F456535

General Info

Members Datasets Scaffolds Average Seq Length
506 213 1012 284

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10171148|Ga0207654_101711481
Length 321
Sequence MQPMAMPPQPWPTGEVEELEPLVRRILAPNGSPFTYTGTQTYLVGNSEGLAVIDPGPADPAHIDALIRAIGAAPVLAIACTHTHRDHSPAAAPLARRTRAPIVGCAPLVLETGEPRADAPFDKDYAPDRVLEDGGQLRGPSWTLTAVATPGHTSNHVCFALDQAGALFTGDHVMGWSTTVVAPPDGDMADYMASLDKLHSRQDRVYYPAHGPAVHNPHQLVRGMIGHRRQRERQILRLLGQRPQAVHELVPQMYKGVDERLWPAAGQSVKAHLLDLERRGAATAMARSFPAWMLPSAGAIVLKPSATWPPTRSLVSGPVPL

Samples

Sample ID Description Type Environment
1 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
199 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
200 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
207 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
208 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
209 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
210 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
211 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
212 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
213 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 4.15
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207654_10171148 3300025911 Bacteria 1410
2 JGI24736J21556_1002634 3300001904 Bacteria 3147
3 JGI24740J21852_10014679 3300001979 Bacteria 2881
4 JGI24739J22299_10003122 3300001989 Bacteria 6321
5 Ga0055536_1003895 3300003781 Bacteria 7834
6 Ga0055536_1010879 3300003781 Bacteria 3553
7 Ga0070658_10038324 3300005327 Bacteria 3865
8 Ga0070658_10058618 3300005327 Bacteria 3134
9 Ga0070658_10074881 3300005327 Bacteria 2776
10 Ga0070658_10094073 3300005327 Bacteria 2472
11 Ga0070658_10265707 3300005327 Bacteria 1458
12 Ga0070676_10078077 3300005328 Bacteria 2002
13 Ga0070683_100012511 3300005329 Bacteria 7376
14 Ga0070683_100220886 3300005329 Bacteria 1801
15 Ga0070670_100004114 3300005331 Bacteria 12157
16 Ga0070670_100137951 3300005331 Bacteria 2108
17 Ga0070670_100286813 3300005331 Bacteria 1438
18 Ga0070670_100513987 3300005331 Bacteria 1066
19 Ga0070677_10186862 3300005333 Bacteria 991
20 Ga0068869_100110129 3300005334 Bacteria 2094
21 Ga0068869_100204081 3300005334 Bacteria 1560
22 Ga0070666_10103611 3300005335 Bacteria 1963
23 Ga0070666_10119551 3300005335 Bacteria 1826
24 Ga0070666_10125829 3300005335 Bacteria 1779
25 Ga0070680_100045948 3300005336 Bacteria 3551
26 Ga0070660_100006693 3300005339 Bacteria 7997
27 Ga0070660_100014322 3300005339 Bacteria 5712
28 Ga0070660_100033422 3300005339 Bacteria 3877
29 Ga0070660_100037852 3300005339 Bacteria 3658
30 Ga0070660_100248724 3300005339 Bacteria 1449
31 Ga0070660_100255267 3300005339 Bacteria 1430
32 Ga0070660_100435199 3300005339 Bacteria 1087
33 Ga0070661_100000006 3300005344 Bacteria 216544
34 Ga0070661_100005966 3300005344 Bacteria 8385
35 Ga0070661_100008814 3300005344 Bacteria 6982
36 Ga0070661_100017334 3300005344 Bacteria 5109
37 Ga0070661_100040846 3300005344 Bacteria 3385
38 Ga0070661_100081529 3300005344 Bacteria 2389
39 Ga0070661_100228664 3300005344 Bacteria 1429
40 Ga0070692_10025691 3300005345 Bacteria 2905
41 Ga0070668_100113882 3300005347 Bacteria 2155
42 Ga0070669_100078312 3300005353 Bacteria 2457
43 Ga0070669_100106548 3300005353 Bacteria 2122
44 Ga0070675_100002175 3300005354 Bacteria 14519
45 Ga0070671_100004033 3300005355 Bacteria 11576
46 Ga0070671_100066883 3300005355 Bacteria 2995
47 Ga0070671_100121514 3300005355 Bacteria 2198
48 Ga0070674_100108947 3300005356 Bacteria 2030
49 Ga0070674_100406666 3300005356 Bacteria 1113
50 Ga0070673_100002274 3300005364 Bacteria 11647
51 Ga0070673_100004994 3300005364 Bacteria 8459
52 Ga0070659_100024161 3300005366 Bacteria 4657
53 Ga0070659_100044534 3300005366 Bacteria 3475
54 Ga0070659_100065738 3300005366 Bacteria 2872
55 Ga0070659_100113807 3300005366 Bacteria 2186
56 Ga0070667_100022237 3300005367 Bacteria 5261
57 Ga0070667_100047160 3300005367 Bacteria 3625
58 Ga0070714_100166918 3300005435 Bacteria 1995
59 Ga0070663_100002596 3300005455 Bacteria 10214
60 Ga0070663_100084940 3300005455 Bacteria 2334
61 Ga0070663_100099992 3300005455 Bacteria 2163
62 Ga0070663_100203419 3300005455 Bacteria 1546
63 Ga0070663_100260465 3300005455 Bacteria 1375
64 Ga0070663_100434172 3300005455 Bacteria 1079
65 Ga0070678_100060398 3300005456 Bacteria 2790
66 Ga0070662_100005920 3300005457 Bacteria 7843
67 Ga0070662_100008369 3300005457 Bacteria 6742
68 Ga0070662_100012893 3300005457 Bacteria 5554
69 Ga0070662_100013456 3300005457 Bacteria 5445
70 Ga0070662_100022775 3300005457 Bacteria 4293
71 Ga0070662_100028814 3300005457 Bacteria 3868
72 Ga0070662_100031827 3300005457 Bacteria 3705
73 Ga0070662_100049712 3300005457 Bacteria 3024
74 Ga0070681_10042024 3300005458 Bacteria 4582
75 Ga0068867_100010641 3300005459 Bacteria 6491
76 Ga0068867_100026267 3300005459 Bacteria 4181
77 Ga0070679_100000001 3300005530 Bacteria 764811
78 Ga0070679_100005339 3300005530 Bacteria 11892
79 Ga0070679_100060253 3300005530 Bacteria 3782
80 Ga0070679_100131576 3300005530 Bacteria 2483
81 Ga0070679_100172801 3300005530 Bacteria 2133
82 Ga0070684_100014690 3300005535 Bacteria 6352
83 Ga0068853_100008230 3300005539 Bacteria 8371
84 Ga0068853_100021515 3300005539 Bacteria 5380
85 Ga0068853_100038515 3300005539 Bacteria 4073
86 Ga0068853_100098991 3300005539 Unclassified 2575
