F456532

General Info

Members Datasets Scaffolds Average Seq Length
506 238 1012 266

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10131757|Ga0207688_101317572
Length 305
Sequence MRTPAPGDMICGMARQDRLRRISQAHDRRRPGRPGRAVAIMMPLWDLHRGDGPLIVNVPHAGTFAPPAIAARLTTAGQAWPDTDWHVEKLYAFARDEGATLLCATHSRYVVDLNRDPSGAALYAGADNTEVCPTRTFANEPIYEEGGAPAQEESVHRIAAYFWPYHDTLAAEIERVRARHGYAVLLDGHSIRSEVPRFFAGRLPDLNLGTADGASCAPALQAQAADVLAGANGLTHVVNGRFKGGWITRRYGRPAEGVHALQLEVGQRCYMDEAPPYPWDAKRATALSDVLRKLVAVLAAWRPPA

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
223 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 2643221734 Bosea sp. Root670 Isolate Unclassified
229 2643221736 Bosea sp. Root483D1 Isolate Unclassified
230 2818991467 Bosea vestrisii 3192 Isolate Unclassified
231 2841760612 Bosea sp. Tri-49 Isolate Nodule
232 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
233 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
234 2844104063 Bosea sp. Tri-39 Isolate Nodule
235 2851182111 Bosea sp. Tri-44 Isolate Nodule
236 2851246043 Bosea sp. Tri-54 Isolate Nodule
237 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
238 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 1.38
Rhizoplane 3.75
Rhizosphere 85.57
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10131757 3300025901 Bacteria 1466
2 JGI25151J46595_10000018 3300003187 Bacteria 238438
3 Ga0055526_1001056 3300003771 Bacteria 20118
4 Ga0055526_1002567 3300003771 Bacteria 12179
5 Ga0055524_1000048 3300003775 Bacteria 149598
6 Ga0055524_1009451 3300003775 Bacteria 3962
7 Ga0065165_1000062 3300005262 Bacteria 178885
8 Ga0070658_10447455 3300005327 Bacteria 1113
9 Ga0070676_10006880 3300005328 Bacteria 6089
10 Ga0070676_10249893 3300005328 Bacteria 1183
11 Ga0070683_100012992 3300005329 Bacteria 7248
12 Ga0070690_100037239 3300005330 Bacteria 3065
13 Ga0070690_100291460 3300005330 Bacteria 1167
14 Ga0070670_100003749 3300005331 Bacteria 12653
15 Ga0070670_100023561 3300005331 Bacteria 5299
16 Ga0070670_100040074 3300005331 Bacteria 4029
17 Ga0070670_100047725 3300005331 Bacteria 3685
18 Ga0070670_100058151 3300005331 Bacteria 3319
19 Ga0070670_100070298 3300005331 Bacteria 3005
20 Ga0070670_100233648 3300005331 Bacteria 1600
21 Ga0070670_100446162 3300005331 Bacteria 1146
22 Ga0070670_100633668 3300005331 Bacteria 958
23 Ga0070677_10007016 3300005333 Bacteria 3748
24 Ga0070677_10010629 3300005333 Bacteria 3152
25 Ga0068869_100000926 3300005334 Bacteria 16926
26 Ga0068869_100030096 3300005334 Bacteria 3808
27 Ga0068869_100035343 3300005334 Bacteria 3541
28 Ga0068869_100161235 3300005334 Bacteria 1746
29 Ga0070666_10005904 3300005335 Bacteria 7520
30 Ga0070666_10008121 3300005335 Bacteria 6500
31 Ga0070666_10216679 3300005335 Bacteria 1349
32 Ga0070680_100145255 3300005336 Bacteria 1990
33 Ga0068868_100003652 3300005338 Bacteria 10741
34 Ga0068868_100010424 3300005338 Bacteria 6729
35 Ga0068868_100127380 3300005338 Bacteria 2081
36 Ga0070660_100000940 3300005339 Bacteria 19449
37 Ga0070660_100035806 3300005339 Bacteria 3757
38 Ga0070660_100194222 3300005339 Bacteria 1645
39 Ga0070689_100012276 3300005340 Bacteria 6165
40 Ga0070689_100061506 3300005340 Bacteria 2921
41 Ga0070687_100002271 3300005343 Bacteria 7135
42 Ga0070661_100002505 3300005344 Bacteria 12584
43 Ga0070661_100015498 3300005344 Bacteria 5379
44 Ga0070661_100206447 3300005344 Bacteria 1502
45 Ga0070692_10180786 3300005345 Bacteria 1222
46 Ga0070668_100000779 3300005347 Bacteria 21987
47 Ga0070668_100005217 3300005347 Bacteria 9636
48 Ga0070668_100009357 3300005347 Bacteria 7268
49 Ga0070668_100016106 3300005347 Bacteria 5594
50 Ga0070668_100038163 3300005347 Bacteria 3670
51 Ga0070668_100046636 3300005347 Bacteria 3329
52 Ga0070668_100104673 3300005347 Bacteria 2246
53 Ga0070669_100000668 3300005353 Bacteria 25208
54 Ga0070669_100005376 3300005353 Bacteria 9242
55 Ga0070669_100075780 3300005353 Bacteria 2496
56 Ga0070669_100127502 3300005353 Bacteria 1949
57 Ga0070669_100608637 3300005353 Bacteria 916
58 Ga0070675_100009190 3300005354 Bacteria 7676
59 Ga0070675_100013475 3300005354 Bacteria 6425
60 Ga0070671_100334255 3300005355 Bacteria 1292
61 Ga0070671_100341903 3300005355 Bacteria 1277
62 Ga0070674_100000737 3300005356 Bacteria 16729
63 Ga0070674_100020370 3300005356 Bacteria 4236
64 Ga0070674_100177338 3300005356 Unclassified 1629
65 Ga0070673_100000729 3300005364 Bacteria 18191
66 Ga0070673_100023220 3300005364 Bacteria 4530
67 Ga0070673_100078160 3300005364 Bacteria 2676
68 Ga0070673_100156232 3300005364 Bacteria 1936
69 Ga0070688_100004856 3300005365 Bacteria 7031
70 Ga0070688_100387721 3300005365 Bacteria 1031
71 Ga0070659_100050635 3300005366 Bacteria 3264
72 Ga0070659_100058232 3300005366 Bacteria 3048
73 Ga0070659_100169717 3300005366 Bacteria 1787
74 Ga0070659_100179956 3300005366 Bacteria 1735
