ga0105249_10163504 3300009553 Bacteria 2153
203 Ga0105249_10229856 3300009553 Bacteria 1829
204 Ga0099796_10013153 3300010159 Bacteria 2356
205 Ga0105239_10004244 3300010375 Bacteria 17209
206 Ga0105239_10039817 3300010375 Bacteria 5149
207 Ga0105246_10006082 3300011119 Bacteria 7364
208 Ga0157373_10037404 3300013100 Bacteria 3479
209 Ga0157373_10065793 3300013100 Bacteria 2565
210 Ga0157371_10007472 3300013102 Bacteria 8844
211 Ga0157370_10374437 3300013104 Bacteria 1312
212 Ga0157370_10396412 3300013104 Bacteria 1271
213 Ga0157369_10008874 3300013105 Bacteria 11517
214 Ga0157369_10647107 3300013105 Bacteria 1090
215 Ga0157374_10009612 3300013296 Bacteria 8307
216 Ga0157374_10129214 3300013296 Bacteria 2444
217 Ga0157374_10547261 3300013296 Bacteria 1165
218 Ga0157374_10678244 3300013296 Bacteria 1043
219 Ga0157374_10800591 3300013296 Bacteria 958
220 Ga0157378_10001446 3300013297 Bacteria 21385
221 Ga0157378_10003132 3300013297 Bacteria 14698
222 Ga0157378_10034794 3300013297 Bacteria 4455
223 Ga0157378_10203194 3300013297 Bacteria 1875
224 Ga0157378_10362598 3300013297 Bacteria 1418
225 Ga0163162_10072102 3300013306 Bacteria 3508
226 Ga0163162_10375724 3300013306 Bacteria 1554
227 Ga0163162_10905856 3300013306 Bacteria 995
228 Ga0157372_10009715 3300013307 Bacteria 10231
229 Ga0157375_10058244 3300013308 Bacteria 3821
230 Ga0157375_10240499 3300013308 Bacteria 1970
231 Ga0157375_10537279 3300013308 Bacteria 1331
232 Ga0163163_10001263 3300014325 Bacteria 21347
233 Ga0163163_10073698 3300014325 Bacteria 3405
234 Ga0163163_10427379 3300014325 Bacteria 1384
235 Ga0163163_11327650 3300014325 Bacteria 781
236 Ga0157380_10016601 3300014326 Bacteria 5434
237 Ga0182008_10143790 3300014497 Bacteria 1194
238 Ga0157377_10000395 3300014745 Bacteria 18883
239 Ga0157379_10010509 3300014968 Bacteria 8069
240 Ga0157379_10072146 3300014968 Bacteria 3089
241 Ga0157379_10143664 3300014968 Bacteria 2152
242 Ga0157379_10393568 3300014968 Bacteria 1273
243 Ga0157379_10859857 3300014968 Bacteria 859
244 Ga0157376_10015792 3300014969 Bacteria 5713
245 Ga0157376_10589341 3300014969 Bacteria 1105
246 Ga0182006_1045441 3300015261 Bacteria 1709
247 Ga0182007_10054360 3300015262 Bacteria 1317
248 Ga0163161_10010982 3300017792 Bacteria 6275
249 Ga0206353_11610671 3300020082 Bacteria 3579
250 Ga0224569_104478 3300022732 Bacteria 1055
251 Ga0228598_1000500 3300024227 Bacteria 8100
252 Ga0228598_1031093 3300024227 Bacteria 1051
253 Ga0207697_10000518 3300025315 Bacteria 21729
254 Ga0207692_10056376 3300025898 Bacteria 2015
255 Ga0207692_10070927 3300025898 Bacteria 1835
256 Ga0207642_10139704 3300025899 Bacteria 1275
257 Ga0207642_10212981 3300025899 Bacteria 1075
258 Ga0207710_10025813 3300025900 Bacteria 2537
259 Ga0207688_10025189 3300025901 Bacteria 3266
260 Ga0207680_10001286 3300025903 Bacteria 11881
261 Ga0207647_10004047 3300025904 Bacteria 10920
262 Ga0207699_10007868 3300025906 Bacteria 5227
263 Ga0207699_10111524 3300025906 Bacteria 1754
264 Ga0207645_10000351 3300025907 Bacteria 38347
265 Ga0207643_10001192 3300025908 Bacteria 15359
266 Ga0207705_10270407 3300025909 Unclassified 1299
267 Ga0207684_10000343 3300025910 Bacteria 64775
268 Ga0207684_10024334 3300025910 Bacteria 5164
269 Ga0207684_10034425 3300025910 Bacteria 4304
270 Ga0207684_10116985 3300025910 Bacteria 2284
271 Ga0207707_10002986 3300025912 Bacteria 15042
272 Ga0207707_10026135 3300025912 Bacteria 5105
273 Ga0207707_10052522 3300025912 Bacteria 3548
274 Ga0207707_10414335 3300025912 Bacteria 1156
275 Ga0207695_10003555 3300025913 Bacteria 21825
276 Ga0207695_10116775 3300025913 Bacteria 2642
277 Ga0207695_10354910 3300025913 Bacteria 1353
278 Ga0207693_10000235 3300025915 Bacteria 50962
279 Ga0207693_10000917 3300025915 Bacteria 26443
280 Ga0207693_10215247 3300025915 Bacteria 1510
281 Ga0207663_10011339 3300025916 Bacteria 4784
282 Ga0207663_10108409 3300025916 Bacteria 1880
283 Ga0207663_10186270 3300025916 Bacteria 1486
284 Ga0207660_10126061 3300025917 Unclassified 1944
285 Ga0207662_10009503 3300025918 Bacteria 5355
286 Ga0207657_10004756 3300025919 Bacteria 14337
287 Ga0207649_10000928 3300025920 Bacteria 18426
288 Ga0207649_10097644 3300025920 Bacteria 1937
289 Ga0207652_10168724 3300025921 Bacteria 1963
290 Ga0207646_10000566 3300025922 Bacteria 48722
291 Ga0207646_10199650 3300025922 Bacteria 1806
292 Ga0207681_10006380 3300025923 Bacteria 7240
293 Ga0207694_10000373 3300025924 Bacteria 41710
294 Ga0207694_10067120 3300025924 Bacteria 2800
295 Ga0207650_10000059 3300025925 Bacteria 151427
296 Ga0207650_10686686 3300025925 Bacteria 864
297 Ga0207659_10007240 3300025926 Bacteria 6817
298 Ga0207687_10122961 3300025927 Bacteria 1943
299 Ga0207687_10144991 3300025927 Bacteria 1805
300 Ga0207700_10051984 3300025928 Bacteria 3061
301 Ga0207700_10062960 3300025928 Bacteria 2819
302 Ga0207700_10149593 3300025928 Bacteria 1928
303 Ga0207700_10318179 3300025928 Unclassified 1348
304 Ga0207664_10031786 3300025929 Bacteria 4042
305 Ga0207664_10080151 3300025929 Bacteria 2653
306 Ga0207644_10002945 3300025931 Bacteria 10965
307 Ga0207644_10717888 3300025931 Bacteria 834
308 Ga0207690_10039695 3300025932 Bacteria 3072
309 Ga0207706_10002202 3300025933 Bacteria 18999
310 Ga0207706_10013693 3300025933 Bacteria 7361
311 Ga0207686_10009371 3300025934 Bacteria 5310
312 Ga0207686_10153171 3300025934 Bacteria 1607
313 Ga0207670_10317864 3300025936 Unclassified 1224
314 Ga0207669_10037058 3300025937 Bacteria 2794
315 Ga0207669_10215404 3300025937 Bacteria 1405
316 Ga0207704_10003936 3300025938 Bacteria 6751
317 Ga0207665_10012740 3300025939 Bacteria 5529
318 Ga0207665_10013558 3300025939 Bacteria 5361
319 Ga0207665_10019479 3300025939 Bacteria 4461
320 Ga0207665_10062347 3300025939 Bacteria 2530
321 Ga0207691_10002027 3300025940 Bacteria 19823
322 Ga0207691_10657861 3300025940 Bacteria 885
