F456554

General Info

Members Datasets Scaffolds Average Seq Length
506 257 1012 258

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0934330|Ga0436364_0934330_3858_4640
Length 230
Sequence VSIRPLRQSSVRPSPVFLAIVAITAIGGVLAWLAANSVRPLAYVGVFVLVVGGWLVSLCLHEFGHAYLAWRYGDHDVAVRGYLTLNPLKYSNPLLSIGLPLLFIALGGIGLPGGAVYVRTSWMTPWRRTMVALAGHALYDPGHAVFWSGVTFLGFLQVTAVVLNLLPIPGLDGYGALEPHLSPETQRAVEPAKQFGFLLNHWFFSINLSGVPSTLAAIGGQLTRFWSAWR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
143 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
146 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
239 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
246 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
247 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
248 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
249 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
250 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
251 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
252 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
253 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
254 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
255 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
256 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
257 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.25
Nodule 0.2
Rhizoplane 14.82
Rhizosphere 62.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0934330 3300037853 Bacteria 5414
2 JGI24744J21845_10004535 3300002077 Bacteria 2870
3 Ga0055540_1000049 3300003792 Bacteria 146100
4 Ga0055540_1023513 3300003792 Bacteria 1551
5 Ga0070683_100126894 3300005329 Bacteria 2412
6 Ga0068869_100006214 3300005334 Bacteria 7562
7 Ga0068869_100032027 3300005334 Bacteria 3702
8 Ga0070666_10017511 3300005335 Bacteria 4594
9 Ga0070666_10054516 3300005335 Bacteria 2697
10 Ga0070682_100133423 3300005337 Bacteria 1683
11 Ga0068868_100000598 3300005338 Bacteria 24261
12 Ga0068868_100007741 3300005338 Bacteria 7666
13 Ga0070668_100005926 3300005347 Bacteria 9058
14 Ga0070668_100011482 3300005347 Bacteria 6594
15 Ga0070668_100038702 3300005347 Bacteria 3646
16 Ga0070671_100001406 3300005355 Bacteria 17976
17 Ga0070671_100750531 3300005355 Bacteria 848
18 Ga0070688_100013586 3300005365 Bacteria 4597
19 Ga0070667_100000029 3300005367 Bacteria 178990
20 Ga0070667_100001266 3300005367 Bacteria 22917
21 Ga0070667_100002517 3300005367 Bacteria 15986
22 Ga0070667_100018381 3300005367 Bacteria 5797
23 Ga0070667_100431978 3300005367 Bacteria 1202
24 Ga0070709_10049660 3300005434 Bacteria 2624
25 Ga0070709_10094761 3300005434 Bacteria 1976
26 Ga0070714_100228958 3300005435 Bacteria 1712
27 Ga0070714_100453121 3300005435 Bacteria 1219
28 Ga0070713_100299759 3300005436 Bacteria 1479
29 Ga0070710_10002134 3300005437 Bacteria 9377
30 Ga0070710_10008655 3300005437 Bacteria 4957
31 Ga0070701_10001535 3300005438 Bacteria 8559
32 Ga0070711_100000399 3300005439 Bacteria 22400
33 Ga0070700_100023189 3300005441 Bacteria 3628