75 Ga0070667_100001232 3300005367 Bacteria 23249
76 Ga0070667_100335688 3300005367 Bacteria 1366
77 Ga0070667_100489845 3300005367 Bacteria 1126
78 Ga0070709_10076017 3300005434 Bacteria 2180
79 Ga0070714_100092767 3300005435 Bacteria 2647
80 Ga0070701_10021305 3300005438 Bacteria 3091
81 Ga0070700_100106860 3300005441 Bacteria 1854
82 Ga0070708_100000538 3300005445 Bacteria 28503
83 Ga0070663_100140704 3300005455 Bacteria 1842
84 Ga0070678_100001539 3300005456 Bacteria 12334
85 Ga0070678_100029519 3300005456 Bacteria 3756
86 Ga0070678_100049763 3300005456 Bacteria 3026
87 Ga0070678_100225656 3300005456 Bacteria 1559
88 Ga0070662_100010358 3300005457 Bacteria 6114
89 Ga0070662_100226831 3300005457 Bacteria 1493
90 Ga0070681_10023269 3300005458 Bacteria 6230
91 Ga0068867_100001858 3300005459 Bacteria 14677
92 Ga0068867_100034757 3300005459 Bacteria 3655
93 Ga0068867_100105399 3300005459 Bacteria 2159
94 Ga0068867_100499268 3300005459 Bacteria 1045
95 Ga0070685_10012098 3300005466 Bacteria 4526
96 Ga0070685_10201482 3300005466 Bacteria 1294
97 Ga0070679_100137945 3300005530 Bacteria 2420
98 Ga0068853_100016729 3300005539 Bacteria 6040
99 Ga0068853_100033649 3300005539 Bacteria 4349
100 Ga0068853_100097982 3300005539 Bacteria 2589
101 Ga0070672_100000287 3300005543 Bacteria 28567
102 Ga0070672_100001456 3300005543 Bacteria 14663
103 Ga0070672_100120768 3300005543 Bacteria 2144
104 Ga0070672_100152639 3300005543 Bacteria 1911
105 Ga0070672_100454706 3300005543 Bacteria 1103
106 Ga0070686_100045474 3300005544 Bacteria 2765
107 Ga0070696_100250046 3300005546 Bacteria 1340
108 Ga0070693_100023562 3300005547 Bacteria 3292
109 Ga0070693_100077306 3300005547 Bacteria 1975
110 Ga0070665_100012851 3300005548 Bacteria 8429
111 Ga0070665_100090878 3300005548 Bacteria 3059
112 Ga0070665_100491048 3300005548 Bacteria 1239
113 Ga0070665_100508358 3300005548 Bacteria 1216
114 Ga0070704_100510893 3300005549 Bacteria 1044
115 Ga0068855_100021114 3300005563 Bacteria 7808
116 Ga0068855_100054928 3300005563 Bacteria 4679
117 Ga0068855_100195862 3300005563 Bacteria 2276
118 Ga0070664_100025762 3300005564 Bacteria 4876
119 Ga0070664_100084880 3300005564 Bacteria 2734
120 Ga0070664_100098008 3300005564 Bacteria 2546
121 Ga0070664_100102003 3300005564 Bacteria 2496
122 Ga0070664_100398613 3300005564 Unclassified 1258
123 Ga0068857_100006994 3300005577 Bacteria 9707
124 Ga0068857_100014442 3300005577 Bacteria 6888
125 Ga0068857_100070471 3300005577 Bacteria 3114
126 Ga0068857_100165704 3300005577 Bacteria 2007
127 Ga0068854_100018173 3300005578 Bacteria 4716
128 Ga0068854_100030709 3300005578 Bacteria 3729
129 Ga0068854_100054950 3300005578 Bacteria 2866
130 Ga0068854_100074011 3300005578 Bacteria 2498
131 Ga0068856_100003384 3300005614 Bacteria 16150
132 Ga0068856_100164595 3300005614 Bacteria 2229
133 Ga0070702_100055611 3300005615 Bacteria 2282
134 Ga0068852_100001607 3300005616 Bacteria 15383
135 Ga0068852_100001757 3300005616 Bacteria 14754
136 Ga0068852_100007039 3300005616 Bacteria 8191
137 Ga0068852_100049718 3300005616 Bacteria 3588
138 Ga0068852_100741480 3300005616 Bacteria 994
139 Ga0068859_100004806 3300005617 Bacteria 13755
140 Ga0068859_100040552 3300005617 Bacteria 4673
141 Ga0068859_100052884 3300005617 Bacteria 4084
142 Ga0068859_100752712 3300005617 Bacteria 1063
143 Ga0068864_100001285 3300005618 Bacteria 20888
144 Ga0068864_100008284 3300005618 Bacteria 8574
145 Ga0068864_100054096 3300005618 Bacteria 3464
146 Ga0068864_100246502 3300005618 Bacteria 1657
147 Ga0068866_10124373 3300005718 Bacteria 1458
148 Ga0068861_100030445 3300005719 Bacteria 3955
149 Ga0068861_100101839 3300005719 Bacteria 2285
150 Ga0068861_100146315 3300005719 Bacteria 1934
151 Ga0068861_100160578 3300005719 Bacteria 1853
152 Ga0068851_10002374 3300005834 Bacteria 8270
153 Ga0068851_10080831 3300005834 Bacteria 1697
154 Ga0068870_10001701 3300005840 Bacteria 8995
155 Ga0068870_10002898 3300005840 Bacteria 7229
156 Ga0068870_10021789 3300005840 Bacteria 3140
157 Ga0068863_100005435 3300005841 Bacteria 12549
158 Ga0068863_100007038 3300005841 Bacteria 11021
159 Ga0068863_100007445 3300005841 Bacteria 10713
160 Ga0068863_100324512 3300005841 Bacteria 1496
161 Ga0068858_100030372 3300005842 Bacteria 5017
162 Ga0068858_100034495 3300005842 Bacteria 4694
163 Ga0068858_100138789 3300005842 Bacteria 2282
164 Ga0068860_100005493 3300005843 Bacteria 12840
165 Ga0068860_100017730 3300005843 Bacteria 6935
166 Ga0068860_100035344 3300005843 Bacteria 4792
167 Ga0068860_100262593 3300005843 Bacteria 1683
168 Ga0068862_100006542 3300005844 Bacteria 9671
169 Ga0068862_100073377 3300005844 Bacteria 2957
170 Ga0068862_100225520 3300005844 Bacteria 1698
171 Ga0075368_10006065 3300006042 Bacteria 4200
172 Ga0075363_100013355 3300006048 Bacteria 3977
173 Ga0070716_100238351 3300006173 Bacteria 1232