323 Ga0207711_10003820 3300025941 Bacteria 12956
324 Ga0207711_10084342 3300025941 Bacteria 2781
325 Ga0207711_10236252 3300025941 Bacteria 1675
326 Ga0207689_10464124 3300025942 Unclassified 1059
327 Ga0207661_10000352 3300025944 Bacteria 29636
328 Ga0207679_10000039 3300025945 Bacteria 127661
329 Ga0207679_10278763 3300025945 Bacteria 1433
330 Ga0207667_10151991 3300025949 Bacteria 2382
331 Ga0207712_10149179 3300025961 Bacteria 1804
332 Ga0207712_10449391 3300025961 Unclassified 1093
333 Ga0207668_10665411 3300025972 Unclassified 912
334 Ga0207640_10199569 3300025981 Bacteria 1515
335 Ga0207640_10616722 3300025981 Bacteria 920
336 Ga0207658_10003811 3300025986 Bacteria 10616
337 Ga0207677_10022187 3300026023 Bacteria 3897
338 Ga0207677_10022240 3300026023 Bacteria 3893
339 Ga0207677_10042875 3300026023 Bacteria 3004
340 Ga0207703_10003512 3300026035 Bacteria 13111
341 Ga0207703_10107745 3300026035 Bacteria 2372
342 Ga0207639_10020333 3300026041 Bacteria 4750
343 Ga0207639_10040122 3300026041 Bacteria 3492
344 Ga0207639_10050254 3300026041 Unclassified 3166
345 Ga0207678_10001428 3300026067 Bacteria 21910
346 Ga0207678_10012262 3300026067 Bacteria 7526
347 Ga0207641_10000025 3300026088 Bacteria 247727
348 Ga0207648_10000420 3300026089 Bacteria 46606
349 Ga0207648_10095946 3300026089 Bacteria 2595
350 Ga0207648_10154398 3300026089 Bacteria 2026
351 Ga0207648_10198181 3300026089 Bacteria 1781
352 Ga0207676_10000104 3300026095 Bacteria 74872
353 Ga0207676_10010310 3300026095 Bacteria 6654
354 Ga0207676_10184284 3300026095 Bacteria 1831
355 Ga0207674_10000604 3300026116 Bacteria 47244
356 Ga0207674_10048267 3300026116 Bacteria 4358
357 Ga0207675_100025053 3300026118 Bacteria 5552
358 Ga0207675_100451770 3300026118 Bacteria 1273
359 Ga0207683_10000726 3300026121 Bacteria 29917
360 Ga0207698_10129371 3300026142 Bacteria 2154
361 Ga0209588_1028186 3300027671 Bacteria 1787
362 Ga0209971_1014569 3300027682 Bacteria 1864
363 Ga0268266_10004403 3300028379 Bacteria 13498
364 Ga0268266_10407088 3300028379 Bacteria 1287
365 Ga0268265_10028564 3300028380 Bacteria 3994
366 Ga0268264_11206053 3300028381 Unclassified 766
367 Ga0268264_11236497 3300028381 Bacteria 757
368 Ga0265334_10027748 3300028573 Bacteria 2278
369 Ga0265338_10009983 3300028800 Bacteria 11226
370 Ga0265338_10018073 3300028800 Bacteria 7565
371 Ga0265324_10025469 3300029957 Bacteria 2097
372 Ga0265324_10068170 3300029957 Bacteria 1213
373 Ga0265762_1000054 3300030760 Bacteria 14200
374 Ga0265325_10177884 3300031241 Bacteria 992
375 Ga0265340_10002940 3300031247 Bacteria 9706
376 Ga0265339_10003616 3300031249 Bacteria 10790
377 Ga0265339_10039467 3300031249 Bacteria 2628
378 Ga0265316_10017341 3300031344 Bacteria 6229
379 Ga0265316_10044782 3300031344 Bacteria 3517
380 Ga0265316_10067485 3300031344 Bacteria 2766
381 Ga0265313_10084322 3300031595 Bacteria 1438
382 Ga0265314_10054191 3300031711 Bacteria 2776
383 Ga0265342_10077720 3300031712 Bacteria 1921
384 Ga0307406_10054824 3300031901 Bacteria 2546
385 Ga0307406_10083263 3300031901 Bacteria 2133
386 Ga0307406_10813718 3300031901 Bacteria 789
387 Ga0307412_10484035 3300031911 Bacteria 1027
388 Ga0307416_100737355 3300032002 Bacteria 1077
389 Ga0307415_100204175 3300032126 Bacteria 1571
390 Ga0316214_1015830 3300033545 Bacteria 1041
391 Ga0373926_0135321 3300035083 Bacteria 935
392 Ga0373923_0074198 3300035111 Bacteria 1466
393 Ga0373936_0007973 3300035113 Bacteria 3980
394 Ga0373945_0040414 3300035116 Bacteria 1684
395 Ga0373956_0107317 3300035119 Bacteria 1298
396 Ga0373943_0589193 3300035170 Bacteria 654
397 Ga0373955_0001911 3300035172 Bacteria 8994
398 Ga0373955_0348459 3300035172 Bacteria 897
399 Ga0373924_0023551 3300035410 Bacteria 2418
400 Ga0373931_0079635 3300035691 Bacteria 1805
401 Ga0373927_0185106 3300035695 Bacteria 1366
402 Ga0373933_0094760 3300035724 Bacteria 1846
403 Ga0373947_0019871 3300035725 Bacteria 3877
404 Ga0373947_0178513 3300035725 Bacteria 1381
405 Ga0373937_0002384 3300036401 Bacteria 15640
406 Ga0373937_0189818 3300036401 Bacteria 1930
407 Ga0373937_0342679 3300036401 Bacteria 1415
408 Ga0373925_0018793 3300037068 Bacteria 5023
409 Ga0373925_0022953 3300037068 Bacteria 4553
410 Ga0436364_0478514 3300037853 Bacteria 578677
411 Ga0395901_0085256 3300038443 Bacteria 3302
412 Ga0436363_1034869 3300039450 Unclassified 1428
413 Ga0436363_1104128 3300039450 Bacteria 1026
414 Ga0451807_1173178 3300041486 Unclassified 1763
415 Ga0451853_1364154 3300041512 Bacteria 853
416 Ga0453684_0431164 3300044712 Bacteria 1471
417 Ga0453684_0745605 3300044712 Bacteria 1060
418 Ga0495629_0115632 3300046459 Bacteria 1869
419 Ga0495629_0284187 3300046459 Bacteria 1135
420 Ga0495653_0174966 3300046463 Bacteria 1478
421 Ga0495580_0002574 3300046472 Bacteria 15779
422 Ga0495580_0016659 3300046472 Bacteria 5515
423 Ga0495580_0162797 3300046472 Bacteria 1544
424 Ga0495582_0001652 3300046473 Bacteria 12577
425 Ga0495639_0074505 3300046475 Bacteria 1573
426 Ga0495662_0282625 3300046476 Bacteria 817
427 Ga0495664_0468215 3300046477 Bacteria 754
428 Ga0495630_0002261 3300046517 Bacteria 13411
429 Ga0495630_0035927 3300046517 Bacteria 3704
430 Ga0495665_0041486 3300046531 Bacteria 2450
431 Ga0495665_0143922 3300046531 Bacteria 1245
432 Ga0495640_0103137 3300046533 Bacteria 1871
433 Ga0495645_0040763 3300046543 Bacteria 3386
434 Ga0495667_0044371 3300046559 Bacteria 2945
435 Ga0495588_0388387 3300046674 Bacteria 733
436 Ga0495599_0024973 3300046678 Bacteria 3738
437 Ga0495658_0022331 3300046683 Bacteria 3345
438 Ga0495613_0092847 3300046689 Bacteria 2185
439 Ga0495613_0428979 3300046689 Bacteria 898
440 Ga0495624_0214132 3300046690 Bacteria 1168
441 Ga0495604_0432944 3300047317 Bacteria 862
442 Ga0495674_0027723 3300047319 Bacteria 5172
443 Ga0495684_0015204 3300047471 Bacteria 5927