87 Ga0068853_100372913 3300005539 Bacteria 1332
88 Ga0070672_100075793 3300005543 Bacteria 2686
89 Ga0070696_100013187 3300005546 Bacteria 5545
90 Ga0070693_100021224 3300005547 Bacteria 3438
91 Ga0070665_100083075 3300005548 Bacteria 3208
92 Ga0068855_100007295 3300005563 Bacteria 13389
93 Ga0068855_100010123 3300005563 Bacteria 11366
94 Ga0068855_100016889 3300005563 Bacteria 8777
95 Ga0068855_100017657 3300005563 Bacteria 8580
96 Ga0068855_100227273 3300005563 Bacteria 2091
97 Ga0070664_100004519 3300005564 Bacteria 11162
98 Ga0070664_100018365 3300005564 Bacteria 5743
99 Ga0070664_100055390 3300005564 Bacteria 3366
100 Ga0070664_100078152 3300005564 Bacteria 2846
101 Ga0070664_100119855 3300005564 Bacteria 2303
102 Ga0070664_100147219 3300005564 Bacteria 2077
103 Ga0070664_100366111 3300005564 Bacteria 1313
104 Ga0070664_100601343 3300005564 Bacteria 1020
105 Ga0068857_100004600 3300005577 Bacteria 11689
106 Ga0068857_100012714 3300005577 Bacteria 7336
107 Ga0068857_100068474 3300005577 Bacteria 3159
108 Ga0068854_100002493 3300005578 Bacteria 11408
109 Ga0068854_100006333 3300005578 Bacteria 7526
110 Ga0068854_100118179 3300005578 Bacteria 2008
111 Ga0068856_100004328 3300005614 Bacteria 14163
112 Ga0068856_100005719 3300005614 Bacteria 12247
113 Ga0068856_100009109 3300005614 Bacteria 9650
114 Ga0068856_100034389 3300005614 Bacteria 4964
115 Ga0068856_100111185 3300005614 Bacteria 2737
116 Ga0068856_100243604 3300005614 Bacteria 1813
117 Ga0068852_100000358 3300005616 Bacteria 30765
118 Ga0068852_100012993 3300005616 Bacteria 6354
119 Ga0068852_100056390 3300005616 Bacteria 3395
120 Ga0068852_100194878 3300005616 Bacteria 1914
121 Ga0068852_100260373 3300005616 Bacteria 1665
122 Ga0068852_100341545 3300005616 Bacteria 1459
123 Ga0068859_100000855 3300005617 Bacteria 31031
124 Ga0068859_100249470 3300005617 Bacteria 1865
125 Ga0068864_100000366 3300005618 Bacteria 39559
126 Ga0068864_100026183 3300005618 Bacteria 4917
127 Ga0068864_100049023 3300005618 Bacteria 3632
128 Ga0068864_100258085 3300005618 Bacteria 1620
129 Ga0068866_10005046 3300005718 Bacteria 5435
130 Ga0068863_100007295 3300005841 Bacteria 10827
131 Ga0068863_100014764 3300005841 Bacteria 7512
132 Ga0068863_100025653 3300005841 Bacteria 5621
133 Ga0068863_100471829 3300005841 Bacteria 1233
134 Ga0068858_100001635 3300005842 Bacteria 22873
135 Ga0068860_100067144 3300005843 Bacteria 3408
136 Ga0068860_100083159 3300005843 Bacteria 3044
137 Ga0068862_100019573 3300005844 Bacteria 5652
138 Ga0081539_10026481 3300005985 Bacteria 3699
139 Ga0075363_100000585 3300006048 Bacteria 11995
140 Ga0075362_10000026 3300006177 Bacteria 58544
141 Ga0075369_10004939 3300006186 Bacteria 4959
142 Ga0075366_10002584 3300006195 Bacteria 9310
143 Ga0097621_100349942 3300006237 Bacteria 1314
144 Ga0075370_10000033 3300006353 Bacteria 44344
145 Ga0068871_100012133 3300006358 Bacteria 6343
146 Ga0068865_100065486 3300006881 Bacteria 2560
147 Ga0097620_100000855 3300006931 Bacteria 31031
148 Ga0097620_100249471 3300006931 Bacteria 1865
149 Ga0105250_10005314 3300009092 Bacteria 5782
150 Ga0105240_10002881 3300009093 Bacteria 27174
151 Ga0105240_10005161 3300009093 Bacteria 19533
152 Ga0105240_10050229 3300009093 Bacteria 5260
153 Ga0105240_10109794 3300009093 Bacteria 3339
154 Ga0105240_10222556 3300009093 Bacteria 2198
155 Ga0105247_10133291 3300009101 Bacteria 1621
156 Ga0105241_10224662 3300009174 Bacteria 1580
157 Ga0105248_10002687 3300009177 Bacteria 19758
158 Ga0105248_10015535 3300009177 Bacteria 8391
159 Ga0105237_10071839 3300009545 Bacteria 3454
160 Ga0105237_10363370 3300009545 Bacteria 1452
161 Ga0105238_10022690 3300009551 Bacteria 6397
162 Ga0105238_10076021 3300009551 Bacteria 3350
163 Ga0105238_10309196 3300009551 Bacteria 1565
164 Ga0105249_10039926 3300009553 Bacteria 4262
165 Ga0105239_10093614 3300010375 Bacteria 3318
166 Ga0105246_10000759 3300011119 Bacteria 18376
167 Ga0157373_10004720 3300013100 Bacteria 10245
168 Ga0157373_10038289 3300013100 Bacteria 3438
169 Ga0157373_10112457 3300013100 Bacteria 1914
170 Ga0157373_10147109 3300013100 Bacteria 1657
171 Ga0157371_10001091 3300013102 Bacteria 29403
172 Ga0157371_10013982 3300013102 Bacteria 6076
173 Ga0157371_10186706 3300013102 Bacteria 1483
174 Ga0157370_10069312 3300013104 Bacteria 3331
175 Ga0157370_10080769 3300013104 Bacteria 3061
176 Ga0157370_10100138 3300013104 Bacteria 2715
177 Ga0157370_10129241 3300013104 Bacteria 2357
178 Ga0157370_10196309 3300013104 Bacteria 1873
179 Ga0157370_10363486 3300013104 Bacteria 1334
180 Ga0157369_10006444 3300013105 Bacteria 13607
181 Ga0157369_10008287 3300013105 Bacteria 11915
182 Ga0157369_10062724 3300013105 Bacteria 4005
183 Ga0157369_10073644 3300013105 Bacteria 3664
184 Ga0157369_10081960 3300013105 Bacteria 3452
185 Ga0163162_10067628 3300013306 Bacteria 3623
186 Ga0163162_10268933 3300013306 Bacteria 1836
187 Ga0157372_10021721 3300013307 Bacteria 6937
188 Ga0157372_10069390 3300013307 Bacteria 3964
189 Ga0157372_10127121 3300013307 Bacteria 2931
190 Ga0157372_10406520 3300013307 Bacteria 1586
191 Ga0157372_10958902 3300013307 Bacteria 991
192 Ga0157375_10156429 3300013308 Bacteria 2418
193 Ga0157375_10295109 3300013308 Bacteria 1784
194 Ga0163163_10000665 3300014325 Bacteria 29455
195 Ga0163163_10523400 3300014325 Bacteria 1248