34 Ga0070663_100000824 3300005455 Bacteria 16823
35 Ga0070663_100023309 3300005455 Bacteria 4148
36 Ga0070663_100455312 3300005455 Bacteria 1055
37 Ga0070678_100011953 3300005456 Bacteria 5376
38 Ga0070678_100451214 3300005456 Bacteria 1126
39 Ga0070662_100001067 3300005457 Bacteria 16714
40 Ga0070662_100163508 3300005457 Bacteria 1742
41 Ga0068867_100276022 3300005459 Bacteria 1376
42 Ga0070685_10122170 3300005466 Bacteria 1618
43 Ga0070685_10124873 3300005466 Bacteria 1602
44 Ga0070706_100498796 3300005467 Bacteria 1133
45 Ga0070672_100231143 3300005543 Bacteria 1554
46 Ga0070686_100046146 3300005544 Bacteria 2748
47 Ga0070695_100024971 3300005545 Bacteria 3686
48 Ga0070696_100014130 3300005546 Bacteria 5358
49 Ga0070693_100014542 3300005547 Bacteria 4035
50 Ga0070665_100003492 3300005548 Bacteria 16733
51 Ga0070665_100293034 3300005548 Bacteria 1629
52 Ga0070665_100293565 3300005548 Bacteria 1628
53 Ga0070665_100362036 3300005548 Bacteria 1456
54 Ga0070665_100482971 3300005548 Bacteria 1250
55 Ga0070704_100000142 3300005549 Bacteria 27154
56 Ga0070704_100194581 3300005549 Bacteria 1632
57 Ga0068855_100066468 3300005563 Bacteria 4204
58 Ga0068855_100072792 3300005563 Bacteria 3994
59 Ga0070664_100219190 3300005564 Bacteria 1702
60 Ga0068854_100000132 3300005578 Bacteria 51381
61 Ga0068854_100111339 3300005578 Bacteria 2065
62 Ga0070702_100000433 3300005615 Bacteria 14899
63 Ga0068852_100069980 3300005616 Bacteria 3077
64 Ga0068859_100005413 3300005617 Bacteria 12977
65 Ga0068859_100275622 3300005617 Bacteria 1774
66 Ga0068864_100196977 3300005618 Bacteria 1849
67 Ga0068864_100406791 3300005618 Bacteria 1294
68 Ga0068866_10000146 3300005718 Bacteria 31984
69 Ga0068861_100000573 3300005719 Bacteria 21796
70 Ga0068863_100000120 3300005841 Bacteria 82283
71 Ga0068863_100003571 3300005841 Bacteria 15344
72 Ga0068863_100149967 3300005841 Bacteria 2231
73 Ga0068858_100001434 3300005842 Bacteria 24529
74 Ga0068858_100005582 3300005842 Bacteria 12307
75 Ga0068858_100084198 3300005842 Bacteria 2958
76 Ga0068860_100000088 3300005843 Bacteria 154416
77 Ga0068860_100000994 3300005843 Bacteria 31355
78 Ga0068860_100054681 3300005843 Bacteria 3794
79 Ga0068860_100442785 3300005843 Bacteria 1291
80 Ga0068862_100000056 3300005844 Bacteria 142257
81 Ga0068862_100010459 3300005844 Bacteria 7662
82 Ga0068862_100272021 3300005844 Bacteria 1550
83 Ga0081455_10016190 3300005937 Bacteria 7208
84 Ga0081455_10084080 3300005937 Bacteria 2598
85 Ga0075365_10318677 3300006038 Bacteria 1095
86 Ga0075368_10008931 3300006042 Bacteria 3593
87 Ga0075363_100000256 3300006048 Bacteria 15198
88 Ga0075363_100058361 3300006048 Bacteria 2073
89 Ga0075363_100104581 3300006048 Bacteria 1569
90 Ga0075364_10004082 3300006051 Bacteria 8377
91 Ga0075364_10009617 3300006051 Bacteria 5807
92 Ga0075364_10010721 3300006051 Bacteria 5544
93 Ga0075364_10184873 3300006051 Bacteria 1411
94 Ga0070715_10024162 3300006163 Bacteria 2390
95 Ga0070712_100001186 3300006175 Bacteria 15742