444 Ga0495684_0251055 3300047471 Bacteria 1287
445 Ga0495602_0009589 3300048088 Bacteria 10064
446 Ga0495602_0166657 3300048088 Bacteria 1714
447 Ga0496100_0094863 3300048903 Bacteria 2044
448 Ga0496100_0169131 3300048903 Bacteria 1572
449 Ga0496100_0276717 3300048903 Bacteria 1250
450 Ga0496101_0007762 3300048904 Bacteria 6973
451 Ga0496101_0492645 3300048904 Bacteria 968
452 Ga0496102_0008957 3300048905 Bacteria 8584
453 Ga0496102_0622053 3300048905 Bacteria 1003
454 Ga0496102_0834322 3300048905 Bacteria 844
455 Ga0496103_0002761 3300048906 Bacteria 10929
456 Ga0496104_0016605 3300048907 Bacteria 6690
457 Ga0496104_0019128 3300048907 Bacteria 6261
458 Ga0496104_0316433 3300048907 Unclassified 1474
459 Ga0496105_0062761 3300048908 Bacteria 3066
460 Ga0496105_0475092 3300048908 Bacteria 984
461 Ga0496106_0177283 3300048909 Bacteria 1691
462 Ga0496107_0036181 3300048910 Bacteria 3541
463 Ga0496107_0064042 3300048910 Bacteria 2665
464 Ga0496108_0000539 3300048911 Bacteria 29583
465 Ga0496109_0000099 3300048912 Bacteria 89901
466 Ga0496109_0377147 3300048912 Bacteria 1340
467 Ga0496110_1124946 3300048913 Bacteria 694
468 Ga0496111_0007248 3300048914 Bacteria 7256
469 Ga0496112_0000043 3300048915 Bacteria 87684
470 Ga0496112_0004735 3300048915 Bacteria 11593
471 Ga0496112_0142622 3300048915 Bacteria 2365
472 Ga0496112_0521693 3300048915 Bacteria 1123
473 Ga0496112_0675114 3300048915 Bacteria 962
474 Ga0496113_0000107 3300048916 Bacteria 35660
475 Ga0496114_0040815 3300048917 Bacteria 3843
476 Ga0496114_0887149 3300048917 Bacteria 773
477 Ga0496115_0000641 3300048918 Bacteria 26296
478 Ga0496115_0459348 3300048918 Bacteria 1027
479 Ga0501047_0282593 3300049581 Bacteria 1504
480 Ga0501067_0221463 3300049583 Bacteria 1054
481 Ga0501230_001699 3300049667 Bacteria 2676
482 Ga0501080_0146801 3300049742 Bacteria 2180
483 Ga0501044_0000119 3300049823 Bacteria 95213
484 Ga0501044_0029160 3300049823 Bacteria 5820
485 nmdc:mga05p37_119627_c1 3300050507 Bacteria 3236
486 nmdc:mga05p37_218789_c1 3300050507 Bacteria 2299
487 nmdc:mga05p37_32696_c1 3300050507 Bacteria 6364
488 nmdc:mga0qj67_55737_c1 3300050509 Bacteria 3132
489 nmdc:mga0n895_159551_c1 3300050512 Bacteria 2286
490 nmdc:mga0n895_26612_c1 3300050512 Bacteria 5481
491 nmdc:mga0n895_57981_c1 3300050512 Bacteria 3818
492 nmdc:mga0n895_717297_c1 3300050512 Bacteria 995
493 nmdc:mga0n895_801306_c1 3300050512 Bacteria 932
494 nmdc:mga0rr50_14356_c1 3300050513 Bacteria 5193
495 nmdc:mga0rr50_36361_c1 3300050513 Bacteria 3545
496 nmdc:mga0rr50_457092_c1 3300050513 Bacteria 1083
497 nmdc:mga08x19_5242_c1 3300050514 Bacteria 7672
498 nmdc:mga0a205_29175_c2 3300050515 Bacteria 4060
499 nmdc:mga0a205_40967_c1 3300050515 Bacteria 4460
500 nmdc:mga0a205_702902_c1 3300050515 Bacteria 861
501 Ga0495601_0029076 3300053077 Bacteria 3426
502 Ga0495601_0178125 3300053077 Bacteria 1390
503 Ga0495612_0368099 3300053078 Bacteria 650
504 Ga0495619_0092197 3300053085 Bacteria 2052
505 Ga0495619_0229566 3300053085 Bacteria 1286
506 Ga0501084_0789782 3300054114 Bacteria 800
507 Ga0501082_0080996 3300060353 Bacteria 2802

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028573 Ga0265334_10027748 Ga0265334_100277482 183
2 3300031247 Ga0265340_10002940 Ga0265340_100029407 183
3 3300031344 Ga0265316_10044782 Ga0265316_100447822 183
4 3300031595 Ga0265313_10084322 Ga0265313_100843222 183
5 3300035111 Ga0373923_0074198 Ga0373923_0074198_55_633 186
6 3300035119 Ga0373956_0107317 Ga0373956_0107317_418_996 186
7 3300035172 Ga0373955_0001911 Ga0373955_0001911_2091_2669 186
8 3300035724 Ga0373933_0094760 Ga0373933_0094760_16_594 186
9 3300036401 Ga0373937_0002384 Ga0373937_0002384_5037_5615 186
10 3300048088 Ga0495602_0009589 Ga0495602_0009589_7634_8212 186
11 3300005471 Ga0070698_100628867 Ga0070698_1006288673 187
12 3300026067 Ga0207678_10012262 Ga0207678_100122628 187
13 3300005331 Ga0070670_100020760 Ga0070670_1000207602 188
14 3300005365 Ga0070688_100026891 Ga0070688_1000268915 188
15 3300005466 Ga0070685_10191446 Ga0070685_101914462 188
16 3300005617 Ga0068859_100014872 Ga0068859_1000148728 188
17 3300006931 Ga0097620_100014872 Ga0097620_1000148722 188
18 3300009093 Ga0105240_10272894 Ga0105240_102728942 188
19 3300009551 Ga0105238_10120868 Ga0105238_101208684 188
20 3300025924 Ga0207694_10067120 Ga0207694_100671202 188
21 3300025925 Ga0207650_10686686 Ga0207650_106866862 188
22 3300029957 Ga0265324_10025469 Ga0265324_100254692 188
23 3300041512 Ga0451853_1364154 Ga0451853_1364154_49_642 188
24 3300005618 Ga0068864_100868575 Ga0068864_1008685752 189
25 3300005457 Ga0070662_100028109 Ga0070662_1000281095 190
26 3300005530 Ga0070679_100150299 Ga0070679_1001502994 190
27 3300005536 Ga0070697_100750157 Ga0070697_1007501572 190
28 3300005564 Ga0070664_100009579 Ga0070664_1000095795 190
29 3300006871 Ga0075434_100928863 Ga0075434_1009288632 190
30 3300006914 Ga0075436_100321267 Ga0075436_1003212672 190
31 3300009147 Ga0114129_10130655 Ga0114129_101306554 190
32 3300014325 Ga0163163_11327650 Ga0163163_113276501 190
33 3300024227 Ga0228598_1031093 Ga0228598_10310932 190
34 3300025920 Ga0207649_10097644 Ga0207649_100976443 190
35 3300025933 Ga0207706_10013693 Ga0207706_100136935 190
36 3300025981 Ga0207640_10199569 Ga0207640_101995691 190
37 3300026041 Ga0207639_10050254 Ga0207639_100502545 190
38 3300026116 Ga0207674_10048267 Ga0207674_100482676 190
39 3300031901 Ga0307406_10083263 Ga0307406_100832633 190
40 3300031911 Ga0307412_10484035 Ga0307412_104840352 190
41 3300032002 Ga0307416_100737355 Ga0307416_1007373552 190
42 3300032126 Ga0307415_100204175 Ga0307415_1002041752 190
43 3300041486 Ga0451807_1173178 Ga0451807_1173178_963_1577 190
44 3300048915 Ga0496112_0675114 Ga0496112_0675114_17_613 190
45 3300050507 nmdc:mga05p37_218789_c1 nmdc:mga05p37_218789_c1_1333_1929 190
46 3300005445 Ga0070708_100045053 Ga0070708_1000450532 191