196 Ga0157380_10160134 3300014326 Bacteria 1955
197 Ga0182008_10060111 3300014497 Bacteria 1874
198 Ga0157379_10012481 3300014968 Bacteria 7418
199 Ga0157376_10234265 3300014969 Bacteria 1707
200 Ga0163161_10109744 3300017792 Bacteria 2061
201 Ga0213873_10000022 3300021358 Bacteria 103149
202 Ga0213876_10000090 3300021384 Bacteria 103041
203 Ga0209676_1000372 3300025292 Bacteria 83114
204 Ga0209676_1000670 3300025292 Bacteria 48733
205 Ga0209050_1008033 3300025298 Bacteria 5745
206 Ga0209050_1017021 3300025298 Bacteria 2931
207 Ga0209257_1021978 3300025304 Bacteria 2293
208 Ga0207656_10046562 3300025321 Bacteria 1861
209 Ga0207710_10073093 3300025900 Bacteria 1576
210 Ga0207688_10136382 3300025901 Bacteria 1441
211 Ga0207647_10016049 3300025904 Bacteria 5118
212 Ga0207647_10047746 3300025904 Bacteria 2661
213 Ga0207647_10126899 3300025904 Bacteria 1501
214 Ga0207645_10029544 3300025907 Bacteria 3533
215 Ga0207645_10222021 3300025907 Bacteria 1246
216 Ga0207705_10000101 3300025909 Bacteria 98231
217 Ga0207705_10000124 3300025909 Bacteria 85292
218 Ga0207705_10001816 3300025909 Bacteria 16820
219 Ga0207705_10002600 3300025909 Bacteria 13873
220 Ga0207705_10020476 3300025909 Bacteria 4725
221 Ga0207705_10058449 3300025909 Bacteria 2782
222 Ga0207705_10207534 3300025909 Bacteria 1485
223 Ga0207707_10058649 3300025912 Bacteria 3350
224 Ga0207707_10100535 3300025912 Bacteria 2527
225 Ga0207695_10003145 3300025913 Bacteria 23572
226 Ga0207695_10018947 3300025913 Bacteria 7939
227 Ga0207695_10022555 3300025913 Bacteria 7142
228 Ga0207660_10027016 3300025917 Bacteria 3912
229 Ga0207660_10039015 3300025917 Bacteria 3318
230 Ga0207660_10060564 3300025917 Bacteria 2722
231 Ga0207657_10000468 3300025919 Bacteria 42779
232 Ga0207657_10000764 3300025919 Bacteria 34123
233 Ga0207657_10003570 3300025919 Bacteria 16599
234 Ga0207657_10073924 3300025919 Bacteria 2879
235 Ga0207657_10074095 3300025919 Bacteria 2876
236 Ga0207657_10199676 3300025919 Bacteria 1609
237 Ga0207657_10218242 3300025919 Bacteria 1529
238 Ga0207649_10000043 3300025920 Bacteria 115777
239 Ga0207649_10003307 3300025920 Bacteria 8820
240 Ga0207649_10030858 3300025920 Bacteria 3179
241 Ga0207649_10032723 3300025920 Bacteria 3102
242 Ga0207649_10080799 3300025920 Bacteria 2104
243 Ga0207652_10000001 3300025921 Bacteria 1006643
244 Ga0207652_10000002 3300025921 Bacteria 878035
245 Ga0207652_10010715 3300025921 Bacteria 7380
246 Ga0207652_10020515 3300025921 Bacteria 5443
247 Ga0207652_10083901 3300025921 Bacteria 2790
248 Ga0207652_10312402 3300025921 Bacteria 1419
249 Ga0207681_10009916 3300025923 Bacteria 5829
250 Ga0207681_10094939 3300025923 Bacteria 2138
251 Ga0207681_10110060 3300025923 Bacteria 2002
252 Ga0207694_10079974 3300025924 Bacteria 2565
253 Ga0207694_10245917 3300025924 Bacteria 1463
254 Ga0207650_10012679 3300025925 Bacteria 5819
255 Ga0207650_10032733 3300025925 Bacteria 3761
256 Ga0207650_10524334 3300025925 Bacteria 992
257 Ga0207659_10023767 3300025926 Bacteria 4096
258 Ga0207644_10000196 3300025931 Bacteria 43119
259 Ga0207644_10001246 3300025931 Bacteria 16373
260 Ga0207644_10083265 3300025931 Bacteria 2368
261 Ga0207644_10128890 3300025931 Bacteria 1934
262 Ga0207690_10006574 3300025932 Bacteria 6891
263 Ga0207690_10029116 3300025932 Bacteria 3508
264 Ga0207690_10047118 3300025932 Bacteria 2859
265 Ga0207706_10001361 3300025933 Bacteria 24433
266 Ga0207706_10014556 3300025933 Bacteria 7130
267 Ga0207706_10019234 3300025933 Bacteria 6141
268 Ga0207706_10025921 3300025933 Bacteria 5250
269 Ga0207706_10236434 3300025933 Bacteria 1597
270 Ga0207669_10131936 3300025937 Bacteria 1718
271 Ga0207691_10024789 3300025940 Bacteria 5638
272 Ga0207691_10040402 3300025940 Bacteria 4310
273 Ga0207691_10257582 3300025940 Bacteria 1504
274 Ga0207711_10000388 3300025941 Bacteria 46611
275 Ga0207711_10024066 3300025941 Bacteria 5097
276 Ga0207711_10032360 3300025941 Bacteria 4421
277 Ga0207711_10077224 3300025941 Bacteria 2902
278 Ga0207661_10033353 3300025944 Bacteria 3996
279 Ga0207661_10103970 3300025944 Bacteria 2391
280 Ga0207679_10023526 3300025945 Bacteria 4214
281 Ga0207679_10032743 3300025945 Bacteria 3653
282 Ga0207679_10075417 3300025945 Bacteria 2559
283 Ga0207679_10138820 3300025945 Bacteria 1962
284 Ga0207667_10008659 3300025949 Bacteria 12065
285 Ga0207667_10009679 3300025949 Bacteria 11337
286 Ga0207667_10016908 3300025949 Bacteria 8229
287 Ga0207667_10018168 3300025949 Bacteria 7894
288 Ga0207667_10038338 3300025949 Bacteria 5119
289 Ga0207667_10097303 3300025949 Bacteria 3038
290 Ga0207651_10010072 3300025960 Bacteria 5217
291 Ga0207651_10045193 3300025960 Bacteria 2952
292 Ga0207712_10076999 3300025961 Bacteria 2416
293 Ga0207668_10014958 3300025972 Bacteria 4813
294 Ga0207668_10231113 3300025972 Bacteria 1491
295 Ga0207640_10002493 3300025981 Bacteria 9864
296 Ga0207640_10003067 3300025981 Bacteria 9001
297 Ga0207640_10009435 3300025981 Bacteria 5465
298 Ga0207640_10128697 3300025981 Bacteria 1827
299 Ga0207658_10181866 3300025986 Bacteria 1740
300 Ga0207703_10001752 3300026035 Bacteria 19393
301 Ga0207703_10119196 3300026035 Bacteria 2263
302 Ga0207639_10032428 3300026041 Bacteria 3846
303 Ga0207639_10082432 3300026041 Bacteria 2550
304 Ga0207639_10119569 3300026041 Bacteria 2162
305 Ga0207678_10001147 3300026067 Bacteria 24303