96 Ga0075362_10011125 3300006177 Bacteria 3537
97 Ga0075362_10239880 3300006177 Bacteria 890
98 Ga0075367_10063776 3300006178 Bacteria 2203
99 Ga0075367_10140232 3300006178 Bacteria 1497
100 Ga0075369_10002198 3300006186 Bacteria 6897
101 Ga0075369_10002992 3300006186 Bacteria 6107
102 Ga0075369_10035053 3300006186 Bacteria 2132
103 Ga0075369_10050251 3300006186 Bacteria 1803
104 Ga0075370_10009794 3300006353 Bacteria 4993
105 Ga0075370_10015073 3300006353 Bacteria 4132
106 Ga0075430_100083726 3300006846 Bacteria 2672
107 Ga0075430_100143082 3300006846 Bacteria 1992
108 Ga0097620_100005413 3300006931 Bacteria 12977
109 Ga0097620_100275626 3300006931 Bacteria 1774
110 Ga0105250_10067546 3300009092 Bacteria 1442
111 Ga0105240_10626983 3300009093 Bacteria 1181
112 Ga0105245_10019281 3300009098 Bacteria 5972
113 Ga0105245_10025209 3300009098 Bacteria 5228
114 Ga0105247_10000008 3300009101 Bacteria 391450
115 Ga0105247_10000186 3300009101 Bacteria 60603
116 Ga0105243_10042425 3300009148 Bacteria 3561
117 Ga0105243_10262314 3300009148 Bacteria 1547
118 Ga0105242_10000731 3300009176 Bacteria 25618
119 Ga0105248_10000051 3300009177 Bacteria 150288
120 Ga0105248_10004274 3300009177 Bacteria 15808
121 Ga0105248_10047837 3300009177 Bacteria 4797
122 Ga0105248_10675043 3300009177 Bacteria 1166
123 Ga0105237_10011100 3300009545 Bacteria 9548
124 Ga0105237_10031535 3300009545 Bacteria 5371
125 Ga0105237_10063295 3300009545 Bacteria 3697
126 Ga0105238_10180670 3300009551 Bacteria 2087
127 Ga0105249_10000040 3300009553 Bacteria 196153
128 Ga0105249_10016009 3300009553 Bacteria 6646
129 Ga0105249_10105712 3300009553 Bacteria 2654
130 Ga0105249_11027905 3300009553 Bacteria 893
131 Ga0105239_10058877 3300010375 Bacteria 4216
132 Ga0105239_10112590 3300010375 Bacteria 3017
133 Ga0105246_10100794 3300011119 Bacteria 2102
134 Ga0157374_10039377 3300013296 Bacteria 4349
135 Ga0157378_10019603 3300013297 Bacteria 5945
136 Ga0157378_10152185 3300013297 Bacteria 2156
137 Ga0157378_10741037 3300013297 Bacteria 1005
138 Ga0163162_10164128 3300013306 Bacteria 2345
139 Ga0163162_10294545 3300013306 Bacteria 1754
140 Ga0163162_10393625 3300013306 Bacteria 1518
141 Ga0157372_10002789 3300013307 Bacteria 18877
142 Ga0157372_10231028 3300013307 Bacteria 2145
143 Ga0157375_10756241 3300013308 Bacteria 1123
144 Ga0163163_10045164 3300014325 Bacteria 4324
145 Ga0163163_10158563 3300014325 Bacteria 2308
146 Ga0157380_10002376 3300014326 Bacteria 12644
147 Ga0157380_10510672 3300014326 Bacteria 1170
148 Ga0157377_10015328 3300014745 Bacteria 3918
149 Ga0157379_10369506 3300014968 Bacteria 1315
150 Ga0157376_10024770 3300014969 Bacteria 4718
151 Ga0163161_10001312 3300017792 Bacteria 18511
152 Ga0163161_10022234 3300017792 Bacteria 4464
153 Ga0213874_10078399 3300021377 Bacteria 1066
154 Ga0213876_10010144 3300021384 Bacteria 5061
155 Ga0213876_10091944 3300021384 Bacteria 1607
156 Ga0209673_1008167 3300025273 Bacteria 4701
157 Ga0209051_1000034 3300025303 Bacteria 371498
158 Ga0209051_1001481 3300025303 Bacteria 19733