47 3300005467 Ga0070706_100034560 Ga0070706_1000345603 191
48 3300005518 Ga0070699_100027284 Ga0070699_1000272845 191
49 3300005536 Ga0070697_100143837 Ga0070697_1001438372 191
50 3300007265 Ga0099794_10215525 Ga0099794_102155252 191
51 3300025910 Ga0207684_10116985 Ga0207684_101169853 191
52 3300036401 Ga0373937_0342679 Ga0373937_0342679_819_1400 191
53 3300038443 Ga0395901_0085256 Ga0395901_0085256_2618_3205 191
54 3300049583 Ga0501067_0221463 Ga0501067_0221463_210_809 191
55 3300005289 Ga0065704_10004392 Ga0065704_100043923 192
56 3300005295 Ga0065707_10115750 Ga0065707_101157502 192
57 3300005435 Ga0070714_100249108 Ga0070714_1002491082 192
58 3300005539 Ga0068853_100191802 Ga0068853_1001918024 192
59 3300005563 Ga0068855_100424747 Ga0068855_1004247473 192
60 3300005563 Ga0068855_100632156 Ga0068855_1006321562 192
61 3300005578 Ga0068854_100131227 Ga0068854_1001312273 192
62 3300005616 Ga0068852_100307740 Ga0068852_1003077402 192
63 3300009093 Ga0105240_10611337 Ga0105240_106113372 192
64 3300009147 Ga0114129_10270317 Ga0114129_102703173 192
65 3300009174 Ga0105241_10428352 Ga0105241_104283522 192
66 3300013100 Ga0157373_10065793 Ga0157373_100657934 192
67 3300013104 Ga0157370_10374437 Ga0157370_103744373 192
68 3300013104 Ga0157370_10396412 Ga0157370_103964122 192
69 3300013105 Ga0157369_10647107 Ga0157369_106471071 192
70 3300013296 Ga0157374_10129214 Ga0157374_101292143 192
71 3300020082 Ga0206353_11610671 Ga0206353_116106714 192
72 3300025913 Ga0207695_10003555 Ga0207695_1000355520 192
73 3300025917 Ga0207660_10126061 Ga0207660_101260614 192
74 3300025939 Ga0207665_10062347 Ga0207665_100623473 192
75 3300025940 Ga0207691_10657861 Ga0207691_106578611 192
76 3300025981 Ga0207640_10616722 Ga0207640_106167222 192
77 3300027682 Ga0209971_1014569 Ga0209971_10145692 192
78 3300031901 Ga0307406_10813718 Ga0307406_108137181 192
79 3300046476 Ga0495662_0282625 Ga0495662_0282625_77_667 192
80 3300046517 Ga0495630_0002261 Ga0495630_0002261_7199_7789 192
81 3300047471 Ga0495684_0015204 Ga0495684_0015204_3511_4101 192
82 3300050514 nmdc:mga08x19_5242_c1 nmdc:mga08x19_5242_c1_1206_1811 192
83 3300005435 Ga0070714_100050229 Ga0070714_1000502292 193
84 3300005436 Ga0070713_100005047 Ga0070713_1000050474 193
85 3300005436 Ga0070713_100414360 Ga0070713_1004143602 193
86 3300005467 Ga0070706_100035747 Ga0070706_1000357472 193
87 3300005468 Ga0070707_100053877 Ga0070707_1000538774 193
88 3300005518 Ga0070699_100097457 Ga0070699_1000974573 193
89 3300005536 Ga0070697_101204151 Ga0070697_1012041511 193
90 3300005539 Ga0068853_100321261 Ga0068853_1003212612 193
91 3300005981 Ga0081538_10106523 Ga0081538_101065231 193
92 3300006028 Ga0070717_10186710 Ga0070717_101867102 193
93 3300006028 Ga0070717_10342789 Ga0070717_103427892 193
94 3300006173 Ga0070716_100039961 Ga0070716_1000399612 193
95 3300006173 Ga0070716_100351720 Ga0070716_1003517201 193
96 3300006175 Ga0070712_100001023 Ga0070712_1000010233 193
97 3300006358 Ga0068871_101172486 Ga0068871_1011724861 193
98 3300006844 Ga0075428_100470396 Ga0075428_1004703962 193
99 3300006847 Ga0075431_100200094 Ga0075431_1002000943 193
100 3300009147 Ga0114129_10823997 Ga0114129_108239973 193
101 3300014968 Ga0157379_10859857 Ga0157379_108598572 193
102 3300025906 Ga0207699_10007868 Ga0207699_100078686 193
103 3300025910 Ga0207684_10024334 Ga0207684_100243343 193
104 3300025915 Ga0207693_10000235 Ga0207693_100002357 193
105 3300025916 Ga0207663_10011339 Ga0207663_100113395 193
106 3300025922 Ga0207646_10199650 Ga0207646_101996502 193
107 3300025928 Ga0207700_10051984 Ga0207700_100519842 193
108 3300025928 Ga0207700_10318179 Ga0207700_103181792 193
109 3300025939 Ga0207665_10013558 Ga0207665_100135582 193
110 3300026041 Ga0207639_10040122 Ga0207639_100401222 193
111 3300027671 Ga0209588_1028186 Ga0209588_10281862 193
112 3300028800 Ga0265338_10009983 Ga0265338_100099836 193
113 3300029957 Ga0265324_10068170 Ga0265324_100681702 193
114 3300031249 Ga0265339_10003616 Ga0265339_100036166 193
115 3300031344 Ga0265316_10017341 Ga0265316_100173418 193
116 3300031711 Ga0265314_10054191 Ga0265314_100541913 193
117 3300033545 Ga0316214_1015830 Ga0316214_10158301 193
118 3300035083 Ga0373926_0135321 Ga0373926_0135321_240_854 193
119 3300035113 Ga0373936_0007973 Ga0373936_0007973_1207_1794 193
120 3300035116 Ga0373945_0040414 Ga0373945_0040414_10_624 193
121 3300035170 Ga0373943_0589193 Ga0373943_0589193_46_633 193
122 3300035172 Ga0373955_0348459 Ga0373955_0348459_18_605 193
123 3300035410 Ga0373924_0023551 Ga0373924_0023551_562_1149 193
124 3300035695 Ga0373927_0185106 Ga0373927_0185106_672_1286 193
125 3300035725 Ga0373947_0019871 Ga0373947_0019871_1290_1904 193
126 3300035725 Ga0373947_0178513 Ga0373947_0178513_170_757 193
127 3300037068 Ga0373925_0018793 Ga0373925_0018793_1966_2580 193
128 3300046459 Ga0495629_0115632 Ga0495629_0115632_666_1280 193
129 3300046472 Ga0495580_0002574 Ga0495580_0002574_4479_5093 193
130 3300046473 Ga0495582_0001652 Ga0495582_0001652_3381_3995 193
131 3300046475 Ga0495639_0074505 Ga0495639_0074505_145_759 193
132 3300046477 Ga0495664_0468215 Ga0495664_0468215_63_650 193
133 3300046517 Ga0495630_0035927 Ga0495630_0035927_2042_2629 193
134 3300046531 Ga0495665_0041486 Ga0495665_0041486_832_1446 193
135 3300046533 Ga0495640_0103137 Ga0495640_0103137_560_1147 193
136 3300046674 Ga0495588_0388387 Ga0495588_0388387_11_625 193
137 3300046683 Ga0495658_0022331 Ga0495658_0022331_1952_2566 193
138 3300046689 Ga0495613_0428979 Ga0495613_0428979_113_727 193
139 3300047319 Ga0495674_0027723 Ga0495674_0027723_801_1388 193
140 3300047471 Ga0495684_0251055 Ga0495684_0251055_115_702 193
141 3300048903 Ga0496100_0276717 Ga0496100_0276717_422_1009 193
142 3300048907 Ga0496104_0019128 Ga0496104_0019128_2102_2689 193
143 3300048908 Ga0496105_0475092 Ga0496105_0475092_370_957 193