306 Ga0207678_10004771 3300026067 Bacteria 12166
307 Ga0207678_10029003 3300026067 Bacteria 4829
308 Ga0207678_10048697 3300026067 Bacteria 3663
309 Ga0207678_10095769 3300026067 Bacteria 2536
310 Ga0207678_10574411 3300026067 Bacteria 987
311 Ga0207702_10004354 3300026078 Bacteria 12627
312 Ga0207702_10004365 3300026078 Bacteria 12607
313 Ga0207702_10012315 3300026078 Bacteria 7118
314 Ga0207702_10012913 3300026078 Bacteria 6947
315 Ga0207702_10049112 3300026078 Bacteria 3560
316 Ga0207702_10192481 3300026078 Bacteria 1885
317 Ga0207702_10564800 3300026078 Bacteria 1114
318 Ga0207641_10000421 3300026088 Bacteria 49462
319 Ga0207641_10088046 3300026088 Bacteria 2710
320 Ga0207641_10364875 3300026088 Bacteria 1380
321 Ga0207648_10008008 3300026089 Bacteria 10302
322 Ga0207648_10010973 3300026089 Bacteria 8559
323 Ga0207676_10008522 3300026095 Bacteria 7293
324 Ga0207676_10012688 3300026095 Bacteria 6045
325 Ga0207674_10000730 3300026116 Bacteria 42917
326 Ga0207674_10007002 3300026116 Bacteria 13181
327 Ga0207674_10012999 3300026116 Bacteria 9278
328 Ga0207674_10069463 3300026116 Bacteria 3543
329 Ga0207674_10080955 3300026116 Bacteria 3250
330 Ga0207674_10098726 3300026116 Bacteria 2903
331 Ga0207683_10001943 3300026121 Bacteria 18297
332 Ga0207683_10020864 3300026121 Bacteria 5606
333 Ga0207698_10000067 3300026142 Bacteria 70181
334 Ga0207698_10057431 3300026142 Bacteria 3011
335 Ga0207698_10158683 3300026142 Bacteria 1975
336 Ga0207698_10180700 3300026142 Bacteria 1869
337 Ga0207698_10348478 3300026142 Bacteria 1398
338 Ga0268266_10021340 3300028379 Bacteria 5517
339 Ga0268266_10026509 3300028379 Bacteria 4932
340 Ga0268265_10000980 3300028380 Bacteria 26001
341 Ga0268264_10000338 3300028381 Bacteria 72206
342 Ga0268264_10155844 3300028381 Bacteria 2052
343 Ga0307408_100026207 3300031548 Bacteria 4001
344 Ga0307408_100099605 3300031548 Bacteria 2212
345 Ga0307405_10013488 3300031731 Bacteria 4361
346 Ga0307405_10094026 3300031731 Bacteria 1993
347 Ga0307413_10121664 3300031824 Bacteria 1769
348 Ga0307413_10239432 3300031824 Bacteria 1339
349 Ga0307410_10015627 3300031852 Bacteria 4508
350 Ga0307410_10049079 3300031852 Bacteria 2831
351 Ga0307410_10222942 3300031852 Bacteria 1451
352 Ga0307407_10001078 3300031903 Bacteria 9484
353 Ga0307407_10031079 3300031903 Bacteria 2888
354 Ga0307412_10090691 3300031911 Bacteria 2137
355 Ga0307409_100127646 3300031995 Bacteria 2167
356 Ga0307409_100174923 3300031995 Unclassified 1893
357 Ga0307409_100447575 3300031995 Bacteria 1246
358 Ga0307416_100004054 3300032002 Bacteria 8753
359 Ga0307416_100718129 3300032002 Bacteria 1090
360 Ga0307416_100813957 3300032002 Bacteria 1030
361 Ga0307414_10000090 3300032004 Bacteria 78448
362 Ga0307414_10017881 3300032004 Bacteria 4349
363 Ga0307414_10072987 3300032004 Bacteria 2481
364 Ga0307414_10104588 3300032004 Bacteria 2139
365 Ga0307415_100003523 3300032126 Bacteria 7982
366 Ga0373928_0011258 3300035084 Bacteria 1768
367 Ga0316582_0148803 3300036647 Bacteria 1582
368 Ga0316584_0047107 3300036712 Bacteria 3220
369 Ga0316584_0322936 3300036712 Bacteria 1113
370 Ga0395899_0022393 3300037312 Bacteria 4791
371 Ga0395899_0036148 3300037312 Bacteria 3706
372 Ga0395899_0040112 3300037312 Bacteria 3502
373 Ga0395899_0060202 3300037312 Bacteria 2797
374 Ga0395899_0179726 3300037312 Bacteria 1486
375 Ga0395900_0002717 3300037418 Bacteria 19339
376 Ga0395900_0003576 3300037418 Bacteria 16706
377 Ga0395900_0078201 3300037418 Bacteria 3399
378 Ga0395900_0080027 3300037418 Bacteria 3358
379 Ga0395900_0111262 3300037418 Bacteria 2813
380 Ga0395900_0138341 3300037418 Bacteria 2494
381 Ga0395900_0235424 3300037418 Bacteria 1839
382 Ga0395900_0239107 3300037418 Bacteria 1822
383 Ga0395900_0433359 3300037418 Bacteria 1273
384 Ga0395898_0004254 3300037466 Bacteria 15703
385 Ga0395898_0006820 3300037466 Bacteria 12144
386 Ga0395898_0029920 3300037466 Bacteria 5451
387 Ga0395898_0097406 3300037466 Bacteria 2825
388 Ga0395898_0123077 3300037466 Bacteria 2485
389 Ga0395898_0344258 3300037466 Bacteria 1422
390 Ga0395905_0000298 3300037471 Bacteria 72500
391 Ga0395905_0009807 3300037471 Bacteria 9333
392 Ga0395905_0010154 3300037471 Bacteria 9177
393 Ga0395905_0020964 3300037471 Bacteria 6188
394 Ga0395905_0030876 3300037471 Bacteria 5046
395 Ga0395905_0042029 3300037471 Bacteria 4289
396 Ga0395905_0044171 3300037471 Bacteria 4182
397 Ga0395905_0052817 3300037471 Bacteria 3804
398 Ga0395905_0113403 3300037471 Bacteria 2547
399 Ga0395905_0155230 3300037471 Bacteria 2153
400 Ga0395905_0251835 3300037471 Bacteria 1650
401 Ga0395905_0463034 3300037471 Bacteria 1166
402 Ga0395901_0000140 3300038443 Bacteria 94487
403 Ga0395901_0053668 3300038443 Bacteria 4188
404 Ga0395901_0054851 3300038443 Bacteria 4143
405 Ga0395901_0093276 3300038443 Bacteria 3152
406 Ga0395901_0110617 3300038443 Bacteria 2884
407 Ga0395901_0113049 3300038443 Unclassified 2851
408 Ga0395901_0119789 3300038443 Bacteria 2765
409 Ga0395901_0120881 3300038443 Bacteria 2752
410 Ga0395901_0143264 3300038443 Bacteria 2512
411 Ga0395901_0686626 3300038443 Bacteria 1023
412 Ga0436365_0863570 3300039437 Bacteria 121422
413 Ga0436362_0592983 3300039453 Bacteria 296966
414 Ga0439448_0020485 3300042005 Bacteria 2046
415 Ga0439462_0000371 3300042015 Bacteria 8593
416 Ga0439458_0000872 3300042157 Bacteria 7816