159 Ga0209051_1064655 3300025303 Bacteria 1132
160 Ga0207692_10003683 3300025898 Bacteria 6008
161 Ga0207642_10000332 3300025899 Bacteria 14184
162 Ga0207710_10000006 3300025900 Bacteria 538831
163 Ga0207710_10007005 3300025900 Bacteria 4791
164 Ga0207688_10020408 3300025901 Bacteria 3617
165 Ga0207680_10031355 3300025903 Bacteria 3010
166 Ga0207680_10115270 3300025903 Bacteria 1750
167 Ga0207685_10001049 3300025905 Bacteria 5426
168 Ga0207699_10044912 3300025906 Bacteria 2575
169 Ga0207684_10381763 3300025910 Bacteria 1212
170 Ga0207654_10288868 3300025911 Bacteria 1111
171 Ga0207671_10206361 3300025914 Bacteria 1536
172 Ga0207693_10000172 3300025915 Bacteria 58877
173 Ga0207663_10001208 3300025916 Bacteria 11932
174 Ga0207662_10077690 3300025918 Bacteria 2019
175 Ga0207657_10148878 3300025919 Bacteria 1908
176 Ga0207681_10006037 3300025923 Bacteria 7429
177 Ga0207650_10516042 3300025925 Bacteria 1000
178 Ga0207687_10004141 3300025927 Bacteria 9717
179 Ga0207700_10742316 3300025928 Bacteria 877
180 Ga0207664_10225555 3300025929 Bacteria 1627
181 Ga0207664_10474214 3300025929 Bacteria 1119
182 Ga0207664_10550193 3300025929 Bacteria 1035
183 Ga0207644_10002477 3300025931 Bacteria 11891
184 Ga0207644_10052303 3300025931 Bacteria 2935
185 Ga0207690_10131161 3300025932 Bacteria 1834
186 Ga0207706_10003347 3300025933 Bacteria 15335
187 Ga0207706_10022970 3300025933 Bacteria 5600
188 Ga0207686_10010473 3300025934 Bacteria 5050
189 Ga0207709_10003310 3300025935 Bacteria 9654
190 Ga0207669_10000124 3300025937 Bacteria 38397
191 Ga0207669_10115509 3300025937 Bacteria 1809
192 Ga0207704_10010674 3300025938 Bacteria 4489
193 Ga0207704_10058218 3300025938 Bacteria 2378
194 Ga0207665_10003955 3300025939 Bacteria 9915
195 Ga0207691_10085377 3300025940 Bacteria 2833
196 Ga0207691_10204558 3300025940 Bacteria 1717
197 Ga0207711_10000095 3300025941 Bacteria 93602
198 Ga0207711_10022486 3300025941 Bacteria 5273
199 Ga0207711_10243614 3300025941 Bacteria 1649
200 Ga0207689_10008704 3300025942 Bacteria 8833
201 Ga0207661_10062876 3300025944 Bacteria 3005
202 Ga0207712_10000017 3300025961 Bacteria 337943
203 Ga0207712_10020990 3300025961 Bacteria 4283
204 Ga0207712_10082962 3300025961 Bacteria 2338
205 Ga0207712_10190420 3300025961 Bacteria 1619
206 Ga0207668_10001759 3300025972 Bacteria 12659
207 Ga0207668_10002901 3300025972 Bacteria 10061
208 Ga0207640_10001238 3300025981 Bacteria 13910
209 Ga0207658_10000060 3300025986 Bacteria 119956
210 Ga0207658_10004718 3300025986 Bacteria 9440
211 Ga0207658_10010557 3300025986 Bacteria 6274
212 Ga0207658_10265201 3300025986 Bacteria 1465
213 Ga0207677_10086083 3300026023 Bacteria 2270
214 Ga0207677_10411641 3300026023 Bacteria 1149
215 Ga0207703_10025578 3300026035 Bacteria 4643
216 Ga0207639_10767654 3300026041 Bacteria 897
217 Ga0207678_10007789 3300026067 Bacteria 9463
218 Ga0207678_10030318 3300026067 Bacteria 4723
219 Ga0207678_10038500 3300026067 Bacteria 4155
220 Ga0207708_10023419 3300026075 Bacteria 4667