144 3300048918 Ga0496115_0459348 Ga0496115_0459348_237_824 193
145 3300049823 Ga0501044_0029160 Ga0501044_0029160_4183_4764 193
146 3300050507 nmdc:mga05p37_119627_c1 nmdc:mga05p37_119627_c1_407_988 193
147 3300050512 nmdc:mga0n895_801306_c1 nmdc:mga0n895_801306_c1_237_845 193
148 3300053077 Ga0495601_0029076 Ga0495601_0029076_1626_2213 193
149 3300053085 Ga0495619_0092197 Ga0495619_0092197_1051_1638 193
150 3300005445 Ga0070708_100262237 Ga0070708_1002622372 194
151 3300005468 Ga0070707_100429417 Ga0070707_1004294172 194
152 3300005618 Ga0068864_100586170 Ga0068864_1005861701 194
153 3300006846 Ga0075430_100059460 Ga0075430_1000594602 194
154 3300028800 Ga0265338_10018073 Ga0265338_100180737 194
155 3300031241 Ga0265325_10177884 Ga0265325_101778842 194
156 3300031249 Ga0265339_10039467 Ga0265339_100394674 194
157 3300031344 Ga0265316_10067485 Ga0265316_100674852 194
158 3300037853 Ga0436364_0478514 Ga0436364_0478514_36404_37036 194
159 3300039450 Ga0436363_1034869 Ga0436363_1034869_85_699 194
160 3300044712 Ga0453684_0431164 Ga0453684_0431164_591_1178 194
161 3300044712 Ga0453684_0745605 Ga0453684_0745605_94_696 194
162 3300050509 nmdc:mga0qj67_55737_c1 nmdc:mga0qj67_55737_c1_1608_2195 194
163 3300003323 rootH1_10024035 rootH1_1002403541 195
164 3300005435 Ga0070714_100009459 Ga0070714_1000094596 195
165 3300005435 Ga0070714_100048131 Ga0070714_1000481312 195
166 3300005436 Ga0070713_100003033 Ga0070713_1000030333 195
167 3300005436 Ga0070713_100014086 Ga0070713_1000140863 195
168 3300005437 Ga0070710_10036205 Ga0070710_100362052 195
169 3300005467 Ga0070706_100011146 Ga0070706_1000111462 195
170 3300005471 Ga0070698_100141468 Ga0070698_1001414681 195
171 3300005471 Ga0070698_100411869 Ga0070698_1004118691 195
172 3300006028 Ga0070717_10159030 Ga0070717_101590301 195
173 3300006852 Ga0075433_10239252 Ga0075433_102392522 195
174 3300007076 Ga0075435_100041786 Ga0075435_1000417864 195
175 3300009147 Ga0114129_10016072 Ga0114129_100160728 195
176 3300014325 Ga0163163_10427379 Ga0163163_104273793 195
177 3300025898 Ga0207692_10070927 Ga0207692_100709272 195
178 3300025906 Ga0207699_10111524 Ga0207699_101115241 195
179 3300025910 Ga0207684_10034425 Ga0207684_100344252 195
180 3300025912 Ga0207707_10026135 Ga0207707_100261354 195
181 3300025912 Ga0207707_10414335 Ga0207707_104143352 195
182 3300025928 Ga0207700_10062960 Ga0207700_100629602 195
183 3300025928 Ga0207700_10149593 Ga0207700_101495933 195
184 3300025929 Ga0207664_10031786 Ga0207664_100317864 195
185 3300025929 Ga0207664_10080151 Ga0207664_100801514 195
186 3300025945 Ga0207679_10278763 Ga0207679_102787632 195
187 3300026095 Ga0207676_10010310 Ga0207676_100103102 195
188 3300026118 Ga0207675_100451770 Ga0207675_1004517702 195
189 3300031712 Ga0265342_10077720 Ga0265342_100777202 195
190 3300031901 Ga0307406_10054824 Ga0307406_100548245 195
191 3300046472 Ga0495580_0162797 Ga0495580_0162797_713_1306 195
192 3300050507 nmdc:mga05p37_32696_c1 nmdc:mga05p37_32696_c1_3487_4107 195
193 3300050512 nmdc:mga0n895_159551_c1 nmdc:mga0n895_159551_c1_1001_1621 195
194 3300050513 nmdc:mga0rr50_36361_c1 nmdc:mga0rr50_36361_c1_2010_2630 195
195 3300050515 nmdc:mga0a205_702902_c1 nmdc:mga0a205_702902_c1_200_820 195
196 3300053078 Ga0495612_0368099 Ga0495612_0368099_13_606 195
197 3300005335 Ga0070666_10284686 Ga0070666_102846861 196
198 3300005338 Ga0068868_100031743 Ga0068868_1000317434 196
199 3300005338 Ga0068868_100055714 Ga0068868_1000557145 196
200 3300005338 Ga0068868_100070039 Ga0068868_1000700392 196
201 3300005458 Ga0070681_10586987 Ga0070681_105869871 196
202 3300005459 Ga0068867_100097363 Ga0068867_1000973632 196
203 3300005459 Ga0068867_100310260 Ga0068867_1003102601 196
204 3300005563 Ga0068855_100378380 Ga0068855_1003783804 196
205 3300005578 Ga0068854_100093594 Ga0068854_1000935942 196
206 3300005614 Ga0068856_101094457 Ga0068856_1010944571 196
207 3300005615 Ga0070702_100143575 Ga0070702_1001435752 196
208 3300005618 Ga0068864_100288990 Ga0068864_1002889902 196
209 3300005718 Ga0068866_10405716 Ga0068866_104057162 196
210 3300005841 Ga0068863_100560552 Ga0068863_1005605522 196
211 3300005841 Ga0068863_101092855 Ga0068863_1010928552 196
212 3300005842 Ga0068858_100089967 Ga0068858_1000899672 196
213 3300006237 Ga0097621_100002942 Ga0097621_1000029428 196
214 3300006237 Ga0097621_100169529 Ga0097621_1001695291 196
215 3300006358 Ga0068871_100005057 Ga0068871_1000050574 196
216 3300009098 Ga0105245_10036717 Ga0105245_100367174 196
217 3300009176 Ga0105242_10019497 Ga0105242_100194974 196
218 3300009177 Ga0105248_10053100 Ga0105248_100531004 196
219 3300009177 Ga0105248_10974855 Ga0105248_109748552 196
220 3300009545 Ga0105237_10200491 Ga0105237_102004912 196
221 3300009545 Ga0105237_10292693 Ga0105237_102926933 196
222 3300009553 Ga0105249_10163504 Ga0105249_101635043 196
223 3300009553 Ga0105249_10229856 Ga0105249_102298562 196
224 3300010375 Ga0105239_10039817 Ga0105239_100398172 196
225 3300013296 Ga0157374_10009612 Ga0157374_1000961210 196
226 3300013297 Ga0157378_10001446 Ga0157378_100014466 196
227 3300013306 Ga0163162_10375724 Ga0163162_103757241 196
228 3300013308 Ga0157375_10058244 Ga0157375_100582446 196
229 3300013308 Ga0157375_10240499 Ga0157375_102404992 196
230 3300013308 Ga0157375_10537279 Ga0157375_105372791 196
231 3300014968 Ga0157379_10393568 Ga0157379_103935681 196
232 3300025899 Ga0207642_10212981 Ga0207642_102129811 196
233 3300025927 Ga0207687_10144991 Ga0207687_101449912 196
234 3300025934 Ga0207686_10009371 Ga0207686_100093714 196
235 3300025937 Ga0207669_10215404 Ga0207669_102154042 196
236 3300025941 Ga0207711_10084342 Ga0207711_100843422 196
237 3300025949 Ga0207667_10151991 Ga0207667_101519912 196
238 3300025961 Ga0207712_10149179 Ga0207712_101491792 196
239 3300026023 Ga0207677_10022187 Ga0207677_100221873 196