417 Ga0439464_0000192 3300042439 Bacteria 10769
418 Ga0466966_0000740 3300044684 Bacteria 20741
419 Ga0466966_0002854 3300044684 Bacteria 11375
420 Ga0466966_0108636 3300044684 Bacteria 1711
421 Ga0466966_0301278 3300044684 Bacteria 963
422 Ga0466961_0008230 3300044693 Bacteria 6641
423 Ga0466961_0100482 3300044693 Bacteria 1822
424 Ga0466961_0327026 3300044693 Bacteria 934
425 Ga0466963_0020310 3300044694 Bacteria 4176
426 Ga0466964_0069688 3300044706 Bacteria 1484
427 Ga0466971_0005161 3300044719 Bacteria 5653
428 Ga0466971_0015086 3300044719 Bacteria 3399
429 Ga0466970_0001595 3300044765 Bacteria 10930
430 Ga0466970_0014407 3300044765 Bacteria 4060
431 Ga0466957_0000272 3300044842 Bacteria 25068
432 Ga0466957_0139452 3300044842 Bacteria 1561
433 Ga0466959_0020541 3300045049 Bacteria 4867
434 Ga0466959_0154027 3300045049 Bacteria 1618
435 Ga0466959_0191666 3300045049 Bacteria 1426
436 Ga0466958_0000445 3300045836 Bacteria 17129
437 Ga0466958_0374644 3300045836 Bacteria 917
438 Ga0466967_0013936 3300045976 Bacteria 6237
439 Ga0466967_0127925 3300045976 Bacteria 2355
440 Ga0495638_0052116 3300046460 Bacteria 2550
441 Ga0495606_0077704 3300046507 Bacteria 2072
442 Ga0495598_0079082 3300046537 Bacteria 1051
443 Ga0495668_0000031 3300046616 Bacteria 256576
444 Ga0495668_0034508 3300046616 Bacteria 2837
445 Ga0495625_0000115 3300046660 Bacteria 122861
446 Ga0495625_0172981 3300046660 Bacteria 1441
447 Ga0495669_0006761 3300046684 Bacteria 4799
448 Ga0495669_0014209 3300046684 Bacteria 3404
449 Ga0495669_0044451 3300046684 Bacteria 1979
450 Ga0495670_0244364 3300046691 Bacteria 956
451 Ga0496101_0053191 3300048904 Bacteria 2920
452 Ga0496101_0295441 3300048904 Bacteria 1268
453 Ga0496102_0052301 3300048905 Bacteria 3721
454 Ga0496103_0042468 3300048906 Bacteria 2798
455 Ga0496105_0035740 3300048908 Bacteria 4091
456 Ga0496107_0011270 3300048910 Bacteria 6221
457 Ga0496107_0085804 3300048910 Bacteria 2297
458 Ga0496107_0152772 3300048910 Bacteria 1708
459 Ga0496108_0000396 3300048911 Bacteria 35971
460 Ga0496108_0282570 3300048911 Bacteria 1445
461 Ga0496109_0003559 3300048912 Bacteria 13006
462 Ga0496109_0073124 3300048912 Bacteria 3150
463 Ga0496109_0099904 3300048912 Bacteria 2692
464 Ga0496110_0001619 3300048913 Bacteria 16509
465 Ga0496110_0133980 3300048913 Bacteria 2238
466 Ga0496111_0010118 3300048914 Bacteria 6313
467 Ga0496111_0040494 3300048914 Bacteria 3342
468 Ga0496112_0000609 3300048915 Bacteria 24640
469 Ga0496112_0043246 3300048915 Bacteria 4410
470 Ga0496113_0000746 3300048916 Bacteria 16744
471 Ga0496114_0161072 3300048917 Bacteria 1951
472 Ga0501032_0020076 3300049569 Bacteria 4659
473 Ga0501034_0017265 3300049571 Bacteria 7403
474 Ga0501036_0065400 3300049572 Bacteria 3078
475 Ga0501043_0176818 3300049579 Bacteria 1664
476 Ga0501046_0199371 3300049580 Bacteria 1490
477 Ga0501047_0262061 3300049581 Bacteria 1576
478 Ga0501035_0043957 3300049822 Bacteria 4024
479 Ga0501035_0124658 3300049822 Bacteria 2249
480 Ga0501044_0005346 3300049823 Bacteria 14275
481 Ga0501044_0268908 3300049823 Bacteria 1641
482 nmdc:mga03683_54_c1 3300050489 Bacteria 47475
483 nmdc:mga03n38_13877_c1 3300050490 Bacteria 3073
484 nmdc:mga0k408_30_c1 3300050493 Bacteria 89511
485 nmdc:mga0k408_67745_c1 3300050493 Bacteria 2081
486 nmdc:mga07m45_148420_c1 3300050496 Bacteria 1359
487 nmdc:mga07m45_14_c1 3300050496 Bacteria 154035
488 nmdc:mga0sz30_710_c1 3300050516 Bacteria 12245
489 Ga0495655_0034874 3300053083 Bacteria 1248
490 Ga0500643_000001 3300053087 Bacteria 1440111
491 Ga0500643_011408 3300053087 Bacteria 3243
492 Ga0500592_002140 3300053116 Bacteria 3188
493 Ga0500568_0003393 3300053139 Bacteria 8903
494 Ga0500616_0008736 3300053153 Bacteria 6248
495 Ga0500622_0006895 3300053156 Bacteria 6517
496 Ga0500627_0000003 3300053158 Bacteria 178186
497 Ga0466962_0061821 3300061719 Unclassified 1787
498 Ga0466962_0230753 3300061719 Bacteria 907
499 2643819651 2643221560 Bacteria 4801179
500 2643834024 2643221563 Bacteria 4726935
501 2643948399 2643221588 Bacteria 3692460
502 2644054950 2643221608 Bacteria 4724829
503 2848298851 2848297114 Bacteria 3608511
504 2896186641 2896184354 Bacteria 3258548
505 2896254414 2896253425 Bacteria 3418029
506 3000865383 3000865235 Bacteria 3106258
507 Ga0207654_10171148
508 JGI24736J21556_1002634
509 JGI24740J21852_10014679
510 JGI24739J22299_10003122
511 Ga0055536_1003895
512 Ga0055536_1010879
513 Ga0070658_10038324
514 Ga0070658_10058618
515 Ga0070658_10074881
516 Ga0070658_10094073
517 Ga0070658_10265707
518 Ga0070676_10078077
519 Ga0070683_100012511
520 Ga0070683_100220886
521 Ga0070670_100004114
522 Ga0070670_100137951
523 Ga0070670_100286813
524 Ga0070670_100513987
525 Ga0070677_10186862
526 Ga0068869_100110129
527 Ga0068869_100204081
528 Ga0070666_10103611
529 Ga0070666_10119551
530 Ga0070666_10125829
531 Ga0070680_100045948
532 Ga0070660_100006693
533 Ga0070660_100014322
534 Ga0070660_100033422
535 Ga0070660_100037852
536 Ga0070660_100248724
537 Ga0070660_100255267
538 Ga0070660_100435199
539 Ga0070661_100000006
540 Ga0070661_100005966
541 Ga0070661_100008814
542 Ga0070661_100017334
543 Ga0070661_100040846
544 Ga0070661_100081529
545 Ga0070661_100228664
546 Ga0070692_10025691
547 Ga0070668_100113882
548 Ga0070669_100078312
549 Ga0070669_100106548
550 Ga0070675_100002175