221 Ga0207708_10034411 3300026075 Bacteria 3854
222 Ga0207641_10001248 3300026088 Bacteria 25371
223 Ga0207641_10004117 3300026088 Bacteria 12678
224 Ga0207641_10117418 3300026088 Bacteria 2369
225 Ga0207648_10043829 3300026089 Bacteria 3927
226 Ga0207676_10278487 3300026095 Bacteria 1518
227 Ga0207675_100001953 3300026118 Bacteria 20591
228 Ga0207675_100218003 3300026118 Bacteria 1838
229 Ga0207683_10001213 3300026121 Bacteria 23363
230 Ga0207683_10257829 3300026121 Bacteria 1592
231 Ga0207683_10273173 3300026121 Bacteria 1544
232 Ga0207698_10249348 3300026142 Bacteria 1623
233 Ga0268266_10017465 3300028379 Bacteria 6119
234 Ga0268266_10026106 3300028379 Bacteria 4970
235 Ga0268266_10114306 3300028379 Bacteria 2395
236 Ga0268265_10000068 3300028380 Bacteria 142272
237 Ga0268265_10007213 3300028380 Bacteria 7511
238 Ga0268265_10125994 3300028380 Bacteria 2119
239 Ga0268264_10000056 3300028381 Bacteria 310339
240 Ga0268264_10006786 3300028381 Bacteria 9617
241 Ga0268264_10251326 3300028381 Bacteria 1642
242 Ga0268264_10351630 3300028381 Bacteria 1403
243 Ga0265327_10000954 3300031251 Bacteria 41614
244 Ga0307413_10117362 3300031824 Bacteria 1795
245 Ga0307410_10542234 3300031852 Bacteria 963
246 Ga0307409_100273441 3300031995 Bacteria 1557
247 Ga0436365_0100200 3300039437 Bacteria 6552
248 Ga0436365_1177772 3300039437 Bacteria 64815
249 Ga0436361_1042260 3300039447 Bacteria 2195
250 Ga0436363_0993558 3300039450 Bacteria 2029
251 Ga0439461_0004147 3300041410 Bacteria 2409
252 Ga0439466_0001778 3300041411 Bacteria 8426
253 Ga0439466_0007796 3300041411 Bacteria 4044
254 Ga0451793_0833982 3300041452 Bacteria 2773
255 Ga0451793_1502081 3300041452 Bacteria 970
256 Ga0451795_0491412 3300041456 Bacteria 1293
257 Ga0451800_0653049 3300041459 Bacteria 1277
258 Ga0439431_0000818 3300041997 Bacteria 6718
259 Ga0439442_029246 3300042002 Bacteria 1149
260 Ga0439448_0007443 3300042005 Bacteria 3175
261 Ga0439434_0003546 3300042435 Bacteria 4556
262 Ga0466969_0019912 3300044656 Bacteria 3479
263 Ga0466972_0022436 3300044658 Bacteria 3144
264 Ga0466972_0264036 3300044658 Bacteria 805
265 Ga0466965_0001481 3300044683 Bacteria 9492
266 Ga0466965_0024314 3300044683 Bacteria 2929
267 Ga0466965_0026272 3300044683 Bacteria 2822
268 Ga0466965_0102008 3300044683 Bacteria 1468
269 Ga0466966_0013907 3300044684 Bacteria 5327
270 Ga0466966_0014048 3300044684 Bacteria 5301
271 Ga0466961_0146289 3300044693 Bacteria 1477
272 Ga0466963_0042198 3300044694 Bacteria 2994
273 Ga0466963_0135115 3300044694 Bacteria 1706
274 Ga0466963_0186402 3300044694 Bacteria 1449
275 Ga0466963_0546554 3300044694 Bacteria 818
276 Ga0466964_0004151 3300044706 Bacteria 5328
277 Ga0466964_0208969 3300044706 Bacteria 942
278 Ga0466971_0008376 3300044719 Bacteria 4512
279 Ga0466971_0110079 3300044719 Bacteria 1270
280 Ga0466971_0157774 3300044719 Bacteria 1061
281 Ga0466968_0002213 3300044735 Bacteria 7099
282 Ga0466968_0014354 3300044735 Bacteria 3130
283 Ga0466968_0058237 3300044735 Bacteria 1662