174 Ga0075362_10068508 3300006177 Bacteria 1616
175 Ga0075366_10023116 3300006195 Bacteria 3621
176 Ga0097621_100001308 3300006237 Bacteria 17135
177 Ga0097621_100393040 3300006237 Bacteria 1240
178 Ga0075370_10014087 3300006353 Bacteria 4259
179 Ga0068871_100001077 3300006358 Bacteria 18307
180 Ga0068871_100161240 3300006358 Bacteria 1918
181 Ga0068871_100199050 3300006358 Bacteria 1729
182 Ga0068871_100295907 3300006358 Bacteria 1419
183 Ga0075428_100104144 3300006844 Bacteria 3094
184 Ga0075433_10244429 3300006852 Bacteria 1593
185 Ga0068865_100113104 3300006881 Bacteria 2006
186 Ga0097620_100004806 3300006931 Bacteria 13755
187 Ga0097620_100040550 3300006931 Bacteria 4673
188 Ga0097620_100052888 3300006931 Bacteria 4084
189 Ga0097620_100752747 3300006931 Bacteria 1063
190 Ga0105240_10002428 3300009093 Bacteria 29958
191 Ga0105245_10241799 3300009098 Bacteria 1750
192 Ga0105243_10182802 3300009148 Bacteria 1825
193 Ga0105243_10271154 3300009148 Bacteria 1524
194 Ga0105241_10022261 3300009174 Bacteria 4692
195 Ga0105242_10042406 3300009176 Bacteria 3674
196 Ga0105242_10044438 3300009176 Bacteria 3598
197 Ga0105248_10002074 3300009177 Bacteria 22178
198 Ga0105248_10323351 3300009177 Bacteria 1737
199 Ga0105248_10642683 3300009177 Bacteria 1197
200 Ga0105237_10330965 3300009545 Bacteria 1527
201 Ga0105238_10001044 3300009551 Bacteria 28027
202 Ga0105249_10053405 3300009553 Bacteria 3693
203 Ga0105239_10426412 3300010375 Bacteria 1503
204 Ga0105246_10090883 3300011119 Bacteria 2199
205 Ga0105246_10677933 3300011119 Unclassified 901
206 Ga0157370_10015688 3300013104 Bacteria 7695
207 Ga0157369_10014238 3300013105 Bacteria 8986
208 Ga0171462_1009 3300013250 Bacteria 344993
209 Ga0157374_10001312 3300013296 Bacteria 21166
210 Ga0157374_10003097 3300013296 Bacteria 13957
211 Ga0157374_10048388 3300013296 Bacteria 3945
212 Ga0157374_10903612 3300013296 Bacteria 901
213 Ga0157378_10029765 3300013297 Bacteria 4821
214 Ga0157378_10183501 3300013297 Bacteria 1969
215 Ga0157378_10240073 3300013297 Bacteria 1730
216 Ga0163162_10005459 3300013306 Bacteria 12283
217 Ga0163162_10401407 3300013306 Bacteria 1503
218 Ga0157372_10004393 3300013307 Bacteria 15042
219 Ga0157375_10002469 3300013308 Bacteria 16013
220 Ga0157375_10004713 3300013308 Bacteria 11862
221 Ga0157375_10052859 3300013308 Bacteria 3995
222 Ga0157375_10075973 3300013308 Bacteria 3385
223 Ga0157375_10220013 3300013308 Bacteria 2057
224 Ga0157375_10442930 3300013308 Bacteria 1465
225 Ga0163163_10016698 3300014325 Bacteria 6827
226 Ga0163163_10180571 3300014325 Bacteria 2157
227 Ga0157380_10008656 3300014326 Bacteria 7274
228 Ga0157380_10012745 3300014326 Bacteria 6105
229 Ga0157380_10059234 3300014326 Bacteria 3055
230 Ga0157380_10289124 3300014326 Bacteria 1504
231 Ga0157377_10031200 3300014745 Bacteria 2894
232 Ga0157379_10000858 3300014968 Bacteria 24649
233 Ga0157379_10003487 3300014968 Bacteria 13323
234 Ga0157379_10119043 3300014968 Bacteria 2375
235 Ga0157376_10012373 3300014969 Bacteria 6332
236 Ga0157376_10074505 3300014969 Bacteria 2894
237 Ga0157376_10117530 3300014969 Bacteria 2351
238 Ga0163161_10010199 3300017792 Bacteria 6504
239 Ga0163161_10021494 3300017792 Bacteria 4534
240 Ga0163161_10047569 3300017792 Bacteria 3097
241 Ga0213872_10064326 3300021361 Bacteria 1657
242 Ga0209673_1020163 3300025273 Bacteria 2369
243 Ga0209130_1000235 3300025284 Bacteria 71379
244 Ga0209675_1000239 3300025291 Bacteria 54796
245 Ga0209025_1000010 3300025294 Bacteria 986612
246 Ga0209025_1018750 3300025294 Bacteria 3896
247 Ga0209025_1024131 3300025294 Bacteria 3152
248 Ga0209025_1048588 3300025294 Bacteria 1718
249 Ga0209564_1000019 3300025295 Bacteria 573686
250 Ga0209564_1000034 3300025295 Bacteria 444284
251 Ga0209256_1000026 3300025299 Bacteria 432835
252 Ga0209256_1000182 3300025299 Bacteria 122471
253 Ga0207697_10000414 3300025315 Bacteria 24140
254 Ga0207656_10008813 3300025321 Bacteria 3730
255 Ga0207656_10028284 3300025321 Bacteria 2300
256 Ga0207682_10001566 3300025893 Bacteria 10511
257 Ga0207682_10007385 3300025893 Bacteria 4381
258 Ga0207688_10001416 3300025901 Bacteria 12500
259 Ga0207680_10000458 3300025903 Bacteria 19273
260 Ga0207680_10191932 3300025903 Bacteria 1387
261 Ga0207699_10231547 3300025906 Bacteria 1266
262 Ga0207645_10000308 3300025907 Bacteria 41052
263 Ga0207645_10000661 3300025907 Bacteria 28611
264 Ga0207643_10000515 3300025908 Bacteria 24751
265 Ga0207643_10005399 3300025908 Bacteria 6841
266 Ga0207643_10017207 3300025908 Bacteria 3950
267 Ga0207643_10136125 3300025908 Bacteria 1464
268 Ga0207707_10106830 3300025912 Bacteria 2447
269 Ga0207693_10330001 3300025915 Bacteria 1194
270 Ga0207660_10402337 3300025917 Bacteria 1103
271 Ga0207662_10007274 3300025918 Bacteria 6019
272 Ga0207657_10019674 3300025919 Bacteria 6402
273 Ga0207657_10022078 3300025919 Bacteria 5973