240 3300026023 Ga0207677_10022240 Ga0207677_100222402 196
241 3300026035 Ga0207703_10107745 Ga0207703_101077452 196
242 3300026089 Ga0207648_10095946 Ga0207648_100959462 196
243 3300026089 Ga0207648_10198181 Ga0207648_101981811 196
244 3300026095 Ga0207676_10184284 Ga0207676_101842842 196
245 3300030760 Ga0265762_1000054 Ga0265762_10000547 196
246 3300039450 Ga0436363_1104128 Ga0436363_1104128_199_801 196
247 3300048905 Ga0496102_0834322 Ga0496102_0834322_76_672 196
248 3300048913 Ga0496110_1124946 Ga0496110_1124946_26_616 196
249 3300048915 Ga0496112_0004735 Ga0496112_0004735_322_912 196
250 3300048915 Ga0496112_0142622 Ga0496112_0142622_549_1142 196
251 3300048917 Ga0496114_0887149 Ga0496114_0887149_133_723 196
252 3300007788 Ga0099795_10184031 Ga0099795_101840312 197
253 3300010159 Ga0099796_10013153 Ga0099796_100131532 197
254 3300014497 Ga0182008_10143790 Ga0182008_101437902 197
255 3300015261 Ga0182006_1045441 Ga0182006_10454412 197
256 3300015262 Ga0182007_10054360 Ga0182007_100543602 197
257 3300022732 Ga0224569_104478 Ga0224569_1044782 197
258 3300024227 Ga0228598_1000500 Ga0228598_10005007 197
259 3300025924 Ga0207694_10000373 Ga0207694_1000037329 197
260 3300005434 Ga0070709_10277867 Ga0070709_102778672 198
261 3300005436 Ga0070713_100126931 Ga0070713_1001269311 198
262 3300005439 Ga0070711_100000088 Ga0070711_1000000881 198
263 3300005547 Ga0070693_100096541 Ga0070693_1000965412 198
264 3300005841 Ga0068863_101147225 Ga0068863_1011472251 198
265 3300006163 Ga0070715_10011542 Ga0070715_100115422 198
266 3300006173 Ga0070716_100012833 Ga0070716_1000128331 198
267 3300006173 Ga0070716_100703760 Ga0070716_1007037601 198
268 3300006175 Ga0070712_100037626 Ga0070712_1000376263 198
269 3300006237 Ga0097621_100198573 Ga0097621_1001985731 198
270 3300009098 Ga0105245_10161933 Ga0105245_101619333 198
271 3300009101 Ga0105247_10258786 Ga0105247_102587861 198
272 3300009174 Ga0105241_10026094 Ga0105241_100260944 198
273 3300009177 Ga0105248_11423632 Ga0105248_114236321 198
274 3300013296 Ga0157374_10800591 Ga0157374_108005911 198
275 3300013297 Ga0157378_10362598 Ga0157378_103625981 198
276 3300013306 Ga0163162_10905856 Ga0163162_109058561 198
277 3300014968 Ga0157379_10010509 Ga0157379_100105094 198
278 3300025898 Ga0207692_10056376 Ga0207692_100563762 198
279 3300025915 Ga0207693_10000917 Ga0207693_1000091712 198
280 3300025916 Ga0207663_10108409 Ga0207663_101084092 198
281 3300025916 Ga0207663_10186270 Ga0207663_101862702 198
282 3300025927 Ga0207687_10122961 Ga0207687_101229612 198
283 3300025939 Ga0207665_10012740 Ga0207665_100127401 198
284 3300025939 Ga0207665_10019479 Ga0207665_100194796 198
285 3300035691 Ga0373931_0079635 Ga0373931_0079635_346_945 198
286 3300048904 Ga0496101_0492645 Ga0496101_0492645_336_935 198
287 3300048905 Ga0496102_0008957 Ga0496102_0008957_3105_3704 198
288 3300048906 Ga0496103_0002761 Ga0496103_0002761_9173_9772 198
289 3300048907 Ga0496104_0016605 Ga0496104_0016605_5738_6337 198
290 3300049581 Ga0501047_0282593 Ga0501047_0282593_179_790 198
291 3300049742 Ga0501080_0146801 Ga0501080_0146801_707_1318 198
292 3300049823 Ga0501044_0000119 Ga0501044_0000119_73545_74156 198
293 3300054114 Ga0501084_0789782 Ga0501084_0789782_179_790 198
294 3300060353 Ga0501082_0080996 Ga0501082_0080996_1458_2069 198
295 3300005445 Ga0070708_100140285 Ga0070708_1001402853 199
296 3300005530 Ga0070679_100081066 Ga0070679_1000810663 199
297 3300005536 Ga0070697_100001000 Ga0070697_1000010003 199
298 3300006028 Ga0070717_10288270 Ga0070717_102882702 199
299 3300006852 Ga0075433_10208223 Ga0075433_102082232 199
300 3300006871 Ga0075434_100029506 Ga0075434_1000295062 199
301 3300006871 Ga0075434_100945974 Ga0075434_1009459741 199
302 3300006914 Ga0075436_100125810 Ga0075436_1001258101 199
303 3300025912 Ga0207707_10002986 Ga0207707_100029868 199
304 3300025921 Ga0207652_10168724 Ga0207652_101687241 199
305 3300046463 Ga0495653_0174966 Ga0495653_0174966_237_839 199
306 3300046472 Ga0495580_0016659 Ga0495580_0016659_1633_2232 199
307 3300046531 Ga0495665_0143922 Ga0495665_0143922_227_829 199
308 3300046543 Ga0495645_0040763 Ga0495645_0040763_1531_2133 199
309 3300046559 Ga0495667_0044371 Ga0495667_0044371_1640_2242 199
310 3300046678 Ga0495599_0024973 Ga0495599_0024973_1469_2071 199
311 3300046689 Ga0495613_0092847 Ga0495613_0092847_602_1204 199
312 3300046690 Ga0495624_0214132 Ga0495624_0214132_118_720 199
313 3300048088 Ga0495602_0166657 Ga0495602_0166657_402_1004 199
314 3300049667 Ga0501230_001699 Ga0501230_001699_249_875 199
315 3300050512 nmdc:mga0n895_57981_c1 nmdc:mga0n895_57981_c1_3065_3664 199
316 3300050512 nmdc:mga0n895_717297_c1 nmdc:mga0n895_717297_c1_271_870 199
317 3300050513 nmdc:mga0rr50_14356_c1 nmdc:mga0rr50_14356_c1_3317_3916 199
318 3300050515 nmdc:mga0a205_29175_c2 nmdc:mga0a205_29175_c2_3371_3970 199
319 3300013297 Ga0157378_10203194 Ga0157378_102031942 200
320 3300048905 Ga0496102_0622053 Ga0496102_0622053_367_978 200
321 3300005445 Ga0070708_100000372 Ga0070708_10000037233 201
322 3300005458 Ga0070681_10282368 Ga0070681_102823682 201
323 3300005467 Ga0070706_100014149 Ga0070706_1000141496 201
324 3300005468 Ga0070707_100032068 Ga0070707_1000320684 201
325 3300005471 Ga0070698_100003025 Ga0070698_10000302516 201
326 3300005518 Ga0070699_100001645 Ga0070699_10000164515 201
327 3300005536 Ga0070697_100001970 Ga0070697_10000197010 201
328 3300006028 Ga0070717_10503490 Ga0070717_105034901 201
329 3300006852 Ga0075433_10061476 Ga0075433_100614762 201
330 3300006871 Ga0075434_100056456 Ga0075434_1000564564 201
331 3300007076 Ga0075435_100303677 Ga0075435_1003036772 201
332 3300009176 Ga0105242_10056543 Ga0105242_100565433 201
333 3300025910 Ga0207684_10000343 Ga0207684_1000034359 201
334 3300025922 Ga0207646_10000566 Ga0207646_1000056625 201
335 3300026089 Ga0207648_10154398 Ga0207648_101543982 201