551 Ga0070671_100004033
552 Ga0070671_100066883
553 Ga0070671_100121514
554 Ga0070674_100108947
555 Ga0070674_100406666
556 Ga0070673_100002274
557 Ga0070673_100004994
558 Ga0070659_100024161
559 Ga0070659_100044534
560 Ga0070659_100065738
561 Ga0070659_100113807
562 Ga0070667_100022237
563 Ga0070667_100047160
564 Ga0070714_100166918
565 Ga0070663_100002596
566 Ga0070663_100084940
567 Ga0070663_100099992
568 Ga0070663_100203419
569 Ga0070663_100260465
570 Ga0070663_100434172
571 Ga0070678_100060398
572 Ga0070662_100005920
573 Ga0070662_100008369
574 Ga0070662_100012893
575 Ga0070662_100013456
576 Ga0070662_100022775
577 Ga0070662_100028814
578 Ga0070662_100031827
579 Ga0070662_100049712
580 Ga0070681_10042024
581 Ga0068867_100010641
582 Ga0068867_100026267
583 Ga0070679_100000001
584 Ga0070679_100005339
585 Ga0070679_100060253
586 Ga0070679_100131576
587 Ga0070679_100172801
588 Ga0070684_100014690
589 Ga0068853_100008230
590 Ga0068853_100021515
591 Ga0068853_100038515
592 Ga0068853_100098991
593 Ga0068853_100372913
594 Ga0070672_100075793
595 Ga0070696_100013187
596 Ga0070693_100021224
597 Ga0070665_100083075
598 Ga0068855_100007295
599 Ga0068855_100010123
600 Ga0068855_100016889
601 Ga0068855_100017657
602 Ga0068855_100227273
603 Ga0070664_100004519
604 Ga0070664_100018365
605 Ga0070664_100055390
606 Ga0070664_100078152
607 Ga0070664_100119855
608 Ga0070664_100147219
609 Ga0070664_100366111
610 Ga0070664_100601343
611 Ga0068857_100004600
612 Ga0068857_100012714
613 Ga0068857_100068474
614 Ga0068854_100002493
615 Ga0068854_100006333
616 Ga0068854_100118179
617 Ga0068856_100004328
618 Ga0068856_100005719
619 Ga0068856_100009109
620 Ga0068856_100034389
621 Ga0068856_100111185
622 Ga0068856_100243604
623 Ga0068852_100000358
624 Ga0068852_100012993
625 Ga0068852_100056390
626 Ga0068852_100194878
627 Ga0068852_100260373
628 Ga0068852_100341545
629 Ga0068859_100000855
630 Ga0068859_100249470
631 Ga0068864_100000366
632 Ga0068864_100026183
633 Ga0068864_100049023
634 Ga0068864_100258085
635 Ga0068866_10005046
636 Ga0068863_100007295
637 Ga0068863_100014764
638 Ga0068863_100025653
639 Ga0068863_100471829
640 Ga0068858_100001635
641 Ga0068860_100067144
642 Ga0068860_100083159
643 Ga0068862_100019573
644 Ga0081539_10026481
645 Ga0075363_100000585
646 Ga0075362_10000026
647 Ga0075369_10004939
648 Ga0075366_10002584
649 Ga0097621_100349942
650 Ga0075370_10000033
651 Ga0068871_100012133
652 Ga0068865_100065486
653 Ga0097620_100000855
654 Ga0097620_100249471
655 Ga0105250_10005314
656 Ga0105240_10002881
657 Ga0105240_10005161
658 Ga0105240_10050229
659 Ga0105240_10109794
660 Ga0105240_10222556
661 Ga0105247_10133291
662 Ga0105241_10224662
663 Ga0105248_10002687
664 Ga0105248_10015535
665 Ga0105237_10071839
666 Ga0105237_10363370
667 Ga0105238_10022690
668 Ga0105238_10076021
669 Ga0105238_10309196
670 Ga0105249_10039926
671 Ga0105239_10093614
672 Ga0105246_10000759
673 Ga0157373_10004720
674 Ga0157373_10038289
675 Ga0157373_10112457
676 Ga0157373_10147109
677 Ga0157371_10001091
678 Ga0157371_10013982
679 Ga0157371_10186706
680 Ga0157370_10069312
681 Ga0157370_10080769
682 Ga0157370_10100138
683 Ga0157370_10129241
684 Ga0157370_10196309
685 Ga0157370_10363486
686 Ga0157369_10006444
687 Ga0157369_10008287
688 Ga0157369_10062724
689 Ga0157369_10073644
690 Ga0157369_10081960
691 Ga0163162_10067628
692 Ga0163162_10268933
693 Ga0157372_10021721
694 Ga0157372_10069390
695 Ga0157372_10127121
696 Ga0157372_10406520
697 Ga0157372_10958902
698 Ga0157375_10156429
699 Ga0157375_10295109
700 Ga0163163_10000665
701 Ga0163163_10523400
702 Ga0157380_10160134
703 Ga0182008_10060111
704 Ga0157379_10012481
705 Ga0157376_10234265
706 Ga0163161_10109744
707 Ga0213873_10000022
708 Ga0213876_10000090
709 Ga0209676_1000372
710 Ga0209676_1000670
711 Ga0209050_1008033
712 Ga0209050_1017021
713 Ga0209257_1021978
714 Ga0207656_10046562
715 Ga0207710_10073093
716 Ga0207688_10136382
717 Ga0207647_10016049
718 Ga0207647_10047746
719 Ga0207647_10126899
720 Ga0207645_10029544
721 Ga0207645_10222021
722 Ga0207705_10000101
723 Ga0207705_10000124
724 Ga0207705_10001816
725 Ga0207705_10002600
726 Ga0207705_10020476
727 Ga0207705_10058449
728 Ga0207705_10207534
729 Ga0207707_10058649
730 Ga0207707_10100535
731 Ga0207695_10003145
732 Ga0207695_10018947
733 Ga0207695_10022555
734 Ga0207660_10027016
735 Ga0207660_10039015
736 Ga0207660_10060564
737 Ga0207657_10000468
738 Ga0207657_10000764
739 Ga0207657_10003570
740 Ga0207657_10073924
741 Ga0207657_10074095
742 Ga0207657_10199676
743 Ga0207657_10218242
744 Ga0207649_10000043
745 Ga0207649_10003307
746 Ga0207649_10030858
747 Ga0207649_10032723
748 Ga0207649_10080799
749 Ga0207652_10000001
750 Ga0207652_10000002
751 Ga0207652_10010715
752 Ga0207652_10020515
753 Ga0207652_10083901
754 Ga0207652_10312402
755 Ga0207681_10009916
756 Ga0207681_10094939
757 Ga0207681_10110060
758 Ga0207694_10079974
759 Ga0207694_10245917
760 Ga0207650_10012679
761 Ga0207650_10032733
762 Ga0207650_10524334
763 Ga0207659_10023767
764 Ga0207644_10000196
765 Ga0207644_10001246
766 Ga0207644_10083265
767 Ga0207644_10128890
768 Ga0207690_10006574
769 Ga0207690_10029116
770 Ga0207690_10047118
771 Ga0207706_10001361
772 Ga0207706_10014556
773 Ga0207706_10019234
774 Ga0207706_10025921
775 Ga0207706_10236434
776 Ga0207669_10131936
777 Ga0207691_10024789