274 Ga0207657_10164626 3300025919 Bacteria 1799
275 Ga0207649_10069130 3300025920 Bacteria 2248
276 Ga0207649_10244663 3300025920 Bacteria 1289
277 Ga0207652_10108831 3300025921 Bacteria 2456
278 Ga0207681_10013968 3300025923 Bacteria 4976
279 Ga0207681_10032962 3300025923 Bacteria 3394
280 Ga0207681_10042165 3300025923 Bacteria 3047
281 Ga0207681_10116360 3300025923 Bacteria 1953
282 Ga0207681_10169549 3300025923 Bacteria 1653
283 Ga0207694_10009651 3300025924 Bacteria 7276
284 Ga0207650_10005013 3300025925 Bacteria 9045
285 Ga0207650_10033665 3300025925 Bacteria 3712
286 Ga0207650_10068239 3300025925 Bacteria 2670
287 Ga0207650_10099075 3300025925 Bacteria 2240
288 Ga0207650_10339861 3300025925 Bacteria 1233
289 Ga0207659_10001947 3300025926 Bacteria 12255
290 Ga0207659_10006871 3300025926 Bacteria 6998
291 Ga0207659_10009786 3300025926 Bacteria 5997
292 Ga0207644_10004658 3300025931 Bacteria 8914
293 Ga0207644_10011516 3300025931 Bacteria 5855
294 Ga0207644_10018704 3300025931 Bacteria 4690
295 Ga0207644_10058309 3300025931 Bacteria 2790
296 Ga0207644_10112707 3300025931 Bacteria 2059
297 Ga0207644_10185620 3300025931 Bacteria 1632
298 Ga0207690_10014956 3300025932 Bacteria 4699
299 Ga0207690_10077309 3300025932 Bacteria 2313
300 Ga0207690_10095013 3300025932 Bacteria 2117
301 Ga0207690_10307952 3300025932 Bacteria 1241
302 Ga0207706_10003433 3300025933 Bacteria 15131
303 Ga0207706_10049200 3300025933 Bacteria 3726
304 Ga0207686_10023568 3300025934 Bacteria 3557
305 Ga0207709_10107197 3300025935 Bacteria 1860
306 Ga0207670_10023785 3300025936 Bacteria 3819
307 Ga0207670_10049705 3300025936 Bacteria 2806
308 Ga0207670_10231592 3300025936 Bacteria 1419
309 Ga0207669_10010269 3300025937 Bacteria 4501
310 Ga0207669_10021749 3300025937 Bacteria 3393
311 Ga0207669_10026018 3300025937 Bacteria 3174
312 Ga0207669_10083275 3300025937 Bacteria 2057
313 Ga0207704_10007203 3300025938 Bacteria 5238
314 Ga0207704_10040324 3300025938 Bacteria 2728
315 Ga0207665_10238818 3300025939 Bacteria 1338
316 Ga0207691_10000249 3300025940 Bacteria 53276
317 Ga0207691_10001733 3300025940 Bacteria 21505
318 Ga0207691_10023071 3300025940 Bacteria 5861
319 Ga0207691_10259259 3300025940 Bacteria 1499
320 Ga0207691_10428016 3300025940 Bacteria 1127
321 Ga0207711_10015621 3300025941 Bacteria 6298
322 Ga0207711_10328908 3300025941 Bacteria 1413
323 Ga0207689_10002125 3300025942 Bacteria 18643
324 Ga0207689_10003129 3300025942 Bacteria 15185
325 Ga0207689_10006079 3300025942 Bacteria 10675
326 Ga0207689_10077369 3300025942 Bacteria 2735
327 Ga0207689_10269273 3300025942 Bacteria 1410
328 Ga0207661_10319838 3300025944 Bacteria 1395
329 Ga0207661_10514393 3300025944 Bacteria 1094
330 Ga0207679_10033811 3300025945 Bacteria 3601
331 Ga0207679_10054877 3300025945 Bacteria 2935
332 Ga0207679_10134935 3300025945 Bacteria 1986
333 Ga0207679_10306697 3300025945 Bacteria 1370
334 Ga0207679_10479547 3300025945 Unclassified 1107
335 Ga0207667_10005138 3300025949 Bacteria 15985
336 Ga0207667_10049514 3300025949 Bacteria 4437
337 Ga0207667_10160958 3300025949 Bacteria 2309
338 Ga0207651_10006581 3300025960 Bacteria 6103
339 Ga0207651_10073054 3300025960 Bacteria 2437
340 Ga0207651_10114070 3300025960 Bacteria 2035
341 Ga0207651_10129294 3300025960 Bacteria 1930
342 Ga0207651_10151536 3300025960 Bacteria 1805
343 Ga0207712_10209738 3300025961 Bacteria 1550
344 Ga0207668_10002554 3300025972 Bacteria 10635
345 Ga0207668_10005847 3300025972 Bacteria 7243
346 Ga0207668_10013549 3300025972 Bacteria 5026
347 Ga0207668_10035407 3300025972 Bacteria 3323
348 Ga0207668_10085662 3300025972 Bacteria 2300
349 Ga0207668_10134559 3300025972 Bacteria 1892
350 Ga0207668_10275826 3300025972 Bacteria 1376
351 Ga0207668_10288337 3300025972 Bacteria 1349
352 Ga0207640_10050889 3300025981 Bacteria 2690
353 Ga0207658_10001272 3300025986 Bacteria 19944
354 Ga0207658_10022052 3300025986 Bacteria 4429
355 Ga0207658_10087701 3300025986 Bacteria 2403
356 Ga0207658_10096788 3300025986 Bacteria 2303
357 Ga0207658_10198865 3300025986 Unclassified 1672
358 Ga0207658_10262189 3300025986 Bacteria 1473
359 Ga0207677_10001441 3300026023 Bacteria 12630
360 Ga0207677_10007009 3300026023 Bacteria 6201
361 Ga0207677_10127016 3300026023 Bacteria 1929
362 Ga0207703_10007973 3300026035 Bacteria 8370
363 Ga0207703_10011900 3300026035 Bacteria 6776
364 Ga0207703_10465575 3300026035 Bacteria 1183
365 Ga0207639_10038520 3300026041 Bacteria 3556
366 Ga0207639_10238296 3300026041 Bacteria 1580
367 Ga0207678_10013575 3300026067 Bacteria 7152
368 Ga0207678_10106194 3300026067 Bacteria 2396
369 Ga0207678_10144812 3300026067 Bacteria 2028
370 Ga0207708_10173582 3300026075 Bacteria 1708
371 Ga0207708_10429752 3300026075 Bacteria 1097
372 Ga0207702_10009250 3300026078 Bacteria 8280
373 Ga0207641_10000374 3300026088 Bacteria 53088