336 3300050512 nmdc:mga0n895_26612_c1 nmdc:mga0n895_26612_c1_3347_3973 201
337 3300050513 nmdc:mga0rr50_457092_c1 nmdc:mga0rr50_457092_c1_153_779 201
338 3300050515 nmdc:mga0a205_40967_c1 nmdc:mga0a205_40967_c1_511_1137 201
339 3300005355 Ga0070671_100140064 Ga0070671_1001400641 202
340 3300005437 Ga0070710_10161514 Ga0070710_101615141 202
341 3300005545 Ga0070695_100502080 Ga0070695_1005020801 202
342 3300005614 Ga0068856_100261225 Ga0068856_1002612252 202
343 3300005841 Ga0068863_100975050 Ga0068863_1009750501 202
344 3300005843 Ga0068860_101525515 Ga0068860_1015255151 202
345 3300006237 Ga0097621_100003025 Ga0097621_10000302510 202
346 3300009093 Ga0105240_10138512 Ga0105240_101385121 202
347 3300009093 Ga0105240_10139423 Ga0105240_101394234 202
348 3300009098 Ga0105245_10479720 Ga0105245_104797201 202
349 3300009177 Ga0105248_10067707 Ga0105248_100677073 202
350 3300013296 Ga0157374_10547261 Ga0157374_105472612 202
351 3300013296 Ga0157374_10678244 Ga0157374_106782442 202
352 3300013297 Ga0157378_10003132 Ga0157378_100031329 202
353 3300013306 Ga0163162_10072102 Ga0163162_100721022 202
354 3300014325 Ga0163163_10073698 Ga0163163_100736983 202
355 3300014968 Ga0157379_10072146 Ga0157379_100721463 202
356 3300014969 Ga0157376_10015792 Ga0157376_100157922 202
357 3300025912 Ga0207707_10052522 Ga0207707_100525224 202
358 3300025913 Ga0207695_10116775 Ga0207695_101167751 202
359 3300025913 Ga0207695_10354910 Ga0207695_103549102 202
360 3300025915 Ga0207693_10215247 Ga0207693_102152471 202
361 3300025931 Ga0207644_10717888 Ga0207644_107178881 202
362 3300025941 Ga0207711_10236252 Ga0207711_102362522 202
363 3300028379 Ga0268266_10407088 Ga0268266_104070882 202
364 3300028381 Ga0268264_11236497 Ga0268264_112364971 202
365 3300036401 Ga0373937_0189818 Ga0373937_0189818_1121_1729 202
366 3300037068 Ga0373925_0022953 Ga0373925_0022953_2468_3076 202
367 3300046459 Ga0495629_0284187 Ga0495629_0284187_98_706 202
368 3300047317 Ga0495604_0432944 Ga0495604_0432944_225_833 202
369 3300048903 Ga0496100_0169131 Ga0496100_0169131_282_890 202
370 3300048904 Ga0496101_0007762 Ga0496101_0007762_3327_3935 202
371 3300048908 Ga0496105_0062761 Ga0496105_0062761_1519_2127 202
372 3300048910 Ga0496107_0064042 Ga0496107_0064042_18_626 202
373 3300048912 Ga0496109_0377147 Ga0496109_0377147_519_1127 202
374 3300048915 Ga0496112_0521693 Ga0496112_0521693_470_1078 202
375 3300048917 Ga0496114_0040815 Ga0496114_0040815_631_1239 202
376 3300048918 Ga0496115_0000641 Ga0496115_0000641_5182_5790 202
377 3300053077 Ga0495601_0178125 Ga0495601_0178125_486_1094 202
378 3300053085 Ga0495619_0229566 Ga0495619_0229566_626_1234 202
379 3300005289 Ga0065704_10296464 Ga0065704_102964642 203
380 3300001978 JGI24747J21853_1011365 JGI24747J21853_10113652 206
381 3300001991 JGI24743J22301_10000293 JGI24743J22301_100002932 206
382 3300002075 JGI24738J21930_10038615 JGI24738J21930_100386152 206
383 3300002075 JGI24738J21930_10054479 JGI24738J21930_100544792 206
384 3300002155 JGI24033J26618_1006334 JGI24033J26618_10063342 206
385 3300002239 JGI24034J26672_10002026 JGI24034J26672_100020261 206
386 3300005293 Ga0065715_10116360 Ga0065715_101163602 206
387 3300005295 Ga0065707_10014157 Ga0065707_100141572 206
388 3300005327 Ga0070658_10063359 Ga0070658_100633595 206
389 3300005329 Ga0070683_100007493 Ga0070683_1000074934 206
390 3300005330 Ga0070690_100104267 Ga0070690_1001042672 206
391 3300005331 Ga0070670_100033325 Ga0070670_1000333254 206
392 3300005333 Ga0070677_10004665 Ga0070677_100046653 206
393 3300005335 Ga0070666_10313917 Ga0070666_103139171 206
394 3300005337 Ga0070682_100037463 Ga0070682_1000374632 206
395 3300005338 Ga0068868_100011209 Ga0068868_1000112097 206
396 3300005339 Ga0070660_100011061 Ga0070660_1000110613 206
397 3300005340 Ga0070689_100007514 Ga0070689_1000075142 206
398 3300005343 Ga0070687_100006117 Ga0070687_1000061172 206
399 3300005344 Ga0070661_100159243 Ga0070661_1001592431 206
400 3300005347 Ga0070668_100004857 Ga0070668_1000048579 206
401 3300005353 Ga0070669_100002184 Ga0070669_10000218410 206
402 3300005354 Ga0070675_100006210 Ga0070675_1000062109 206
403 3300005356 Ga0070674_100001002 Ga0070674_1000010024 206
404 3300005364 Ga0070673_100063181 Ga0070673_1000631811 206
405 3300005365 Ga0070688_100000618 Ga0070688_10000061811 206
406 3300005366 Ga0070659_100012377 Ga0070659_1000123775 206
407 3300005455 Ga0070663_100215516 Ga0070663_1002155162 206
408 3300005456 Ga0070678_100031605 Ga0070678_1000316053 206
409 3300005457 Ga0070662_100045611 Ga0070662_1000456113 206
410 3300005459 Ga0068867_100068604 Ga0068867_1000686043 206
411 3300005466 Ga0070685_10004460 Ga0070685_100044607 206
412 3300005535 Ga0070684_100001860 Ga0070684_10000186011 206
413 3300005543 Ga0070672_100245973 Ga0070672_1002459732 206
414 3300005547 Ga0070693_100252817 Ga0070693_1002528172 206
415 3300005563 Ga0068855_100022413 Ga0068855_1000224135 206
416 3300005564 Ga0070664_100183003 Ga0070664_1001830032 206
417 3300005577 Ga0068857_100003629 Ga0068857_10000362910 206
418 3300005614 Ga0068856_100012749 Ga0068856_1000127498 206
419 3300005615 Ga0070702_100174134 Ga0070702_1001741342 206
420 3300005616 Ga0068852_100029544 Ga0068852_1000295442 206
421 3300005617 Ga0068859_100627285 Ga0068859_1006272852 206
422 3300005618 Ga0068864_100501834 Ga0068864_1005018342 206
423 3300005718 Ga0068866_10005774 Ga0068866_100057744 206
424 3300005719 Ga0068861_100030010 Ga0068861_1000300103 206
425 3300005834 Ga0068851_10001293 Ga0068851_100012937 206
426 3300005840 Ga0068870_10065757 Ga0068870_100657572 206
427 3300005841 Ga0068863_100212440 Ga0068863_1002124401 206
428 3300005842 Ga0068858_100034480 Ga0068858_1000344804 206
429 3300005843 Ga0068860_100215427 Ga0068860_1002154271 206
430 3300005844 Ga0068862_100139313 Ga0068862_1001393132 206
431 3300006237 Ga0097621_100127536 Ga0097621_1001275361 206