778 Ga0207691_10040402
779 Ga0207691_10257582
780 Ga0207711_10000388
781 Ga0207711_10024066
782 Ga0207711_10032360
783 Ga0207711_10077224
784 Ga0207661_10033353
785 Ga0207661_10103970
786 Ga0207679_10023526
787 Ga0207679_10032743
788 Ga0207679_10075417
789 Ga0207679_10138820
790 Ga0207667_10008659
791 Ga0207667_10009679
792 Ga0207667_10016908
793 Ga0207667_10018168
794 Ga0207667_10038338
795 Ga0207667_10097303
796 Ga0207651_10010072
797 Ga0207651_10045193
798 Ga0207712_10076999
799 Ga0207668_10014958
800 Ga0207668_10231113
801 Ga0207640_10002493
802 Ga0207640_10003067
803 Ga0207640_10009435
804 Ga0207640_10128697
805 Ga0207658_10181866
806 Ga0207703_10001752
807 Ga0207703_10119196
808 Ga0207639_10032428
809 Ga0207639_10082432
810 Ga0207639_10119569
811 Ga0207678_10001147
812 Ga0207678_10004771
813 Ga0207678_10029003
814 Ga0207678_10048697
815 Ga0207678_10095769
816 Ga0207678_10574411
817 Ga0207702_10004354
818 Ga0207702_10004365
819 Ga0207702_10012315
820 Ga0207702_10012913
821 Ga0207702_10049112
822 Ga0207702_10192481
823 Ga0207702_10564800
824 Ga0207641_10000421
825 Ga0207641_10088046
826 Ga0207641_10364875
827 Ga0207648_10008008
828 Ga0207648_10010973
829 Ga0207676_10008522
830 Ga0207676_10012688
831 Ga0207674_10000730
832 Ga0207674_10007002
833 Ga0207674_10012999
834 Ga0207674_10069463
835 Ga0207674_10080955
836 Ga0207674_10098726
837 Ga0207683_10001943
838 Ga0207683_10020864
839 Ga0207698_10000067
840 Ga0207698_10057431
841 Ga0207698_10158683
842 Ga0207698_10180700
843 Ga0207698_10348478
844 Ga0268266_10021340
845 Ga0268266_10026509
846 Ga0268265_10000980
847 Ga0268264_10000338
848 Ga0268264_10155844
849 Ga0307408_100026207
850 Ga0307408_100099605
851 Ga0307405_10013488
852 Ga0307405_10094026
853 Ga0307413_10121664
854 Ga0307413_10239432
855 Ga0307410_10015627
856 Ga0307410_10049079
857 Ga0307410_10222942
858 Ga0307407_10001078
859 Ga0307407_10031079
860 Ga0307412_10090691
861 Ga0307409_100127646
862 Ga0307409_100174923
863 Ga0307409_100447575
864 Ga0307416_100004054
865 Ga0307416_100718129
866 Ga0307416_100813957
867 Ga0307414_10000090
868 Ga0307414_10017881
869 Ga0307414_10072987
870 Ga0307414_10104588
871 Ga0307415_100003523
872 Ga0373928_0011258
873 Ga0316582_0148803
874 Ga0316584_0047107
875 Ga0316584_0322936
876 Ga0395899_0022393
877 Ga0395899_0036148
878 Ga0395899_0040112
879 Ga0395899_0060202
880 Ga0395899_0179726
881 Ga0395900_0002717
882 Ga0395900_0003576
883 Ga0395900_0078201
884 Ga0395900_0080027
885 Ga0395900_0111262
886 Ga0395900_0138341
887 Ga0395900_0235424
888 Ga0395900_0239107
889 Ga0395900_0433359
890 Ga0395898_0004254
891 Ga0395898_0006820
892 Ga0395898_0029920
893 Ga0395898_0097406
894 Ga0395898_0123077
895 Ga0395898_0344258
896 Ga0395905_0000298
897 Ga0395905_0009807
898 Ga0395905_0010154
899 Ga0395905_0020964
900 Ga0395905_0030876
901 Ga0395905_0042029
902 Ga0395905_0044171
903 Ga0395905_0052817
904 Ga0395905_0113403
905 Ga0395905_0155230
906 Ga0395905_0251835
907 Ga0395905_0463034
908 Ga0395901_0000140
909 Ga0395901_0053668
910 Ga0395901_0054851
911 Ga0395901_0093276
912 Ga0395901_0110617
913 Ga0395901_0113049
914 Ga0395901_0119789
915 Ga0395901_0120881
916 Ga0395901_0143264
917 Ga0395901_0686626
918 Ga0436365_0863570
919 Ga0436362_0592983
920 Ga0439448_0020485
921 Ga0439462_0000371
922 Ga0439458_0000872
923 Ga0439464_0000192
924 Ga0466966_0000740
925 Ga0466966_0002854
926 Ga0466966_0108636
927 Ga0466966_0301278
928 Ga0466961_0008230
929 Ga0466961_0100482
930 Ga0466961_0327026
931 Ga0466963_0020310
932 Ga0466964_0069688
933 Ga0466971_0005161
934 Ga0466971_0015086
935 Ga0466970_0001595
936 Ga0466970_0014407
937 Ga0466957_0000272
938 Ga0466957_0139452
939 Ga0466959_0020541
940 Ga0466959_0154027
941 Ga0466959_0191666
942 Ga0466958_0000445
943 Ga0466958_0374644
944 Ga0466967_0013936
945 Ga0466967_0127925
946 Ga0495638_0052116
947 Ga0495606_0077704
948 Ga0495598_0079082
949 Ga0495668_0000031
950 Ga0495668_0034508
951 Ga0495625_0000115
952 Ga0495625_0172981
953 Ga0495669_0006761
954 Ga0495669_0014209
955 Ga0495669_0044451
956 Ga0495670_0244364
957 Ga0496101_0053191
958 Ga0496101_0295441
959 Ga0496102_0052301
960 Ga0496103_0042468
961 Ga0496105_0035740
962 Ga0496107_0011270
963 Ga0496107_0085804
964 Ga0496107_0152772
965 Ga0496108_0000396
966 Ga0496108_0282570
967 Ga0496109_0003559
968 Ga0496109_0073124
969 Ga0496109_0099904
970 Ga0496110_0001619
971 Ga0496110_0133980
972 Ga0496111_0010118
973 Ga0496111_0040494
974 Ga0496112_0000609
975 Ga0496112_0043246
976 Ga0496113_0000746
977 Ga0496114_0161072
978 Ga0501032_0020076
979 Ga0501034_0017265
980 Ga0501036_0065400
981 Ga0501043_0176818
982 Ga0501046_0199371
983 Ga0501047_0262061
984 Ga0501035_0043957
985 Ga0501035_0124658
986 Ga0501044_0005346
987 Ga0501044_0268908
988 nmdc:mga03683_54_c1
989 nmdc:mga03n38_13877_c1
990 nmdc:mga0k408_30_c1
991 nmdc:mga0k408_67745_c1
992 nmdc:mga07m45_148420_c1
993 nmdc:mga07m45_14_c1
994 nmdc:mga0sz30_710_c1
995 Ga0495655_0034874
996 Ga0500643_000001
997 Ga0500643_011408
998 Ga0500592_002140
999 Ga0500568_0003393
1000 Ga0500616_0008736
1001 Ga0500622_0006895
1002 Ga0500627_0000003
1003 Ga0466962_0061821
1004 Ga0466962_0230753
1005 2643819651
1006 2643834024
1007 2643948399
1008 2644054950
1009 2848298851
1010 2896186641
1011 2896254414
1012 3000865383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