374 Ga0207641_10012062 3300026088 Bacteria 7089
375 Ga0207641_10026060 3300026088 Bacteria 4824
376 Ga0207641_10028677 3300026088 Bacteria 4601
377 Ga0207641_10076588 3300026088 Bacteria 2892
378 Ga0207641_10140897 3300026088 Bacteria 2175
379 Ga0207641_10223185 3300026088 Bacteria 1748
380 Ga0207641_10232145 3300026088 Bacteria 1715
381 Ga0207641_10297679 3300026088 Bacteria 1523
382 Ga0207648_10000523 3300026089 Bacteria 42961
383 Ga0207648_10002934 3300026089 Bacteria 18047
384 Ga0207648_10029738 3300026089 Bacteria 4844
385 Ga0207648_10038007 3300026089 Bacteria 4237
386 Ga0207648_10093524 3300026089 Bacteria 2629
387 Ga0207648_10098829 3300026089 Bacteria 2555
388 Ga0207676_10012004 3300026095 Bacteria 6199
389 Ga0207676_10017764 3300026095 Bacteria 5161
390 Ga0207676_10055793 3300026095 Bacteria 3103
391 Ga0207676_10296358 3300026095 Unclassified 1475
392 Ga0207674_10000118 3300026116 Bacteria 92408
393 Ga0207674_10004098 3300026116 Bacteria 17651
394 Ga0207674_10036123 3300026116 Bacteria 5152
395 Ga0207674_10103685 3300026116 Bacteria 2823
396 Ga0207675_100000635 3300026118 Bacteria 34445
397 Ga0207675_100002219 3300026118 Bacteria 19296
398 Ga0207675_100027244 3300026118 Bacteria 5323
399 Ga0207675_100215225 3300026118 Bacteria 1849
400 Ga0207675_100342860 3300026118 Bacteria 1463
401 Ga0207675_100370411 3300026118 Bacteria 1407
402 Ga0207675_100500280 3300026118 Bacteria 1210
403 Ga0207683_10000476 3300026121 Bacteria 37318
404 Ga0207683_10000672 3300026121 Bacteria 31425
405 Ga0207683_10002112 3300026121 Bacteria 17478
406 Ga0207683_10025522 3300026121 Bacteria 5099
407 Ga0207683_10325189 3300026121 Bacteria 1409
408 Ga0207698_10412923 3300026142 Bacteria 1293
409 Ga0207698_10415004 3300026142 Bacteria 1290
410 Ga0207698_10516654 3300026142 Bacteria 1165
411 Ga0209971_1034506 3300027682 Bacteria 1216
412 Ga0209813_10002939 3300027866 Bacteria 3945
413 Ga0209974_10031769 3300027876 Bacteria 1749
414 Ga0268266_10005562 3300028379 Bacteria 11729
415 Ga0268266_10122479 3300028379 Bacteria 2316
416 Ga0268266_10334000 3300028379 Bacteria 1421
417 Ga0268265_10006395 3300028380 Bacteria 7985
418 Ga0268265_10007463 3300028380 Bacteria 7384
419 Ga0268265_10206294 3300028380 Bacteria 1709
420 Ga0268265_10247883 3300028380 Bacteria 1576
421 Ga0268265_10550497 3300028380 Bacteria 1095
422 Ga0268264_10002850 3300028381 Bacteria 15079
423 Ga0268264_10035616 3300028381 Bacteria 4097
424 Ga0268264_10599710 3300028381 Bacteria 1085
425 Ga0265330_10029055 3300031235 Bacteria 2488
426 Ga0265325_10001765 3300031241 Bacteria 14982
427 Ga0265339_10011970 3300031249 Bacteria 5316
428 Ga0265316_10050931 3300031344 Bacteria 3255
429 Ga0265314_10065716 3300031711 Bacteria 2449
430 Ga0307405_10003090 3300031731 Bacteria 7556
431 Ga0307413_10023009 3300031824 Bacteria 3370
432 Ga0307410_10025239 3300031852 Bacteria 3725
433 Ga0307406_10006314 3300031901 Bacteria 6536
434 Ga0307406_10365151 3300031901 Bacteria 1133
435 Ga0307407_10050317 3300031903 Bacteria 2383
436 Ga0307412_10005056 3300031911 Bacteria 7373
437 Ga0307409_100000504 3300031995 Bacteria 16863
438 Ga0307416_100034762 3300032002 Bacteria 3840
439 Ga0307416_100309559 3300032002 Bacteria 1575
440 Ga0307411_10008803 3300032005 Bacteria 5254
441 Ga0307507_10042998 3300033179 Bacteria 4491
442 Ga0373939_0111890 3300035114 Bacteria 952
443 Ga0373955_0344122 3300035172 Bacteria 902
444 Ga0373924_0001169 3300035410 Bacteria 8430
445 Ga0373933_0052689 3300035724 Bacteria 2436
446 Ga0373933_0124889 3300035724 Bacteria 1614
447 Ga0373947_0109402 3300035725 Bacteria 1745
448 Ga0373947_0398981 3300035725 Bacteria 927
449 Ga0495606_0008981 3300046507 Bacteria 8549
450 Ga0495643_0079168 3300046522 Bacteria 1714
451 Ga0495686_0001810 3300047472 Bacteria 21581
452 Ga0496100_0455593 3300048903 Bacteria 981
453 Ga0496101_0005009 3300048904 Bacteria 8416
454 Ga0496101_0075703 3300048904 Bacteria 2478
455 Ga0496102_0034110 3300048905 Bacteria 4577
456 Ga0496102_0190732 3300048905 Bacteria 1931
457 Ga0496103_0201467 3300048906 Bacteria 1280
458 Ga0496104_0021708 3300048907 Bacteria 5897
459 Ga0496104_0398410 3300048907 Bacteria 1289
460 Ga0496105_0007050 3300048908 Bacteria 8663
461 Ga0496106_0011048 3300048909 Bacteria 6675
462 Ga0496107_0034684 3300048910 Bacteria 3615
463 Ga0496108_0004760 3300048911 Bacteria 10940
464 Ga0496108_0420528 3300048911 Bacteria 1167
465 Ga0496109_0046869 3300048912 Bacteria 3927
466 Ga0496109_0135071 3300048912 Bacteria 2304
467 Ga0496110_0007678 3300048913 Bacteria 8630
468 Ga0496113_0244567 3300048916 Bacteria 1432
469 Ga0496114_0014725 3300048917 Bacteria 6285
470 Ga0496114_0589351 3300048917 Bacteria 981
471 Ga0496117_0056498 3300048920 Bacteria 2733
472 Ga0496122_0055794 3300048925 Bacteria 2952
473 Ga0496123_0019134 3300048926 Bacteria 5406
474 Ga0496125_0059253 3300048928 Bacteria 3087