284 Ga0466970_0043340 3300044765 Bacteria 2394
285 Ga0466970_0085933 3300044765 Bacteria 1704
286 Ga0466957_0010642 3300044842 Bacteria 5288
287 Ga0466957_0065067 3300044842 Bacteria 2244
288 Ga0466957_0234089 3300044842 Bacteria 1217
289 Ga0466960_0000731 3300044901 Bacteria 11497
290 Ga0466960_0002339 3300044901 Bacteria 7124
291 Ga0466960_0036173 3300044901 Bacteria 2312
292 Ga0466960_0094006 3300044901 Bacteria 1533
293 Ga0466959_0027235 3300045049 Bacteria 4239
294 Ga0466959_0039079 3300045049 Bacteria 3507
295 Ga0466959_0100425 3300045049 Bacteria 2071
296 Ga0466959_0247557 3300045049 Bacteria 1230
297 Ga0466958_0017959 3300045836 Bacteria 4099
298 Ga0466958_0198049 3300045836 Bacteria 1278
299 Ga0466967_0004105 3300045976 Bacteria 9731
300 Ga0466967_0013771 3300045976 Bacteria 6268
301 Ga0466967_0019262 3300045976 Bacteria 5483
302 Ga0466967_0037800 3300045976 Bacteria 4135
303 Ga0466967_0405670 3300045976 Bacteria 1327
304 Ga0495629_0010144 3300046459 Bacteria 6867
305 Ga0495638_0007305 3300046460 Bacteria 7939
306 Ga0495638_0014201 3300046460 Bacteria 5390
307 Ga0495582_0015620 3300046473 Bacteria 4168
308 Ga0495583_0028336 3300046506 Bacteria 2755
309 Ga0495606_0039253 3300046507 Bacteria 3194
310 Ga0495648_0004576 3300046524 Bacteria 11781
311 Ga0495640_0033119 3300046533 Bacteria 3674
312 Ga0495668_0074628 3300046616 Bacteria 1862
313 Ga0495635_0332766 3300046663 Bacteria 1015
314 Ga0495649_0233061 3300046694 Bacteria 950
315 Ga0495581_0030942 3300047315 Bacteria 3101
316 Ga0495674_0020448 3300047319 Bacteria 6127
317 Ga0495672_0004629 3300047320 Bacteria 11167
318 Ga0495676_0062428 3300047321 Bacteria 2909
319 Ga0495673_0050610 3300047469 Bacteria 1822
320 Ga0495686_0008750 3300047472 Bacteria 7384
321 Ga0495593_0006265 3300047673 Bacteria 6985
322 Ga0495626_0085578 3300048091 Bacteria 1394
323 Ga0496100_0000201 3300048903 Bacteria 32813
324 Ga0496100_0030387 3300048903 Bacteria 3351
325 Ga0496100_0067324 3300048903 Bacteria 2378
326 Ga0496100_0074576 3300048903 Bacteria 2273
327 Ga0496101_0000115 3300048904 Bacteria 79334
328 Ga0496101_0000167 3300048904 Bacteria 55044
329 Ga0496101_0003276 3300048904 Bacteria 10065
330 Ga0496101_0006585 3300048904 Bacteria 7484
331 Ga0496101_0110213 3300048904 Bacteria 2071
332 Ga0496101_0124521 3300048904 Bacteria 1952
333 Ga0496102_0000009 3300048905 Bacteria 344149
334 Ga0496102_0000274 3300048905 Bacteria 65634
335 Ga0496102_0001208 3300048905 Bacteria 23450
336 Ga0496102_0002475 3300048905 Bacteria 15769
337 Ga0496102_0014684 3300048905 Bacteria 6807
338 Ga0496102_0067101 3300048905 Bacteria 3290
339 Ga0496102_0095680 3300048905 Bacteria 2753
340 Ga0496102_0110838 3300048905 Bacteria 2558
341 Ga0496102_0133966 3300048905 Bacteria 2321
342 Ga0496102_0244094 3300048905 Bacteria 1693
343 Ga0496103_0000051 3300048906 Bacteria 150397
344 Ga0496103_0000288 3300048906 Bacteria 47116
345 Ga0496103_0000694 3300048906 Bacteria 25093
346 Ga0496103_0002189 3300048906 Bacteria 12405
347 Ga0496103_0058185 3300048906 Bacteria 2401