432 3300006358 Ga0068871_100134300 Ga0068871_1001343002 206
433 3300006881 Ga0068865_100014699 Ga0068865_1000146994 206
434 3300006931 Ga0097620_100627238 Ga0097620_1006272382 206
435 3300007076 Ga0075435_100289109 Ga0075435_1002891092 206
436 3300009098 Ga0105245_10011327 Ga0105245_100113274 206
437 3300009101 Ga0105247_10002094 Ga0105247_100020947 206
438 3300009174 Ga0105241_10011865 Ga0105241_100118654 206
439 3300009176 Ga0105242_10017421 Ga0105242_100174213 206
440 3300009553 Ga0105249_10009154 Ga0105249_100091544 206
441 3300010375 Ga0105239_10004244 Ga0105239_100042442 206
442 3300011119 Ga0105246_10006082 Ga0105246_100060825 206
443 3300013100 Ga0157373_10037404 Ga0157373_100374042 206
444 3300013102 Ga0157371_10007472 Ga0157371_100074722 206
445 3300013105 Ga0157369_10008874 Ga0157369_100088747 206
446 3300013297 Ga0157378_10034794 Ga0157378_100347943 206
447 3300013307 Ga0157372_10009715 Ga0157372_100097154 206
448 3300014325 Ga0163163_10001263 Ga0163163_1000126318 206
449 3300014326 Ga0157380_10016601 Ga0157380_100166012 206
450 3300014745 Ga0157377_10000395 Ga0157377_1000039511 206
451 3300014968 Ga0157379_10143664 Ga0157379_101436642 206
452 3300014969 Ga0157376_10589341 Ga0157376_105893411 206
453 3300017792 Ga0163161_10010982 Ga0163161_100109824 206
454 3300025315 Ga0207697_10000518 Ga0207697_1000051810 206
455 3300025899 Ga0207642_10139704 Ga0207642_101397042 206
456 3300025900 Ga0207710_10025813 Ga0207710_100258132 206
457 3300025901 Ga0207688_10025189 Ga0207688_100251893 206
458 3300025903 Ga0207680_10001286 Ga0207680_100012864 206
459 3300025904 Ga0207647_10004047 Ga0207647_100040473 206
460 3300025907 Ga0207645_10000351 Ga0207645_1000035119 206
461 3300025908 Ga0207643_10001192 Ga0207643_100011929 206
462 3300025909 Ga0207705_10270407 Ga0207705_102704071 206
463 3300025918 Ga0207662_10009503 Ga0207662_100095034 206
464 3300025919 Ga0207657_10004756 Ga0207657_1000475611 206
465 3300025920 Ga0207649_10000928 Ga0207649_100009289 206
466 3300025923 Ga0207681_10006380 Ga0207681_100063802 206
467 3300025925 Ga0207650_10000059 Ga0207650_10000059100 206
468 3300025926 Ga0207659_10007240 Ga0207659_100072402 206
469 3300025931 Ga0207644_10002945 Ga0207644_100029451 206
470 3300025932 Ga0207690_10039695 Ga0207690_100396952 206
471 3300025933 Ga0207706_10002202 Ga0207706_100022024 206
472 3300025934 Ga0207686_10153171 Ga0207686_101531712 206
473 3300025936 Ga0207670_10317864 Ga0207670_103178642 206
474 3300025937 Ga0207669_10037058 Ga0207669_100370582 206
475 3300025938 Ga0207704_10003936 Ga0207704_100039364 206
476 3300025940 Ga0207691_10002027 Ga0207691_100020271 206
477 3300025941 Ga0207711_10003820 Ga0207711_100038203 206
478 3300025942 Ga0207689_10464124 Ga0207689_104641241 206
479 3300025944 Ga0207661_10000352 Ga0207661_100003529 206
480 3300025945 Ga0207679_10000039 Ga0207679_1000003943 206
481 3300025961 Ga0207712_10449391 Ga0207712_104493911 206
482 3300025972 Ga0207668_10665411 Ga0207668_106654112 206
483 3300025986 Ga0207658_10003811 Ga0207658_100038116 206
484 3300026023 Ga0207677_10042875 Ga0207677_100428751 206
485 3300026035 Ga0207703_10003512 Ga0207703_100035123 206
486 3300026041 Ga0207639_10020333 Ga0207639_100203331 206
487 3300026067 Ga0207678_10001428 Ga0207678_1000142822 206
488 3300026088 Ga0207641_10000025 Ga0207641_10000025102 206
489 3300026089 Ga0207648_10000420 Ga0207648_1000042021 206
490 3300026095 Ga0207676_10000104 Ga0207676_1000010410 206
491 3300026116 Ga0207674_10000604 Ga0207674_1000060412 206
492 3300026118 Ga0207675_100025053 Ga0207675_1000250532 206
493 3300026121 Ga0207683_10000726 Ga0207683_1000072610 206
494 3300026142 Ga0207698_10129371 Ga0207698_101293712 206
495 3300028379 Ga0268266_10004403 Ga0268266_100044037 206
496 3300028380 Ga0268265_10028564 Ga0268265_100285643 206
497 3300028381 Ga0268264_11206053 Ga0268264_112060532 206
498 3300048903 Ga0496100_0094863 Ga0496100_0094863_54_674 206
499 3300048907 Ga0496104_0316433 Ga0496104_0316433_277_897 206
500 3300048909 Ga0496106_0177283 Ga0496106_0177283_621_1241 206
501 3300048910 Ga0496107_0036181 Ga0496107_0036181_2187_2807 206
502 3300048911 Ga0496108_0000539 Ga0496108_0000539_21170_21790 206
503 3300048912 Ga0496109_0000099 Ga0496109_0000099_70556_71176 206
504 3300048914 Ga0496111_0007248 Ga0496111_0007248_2106_2726 206
505 3300048915 Ga0496112_0000043 Ga0496112_0000043_33037_33657 206
506 3300048916 Ga0496113_0000107 Ga0496113_0000107_10784_11404 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

50

226

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.978 11 188
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9739 12 187
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9616 12 187
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9555 12 199
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9517 11 188
ID Description Score Start End Superfamily
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9809 17 187 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9771 11 190 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9765 11 193 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9509 11 193 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.946 11 190 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A7T9GAR2-F1-model_v4 deleted 1.002 11 193
AF-A0A1F9VRF3-F1-model_v4 DNA-3-methyladenine glycosylase 1 22 195 GO:0006284
GO:0008725
GO:0046872
AF-A0A357VPW6-F1-model_v4 DNA-3-methyladenine glycosylase I 1 36 193 GO:0006284
GO:0008725
GO:0046872
AF-A0A1H1N6L2-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9999 12 194 GO:0006284
GO:0008725
GO:0046872
AF-A0A023BY08-F1-model_v4 DNA-3-methyladenine glycosylase 0.9999 10 193 GO:0006284
GO:0008725
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.14 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map