475 Ga0496126_0000823 3300048929 Bacteria 55212
476 Ga0501034_0340463 3300049571 Bacteria 1430
477 Ga0501037_0227244 3300049573 Bacteria 1311
478 Ga0501070_0115702 3300049586 Bacteria 2215
479 Ga0501071_0166408 3300049587 Bacteria 1650
480 Ga0501044_0024730 3300049823 Bacteria 6371
481 nmdc:mga03683_15428_c1 3300050489 Bacteria 2851
482 nmdc:mga03n38_976_c1 3300050490 Bacteria 7782
483 nmdc:mga00v17_31433_c1 3300050491 Bacteria 3131
484 nmdc:mga0yw44_63939_c1 3300050492 Bacteria 2264
485 nmdc:mga0k408_27226_c1 3300050493 Bacteria 3246
486 nmdc:mga06z11_2506_c1 3300050494 Bacteria 7025
487 nmdc:mga04h51_7355_c1 3300050495 Bacteria 2902
488 nmdc:mga07m45_1279_c2 3300050496 Bacteria 4652
489 nmdc:mga0sz30_11294_c1 3300050516 Bacteria 2994
490 Ga0500578_0168392 3300053086 Bacteria 1356
491 Ga0500588_0000211 3300053146 Bacteria 8154
492 Ga0500616_0028018 3300053153 Bacteria 3108
493 Ga0500622_0041856 3300053156 Bacteria 2382
494 Ga0500636_0019135 3300053177 Bacteria 4052
495 Ga0500645_011546 3300053730 Bacteria 2881
496 2644733871 2643221734 Bacteria 5365412
497 2644742387 2643221736 Bacteria 6608466
498 2819716841 2818991467 Bacteria 5893227
499 2841763812 2841760612 Bacteria 6454112
500 2841916889 2841911363 Bacteria 6173697
501 2841917607 2841917233 Bacteria 6173500
502 2844109284 2844104063 Bacteria 6440972
503 2851183065 2851182111 Bacteria 6047226
504 2851251391 2851246043 Bacteria 6439203
505 2917701645 2917699015 Bacteria 7043791
506 8057534263 8057529695 Bacteria 6306553
507 Ga0207688_10131757
508 JGI25151J46595_10000018
509 Ga0055526_1001056
510 Ga0055526_1002567
511 Ga0055524_1000048
512 Ga0055524_1009451
513 Ga0065165_1000062
514 Ga0070658_10447455
515 Ga0070676_10006880
516 Ga0070676_10249893
517 Ga0070683_100012992
518 Ga0070690_100037239
519 Ga0070690_100291460
520 Ga0070670_100003749
521 Ga0070670_100023561
522 Ga0070670_100040074
523 Ga0070670_100047725
524 Ga0070670_100058151
525 Ga0070670_100070298
526 Ga0070670_100233648
527 Ga0070670_100446162
528 Ga0070670_100633668
529 Ga0070677_10007016
530 Ga0070677_10010629
531 Ga0068869_100000926
532 Ga0068869_100030096
533 Ga0068869_100035343
534 Ga0068869_100161235
535 Ga0070666_10005904
536 Ga0070666_10008121
537 Ga0070666_10216679
538 Ga0070680_100145255
539 Ga0068868_100003652
540 Ga0068868_100010424
541 Ga0068868_100127380
542 Ga0070660_100000940
543 Ga0070660_100035806
544 Ga0070660_100194222
545 Ga0070689_100012276
546 Ga0070689_100061506
547 Ga0070687_100002271
548 Ga0070661_100002505
549 Ga0070661_100015498
550 Ga0070661_100206447
551 Ga0070692_10180786
552 Ga0070668_100000779
553 Ga0070668_100005217
554 Ga0070668_100009357
555 Ga0070668_100016106
556 Ga0070668_100038163
557 Ga0070668_100046636
558 Ga0070668_100104673
559 Ga0070669_100000668
560 Ga0070669_100005376
561 Ga0070669_100075780
562 Ga0070669_100127502
563 Ga0070669_100608637
564 Ga0070675_100009190
565 Ga0070675_100013475
566 Ga0070671_100334255
567 Ga0070671_100341903
568 Ga0070674_100000737
569 Ga0070674_100020370
570 Ga0070674_100177338
571 Ga0070673_100000729
572 Ga0070673_100023220
573 Ga0070673_100078160
574 Ga0070673_100156232
575 Ga0070688_100004856
576 Ga0070688_100387721
577 Ga0070659_100050635
578 Ga0070659_100058232
579 Ga0070659_100169717
580 Ga0070659_100179956
581 Ga0070667_100001232
582 Ga0070667_100335688
583 Ga0070667_100489845
584 Ga0070709_10076017
585 Ga0070714_100092767
586 Ga0070701_10021305
587 Ga0070700_100106860
588 Ga0070708_100000538
589 Ga0070663_100140704
590 Ga0070678_100001539
591 Ga0070678_100029519
592 Ga0070678_100049763
593 Ga0070678_100225656
594 Ga0070662_100010358
595 Ga0070662_100226831
596 Ga0070681_10023269
597 Ga0068867_100001858
598 Ga0068867_100034757
599 Ga0068867_100105399
600 Ga0068867_100499268
601 Ga0070685_10012098
602 Ga0070685_10201482
603 Ga0070679_100137945
604 Ga0068853_100016729
605 Ga0068853_100033649
606 Ga0068853_100097982
607 Ga0070672_100000287
608 Ga0070672_100001456
609 Ga0070672_100120768
610 Ga0070672_100152639
611 Ga0070672_100454706
612 Ga0070686_100045474
613 Ga0070696_100250046
614 Ga0070693_100023562
615 Ga0070693_100077306
616 Ga0070665_100012851
617 Ga0070665_100090878
618 Ga0070665_100491048
619 Ga0070665_100508358
620 Ga0070704_100510893
621 Ga0068855_100021114
622 Ga0068855_100054928
623 Ga0068855_100195862
624 Ga0070664_100025762
625 Ga0070664_100084880
626 Ga0070664_100098008
627 Ga0070664_100102003
628 Ga0070664_100398613
629 Ga0068857_100006994
630 Ga0068857_100014442
631 Ga0068857_100070471
632 Ga0068857_100165704
633 Ga0068854_100018173
634 Ga0068854_100030709
635 Ga0068854_100054950
636 Ga0068854_100074011
637 Ga0068856_100003384
638 Ga0068856_100164595
639 Ga0070702_100055611
640 Ga0068852_100001607
641 Ga0068852_100001757
642 Ga0068852_100007039
643 Ga0068852_100049718
644 Ga0068852_100741480
645 Ga0068859_100004806