348 Ga0496103_0177629 3300048906 Bacteria 1368
349 Ga0496103_0178831 3300048906 Bacteria 1363
350 Ga0496104_0003950 3300048907 Bacteria 12837
351 Ga0496104_0015115 3300048907 Bacteria 6988
352 Ga0496104_0043047 3300048907 Bacteria 4240
353 Ga0496104_0248480 3300048907 Bacteria 1692
354 Ga0496105_0035125 3300048908 Bacteria 4125
355 Ga0496105_0259840 3300048908 Bacteria 1404
356 Ga0496105_0365168 3300048908 Bacteria 1151
357 Ga0496106_0001133 3300048909 Bacteria 19719
358 Ga0496106_0007463 3300048909 Bacteria 8081
359 Ga0496106_0011332 3300048909 Bacteria 6598
360 Ga0496106_0021573 3300048909 Bacteria 4783
361 Ga0496106_0029089 3300048909 Bacteria 4117
362 Ga0496107_0005423 3300048910 Bacteria 8731
363 Ga0496107_0058257 3300048910 Bacteria 2793
364 Ga0496107_0184363 3300048910 Bacteria 1550
365 Ga0496107_0193914 3300048910 Bacteria 1510
366 Ga0496107_0446489 3300048910 Bacteria 961
367 Ga0496108_0001105 3300048911 Bacteria 21090
368 Ga0496108_0011728 3300048911 Bacteria 7128
369 Ga0496108_0025460 3300048911 Bacteria 4877
370 Ga0496108_0209450 3300048911 Bacteria 1692
371 Ga0496109_0000213 3300048912 Bacteria 56907
372 Ga0496109_0036900 3300048912 Bacteria 4413
373 Ga0496109_0048342 3300048912 Bacteria 3871
374 Ga0496109_0056225 3300048912 Bacteria 3591
375 Ga0496109_0190455 3300048912 Bacteria 1927
376 Ga0496110_0018283 3300048913 Bacteria 5877
377 Ga0496110_0018948 3300048913 Bacteria 5782
378 Ga0496110_0042561 3300048913 Bacteria 3964
379 Ga0496110_0067304 3300048913 Bacteria 3169
380 Ga0496110_0523018 3300048913 Bacteria 1079
381 Ga0496112_0007232 3300048915 Bacteria 9840
382 Ga0496112_0029795 3300048915 Bacteria 5280
383 Ga0496112_0056554 3300048915 Bacteria 3861
384 Ga0496113_0012141 3300048916 Bacteria 5779
385 Ga0496113_0581660 3300048916 Bacteria 897
386 Ga0496114_0001282 3300048917 Bacteria 18984
387 Ga0496114_0006864 3300048917 Bacteria 8968
388 Ga0496114_0031618 3300048917 Bacteria 4354
389 Ga0496114_0246830 3300048917 Bacteria 1571
390 Ga0496115_0005314 3300048918 Bacteria 9365
391 Ga0496115_0006111 3300048918 Bacteria 8801
392 Ga0496115_0031789 3300048918 Bacteria 4161
393 Ga0496115_0647460 3300048918 Bacteria 836
394 Ga0496116_0000141 3300048919 Bacteria 150405
395 Ga0496116_0002753 3300048919 Bacteria 18055
396 Ga0496116_0007771 3300048919 Bacteria 9430
397 Ga0496117_0000019 3300048920 Bacteria 469256
398 Ga0496117_0000631 3300048920 Bacteria 57010
399 Ga0496117_0003539 3300048920 Bacteria 18036
400 Ga0496117_0011868 3300048920 Bacteria 7752
401 Ga0496117_0208114 3300048920 Bacteria 1099
402 Ga0496118_0000020 3300048921 Bacteria 470521
403 Ga0496118_0000255 3300048921 Bacteria 94123
404 Ga0496118_0006274 3300048921 Bacteria 13144
405 Ga0496119_0005449 3300048922 Bacteria 12192
406 Ga0496119_0006621 3300048922 Bacteria 10662
407 Ga0496119_0029851 3300048922 Bacteria 3686
408 Ga0496119_0127537 3300048922 Bacteria 1390
409 Ga0496120_0002480 3300048923 Bacteria 18572
410 Ga0496120_0002534 3300048923 Bacteria 18246
411 Ga0496120_0014521 3300048923 Bacteria 5246