35

210

0.96

PF17778

BLACT_WH

Beta-lactamase associated winged helix domain

245

289

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r7j-assembly1.cif.gz_A-2 crystal structure of the dna-binding protein sso10a from sulfolobus solfataricus 0.8263 215 274
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.8216 1 273
5i0p-assembly4.cif.gz_D crystal structure of a beta-lactamase domain protein from burkholderia ambifaria 0.8164 1 274
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.8161 1 273
5i0p-assembly4.cif.gz_D crystal structure of a beta-lactamase domain protein from burkholderia ambifaria 0.8136 1 274
ID Description Score Start End Superfamily
af_Q99KR3_205_288_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8985 200 274 1.10.10.10
af_Q6NYF0_205_289_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8899 202 273 1.10.10.10
af_Q95Q18_202_279_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8674 202 274 1.10.10.10
2fxaD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8472 215 274 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8382 213 274 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6G2K4Z4-F1-model_v4 MBL fold metallo-hydrolase 0.9543 4 98
AF-A0A526XMU4-F1-model_v4 MBL fold metallo-hydrolase 0.9508 5 77 GO:0016787
AF-A0A2E6X934-F1-model_v4 MBL fold metallo-hydrolase 0.9499 15 98 GO:0016787
AF-A0A087NDF3-F1-model_v4 Putative hydrolase/glyoxylase 0.9459 36 274 GO:0016787
GO:0046872
AF-A0A2T4DR41-F1-model_v4 deleted 0.9455 5 93

Map