646 Ga0068859_100040552
647 Ga0068859_100052884
648 Ga0068859_100752712
649 Ga0068864_100001285
650 Ga0068864_100008284
651 Ga0068864_100054096
652 Ga0068864_100246502
653 Ga0068866_10124373
654 Ga0068861_100030445
655 Ga0068861_100101839
656 Ga0068861_100146315
657 Ga0068861_100160578
658 Ga0068851_10002374
659 Ga0068851_10080831
660 Ga0068870_10001701
661 Ga0068870_10002898
662 Ga0068870_10021789
663 Ga0068863_100005435
664 Ga0068863_100007038
665 Ga0068863_100007445
666 Ga0068863_100324512
667 Ga0068858_100030372
668 Ga0068858_100034495
669 Ga0068858_100138789
670 Ga0068860_100005493
671 Ga0068860_100017730
672 Ga0068860_100035344
673 Ga0068860_100262593
674 Ga0068862_100006542
675 Ga0068862_100073377
676 Ga0068862_100225520
677 Ga0075368_10006065
678 Ga0075363_100013355
679 Ga0070716_100238351
680 Ga0075362_10068508
681 Ga0075366_10023116
682 Ga0097621_100001308
683 Ga0097621_100393040
684 Ga0075370_10014087
685 Ga0068871_100001077
686 Ga0068871_100161240
687 Ga0068871_100199050
688 Ga0068871_100295907
689 Ga0075428_100104144
690 Ga0075433_10244429
691 Ga0068865_100113104
692 Ga0097620_100004806
693 Ga0097620_100040550
694 Ga0097620_100052888
695 Ga0097620_100752747
696 Ga0105240_10002428
697 Ga0105245_10241799
698 Ga0105243_10182802
699 Ga0105243_10271154
700 Ga0105241_10022261
701 Ga0105242_10042406
702 Ga0105242_10044438
703 Ga0105248_10002074
704 Ga0105248_10323351
705 Ga0105248_10642683
706 Ga0105237_10330965
707 Ga0105238_10001044
708 Ga0105249_10053405
709 Ga0105239_10426412
710 Ga0105246_10090883
711 Ga0105246_10677933
712 Ga0157370_10015688
713 Ga0157369_10014238
714 Ga0171462_1009
715 Ga0157374_10001312
716 Ga0157374_10003097
717 Ga0157374_10048388
718 Ga0157374_10903612
719 Ga0157378_10029765
720 Ga0157378_10183501
721 Ga0157378_10240073
722 Ga0163162_10005459
723 Ga0163162_10401407
724 Ga0157372_10004393
725 Ga0157375_10002469
726 Ga0157375_10004713
727 Ga0157375_10052859
728 Ga0157375_10075973
729 Ga0157375_10220013
730 Ga0157375_10442930
731 Ga0163163_10016698
732 Ga0163163_10180571
733 Ga0157380_10008656
734 Ga0157380_10012745
735 Ga0157380_10059234
736 Ga0157380_10289124
737 Ga0157377_10031200
738 Ga0157379_10000858
739 Ga0157379_10003487
740 Ga0157379_10119043
741 Ga0157376_10012373
742 Ga0157376_10074505
743 Ga0157376_10117530
744 Ga0163161_10010199
745 Ga0163161_10021494
746 Ga0163161_10047569
747 Ga0213872_10064326
748 Ga0209673_1020163
749 Ga0209130_1000235
750 Ga0209675_1000239
751 Ga0209025_1000010
752 Ga0209025_1018750
753 Ga0209025_1024131
754 Ga0209025_1048588
755 Ga0209564_1000019
756 Ga0209564_1000034
757 Ga0209256_1000026
758 Ga0209256_1000182
759 Ga0207697_10000414
760 Ga0207656_10008813
761 Ga0207656_10028284
762 Ga0207682_10001566
763 Ga0207682_10007385
764 Ga0207688_10001416
765 Ga0207680_10000458
766 Ga0207680_10191932
767 Ga0207699_10231547
768 Ga0207645_10000308
769 Ga0207645_10000661
770 Ga0207643_10000515
771 Ga0207643_10005399
772 Ga0207643_10017207
773 Ga0207643_10136125
774 Ga0207707_10106830
775 Ga0207693_10330001
776 Ga0207660_10402337
777 Ga0207662_10007274
778 Ga0207657_10019674
779 Ga0207657_10022078
780 Ga0207657_10164626
781 Ga0207649_10069130
782 Ga0207649_10244663
783 Ga0207652_10108831
784 Ga0207681_10013968
785 Ga0207681_10032962
786 Ga0207681_10042165
787 Ga0207681_10116360
788 Ga0207681_10169549
789 Ga0207694_10009651
790 Ga0207650_10005013
791 Ga0207650_10033665
792 Ga0207650_10068239
793 Ga0207650_10099075
794 Ga0207650_10339861
795 Ga0207659_10001947
796 Ga0207659_10006871
797 Ga0207659_10009786
798 Ga0207644_10004658
799 Ga0207644_10011516
800 Ga0207644_10018704
801 Ga0207644_10058309
802 Ga0207644_10112707
803 Ga0207644_10185620
804 Ga0207690_10014956
805 Ga0207690_10077309
806 Ga0207690_10095013
807 Ga0207690_10307952
808 Ga0207706_10003433
809 Ga0207706_10049200
810 Ga0207686_10023568
811 Ga0207709_10107197
812 Ga0207670_10023785
813 Ga0207670_10049705
814 Ga0207670_10231592
815 Ga0207669_10010269
816 Ga0207669_10021749
817 Ga0207669_10026018
818 Ga0207669_10083275
819 Ga0207704_10007203
820 Ga0207704_10040324
821 Ga0207665_10238818
822 Ga0207691_10000249
823 Ga0207691_10001733
824 Ga0207691_10023071
825 Ga0207691_10259259
826 Ga0207691_10428016
827 Ga0207711_10015621
828 Ga0207711_10328908
829 Ga0207689_10002125
830 Ga0207689_10003129
831 Ga0207689_10006079
832 Ga0207689_10077369
833 Ga0207689_10269273
834 Ga0207661_10319838
835 Ga0207661_10514393
836 Ga0207679_10033811
837 Ga0207679_10054877
838 Ga0207679_10134935
839 Ga0207679_10306697
840 Ga0207679_10479547
841 Ga0207667_10005138
842 Ga0207667_10049514
843 Ga0207667_10160958
844 Ga0207651_10006581
845 Ga0207651_10073054
846 Ga0207651_10114070
847 Ga0207651_10129294
848 Ga0207651_10151536
849 Ga0207712_10209738
850 Ga0207668_10002554
851 Ga0207668_10005847
852 Ga0207668_10013549
853 Ga0207668_10035407
854 Ga0207668_10085662
855 Ga0207668_10134559
856 Ga0207668_10275826
857 Ga0207668_10288337
858 Ga0207640_10050889
859 Ga0207658_10001272
860 Ga0207658_10022052
861 Ga0207658_10087701
862 Ga0207658_10096788
863 Ga0207658_10198865
864 Ga0207658_10262189
865 Ga0207677_10001441
866 Ga0207677_10007009
867 Ga0207677_10127016
868 Ga0207703_10007973
869 Ga0207703_10011900
870 Ga0207703_10465575
871 Ga0207639_10038520
872 Ga0207639_10238296
873 Ga0207678_10013575
874 Ga0207678_10106194
875 Ga0207678_10144812
876 Ga0207708_10173582
877 Ga0207708_10429752
878 Ga0207702_10009250
879 Ga0207641_10000374
880 Ga0207641_10012062
881 Ga0207641_10026060
882 Ga0207641_10028677
883 Ga0207641_10076588
884 Ga0207641_10140897
885 Ga0207641_10223185
886 Ga0207641_10232145
887 Ga0207641_10297679
888 Ga0207648_10000523
889 Ga0207648_10002934
890 Ga0207648_10029738
891 Ga0207648_10038007
892 Ga0207648_10093524
893 Ga0207648_10098829
894 Ga0207676_10012004
895 Ga0207676_10017764
896 Ga0207676_10055793
897 Ga0207676_10296358
898 Ga0207674_10000118
899 Ga0207674_10004098
900 Ga0207674_10036123
901 Ga0207674_10103685
902 Ga0207675_100000635
903 Ga0207675_100002219
904 Ga0207675_100027244
905 Ga0207675_100215225
906 Ga0207675_100342860
907 Ga0207675_100370411
908 Ga0207675_100500280
909 Ga0207683_10000476
910 Ga0207683_10000672
911 Ga0207683_10002112
912 Ga0207683_10025522
913 Ga0207683_10325189
914 Ga0207698_10412923
915 Ga0207698_10415004
916 Ga0207698_10516654
917 Ga0209971_1034506
918 Ga0209813_10002939
919 Ga0209974_10031769
920 Ga0268266_10005562
921 Ga0268266_10122479
922 Ga0268266_10334000
923 Ga0268265_10006395
924 Ga0268265_10007463
925 Ga0268265_10206294
926 Ga0268265_10247883
927 Ga0268265_10550497
928 Ga0268264_10002850
929 Ga0268264_10035616
930 Ga0268264_10599710
931 Ga0265330_10029055
932 Ga0265325_10001765
933 Ga0265339_10011970
934 Ga0265316_10050931
935 Ga0265314_10065716
936 Ga0307405_10003090
937 Ga0307413_10023009
938 Ga0307410_10025239
939 Ga0307406_10006314
940 Ga0307406_10365151
941 Ga0307407_10050317
942 Ga0307412_10005056
943 Ga0307409_100000504
944 Ga0307416_100034762
945 Ga0307416_100309559
946 Ga0307411_10008803
947 Ga0307507_10042998
948 Ga0373939_0111890
949 Ga0373955_0344122
950 Ga0373924_0001169
951 Ga0373933_0052689
952 Ga0373933_0124889
953 Ga0373947_0109402
954 Ga0373947_0398981
955 Ga0495606_0008981
956 Ga0495643_0079168
957 Ga0495686_0001810
958 Ga0496100_0455593
959 Ga0496101_0005009
960 Ga0496101_0075703
961 Ga0496102_0034110
962 Ga0496102_0190732
963 Ga0496103_0201467
964 Ga0496104_0021708
965 Ga0496104_0398410
966 Ga0496105_0007050
967 Ga0496106_0011048
968 Ga0496107_0034684
969 Ga0496108_0004760
970 Ga0496108_0420528
971 Ga0496109_0046869
972 Ga0496109_0135071
973 Ga0496110_0007678
974 Ga0496113_0244567
975 Ga0496114_0014725
976 Ga0496114_0589351
977 Ga0496117_0056498
978 Ga0496122_0055794
979 Ga0496123_0019134
980 Ga0496125_0059253
981 Ga0496126_0000823
982 Ga0501034_0340463
983 Ga0501037_0227244
984 Ga0501070_0115702
985 Ga0501071_0166408
986 Ga0501044_0024730
987 nmdc:mga03683_15428_c1
988 nmdc:mga03n38_976_c1
989 nmdc:mga00v17_31433_c1
990 nmdc:mga0yw44_63939_c1
991 nmdc:mga0k408_27226_c1
992 nmdc:mga06z11_2506_c1
993 nmdc:mga04h51_7355_c1
994 nmdc:mga07m45_1279_c2
995 nmdc:mga0sz30_11294_c1
996 Ga0500578_0168392
997 Ga0500588_0000211
998 Ga0500616_0028018
999 Ga0500622_0041856
1000 Ga0500636_0019135
1001 Ga0500645_011546
1002 2644733871
1003 2644742387
1004 2819716841
1005 2841763812
1006 2841916889
1007 2841917607
1008 2844109284
1009 2851183065
1010 2851251391
1011 2917701645
1012 8057534263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05013

FGase

N-formylglutamate amidohydrolase

52

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.8009 2 259
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7996 5 267
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7928 5 267
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7804 5 267
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7739 5 267
ID Description Score Start End Superfamily
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7991 6 259 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.795 5 267 3.40.630.40
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7839 6 259 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7787 5 267 3.40.630.40
af_A0A0P0X7D0_1_126_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.6936 123 149 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A522RW12-F1-model_v4 N-formylglutamate deformylase (EC 3.5.1.68) 0.9834 5 224 GO:0050129
AF-A0A2G2LJ21-F1-model_v4 N-formylglutamate deformylase 0.9833 5 267
AF-A0A1G3F373-F1-model_v4 N-formylglutamate deformylase 0.9833 4 228
AF-A0A4P5U8R3-F1-model_v4 N-formylglutamate deformylase 0.9825 5 264
AF-A0A656QRC5-F1-model_v4 N-formylglutamate amidohydrolase 0.9821 124 268 GO:0016787

Map