412 Ga0496120_0051407 3300048923 Bacteria 2354
413 Ga0496121_0000002 3300048924 Bacteria 1494588
414 Ga0496121_0000510 3300048924 Bacteria 74197
415 Ga0496121_0002244 3300048924 Bacteria 30111
416 Ga0496121_0294412 3300048924 Bacteria 1104
417 Ga0496122_0000639 3300048925 Bacteria 71085
418 Ga0496122_0155234 3300048925 Bacteria 1405
419 Ga0496123_0002153 3300048926 Bacteria 25162
420 Ga0496123_0038258 3300048926 Bacteria 3374
421 Ga0496124_0000002 3300048927 Bacteria 1494588
422 Ga0496125_0000002 3300048928 Bacteria 1480920
423 Ga0496125_0043205 3300048928 Bacteria 3829
424 Ga0496126_0000009 3300048929 Bacteria 750350
425 Ga0496126_0001641 3300048929 Bacteria 33823
426 Ga0496126_0004274 3300048929 Bacteria 17184
427 Ga0496126_0013246 3300048929 Bacteria 8407
428 Ga0501032_0000183 3300049569 Bacteria 51751
429 Ga0501032_0006575 3300049569 Bacteria 8535
430 Ga0501033_0151992 3300049570 Bacteria 1670
431 Ga0501034_0004273 3300049571 Bacteria 15940
432 Ga0501034_0065454 3300049571 Bacteria 3647
433 Ga0501036_0016856 3300049572 Bacteria 6103
434 Ga0501037_0003871 3300049573 Bacteria 10856
435 Ga0501038_0000279 3300049574 Bacteria 43292
436 Ga0501039_0000790 3300049575 Bacteria 22773
437 Ga0501043_0002246 3300049579 Bacteria 16438
438 Ga0501043_0017664 3300049579 Bacteria 5594
439 Ga0501046_0026653 3300049580 Bacteria 4720
440 Ga0501047_0014204 3300049581 Bacteria 7568
441 Ga0501047_0074297 3300049581 Bacteria 3273
442 Ga0501048_0001569 3300049582 Bacteria 17372
443 Ga0501069_0055952 3300049585 Bacteria 2197
444 Ga0501070_0001570 3300049586 Bacteria 20304
445 Ga0501070_0029824 3300049586 Bacteria 4570
446 Ga0501070_0055515 3300049586 Bacteria 3283
447 Ga0501073_0024354 3300049589 Bacteria 4346
448 Ga0501073_0058762 3300049589 Bacteria 2687
449 Ga0501080_0103646 3300049742 Bacteria 2638
450 Ga0501035_0021057 3300049822 Bacteria 5994
451 Ga0501044_0004782 3300049823 Bacteria 15149
452 Ga0501044_0009790 3300049823 Bacteria 10423
453 Ga0501044_0013430 3300049823 Bacteria 8856
454 Ga0501045_0301854 3300049824 Bacteria 1192
455 nmdc:mga03n38_25939_c1 3300050490 Bacteria 2414
456 nmdc:mga03n38_286022_c1 3300050490 Bacteria 881
457 nmdc:mga03n38_47137_c1 3300050490 Bacteria 1906
458 nmdc:mga00v17_139903_c1 3300050491 Bacteria 1551
459 nmdc:mga00v17_3403_c1 3300050491 Bacteria 8215
460 nmdc:mga00v17_40344_c1 3300050491 Bacteria 2800
461 nmdc:mga00v17_413474_c1 3300050491 Bacteria 876
462 nmdc:mga00v17_41900_c1 3300050491 Bacteria 2752
463 nmdc:mga00v17_4503_c2 3300050491 Bacteria 5150
464 nmdc:mga00v17_53005_c1 3300050491 Bacteria 2471
465 nmdc:mga0yw44_42200_c1 3300050492 Bacteria 2719
466 nmdc:mga06z11_13909_c1 3300050494 Bacteria 3548
467 nmdc:mga06z11_4449_c1 3300050494 Bacteria 5515
468 nmdc:mga06z11_73608_c1 3300050494 Bacteria 1814
469 nmdc:mga04h51_6588_c1 3300050495 Bacteria 3019
470 nmdc:mga07m45_182432_c1 3300050496 Bacteria 1220
471 nmdc:mga07m45_59065_c1 3300050496 Bacteria 2170
472 nmdc:mga0sz30_13580_c2 3300050516 Bacteria 1492
473 nmdc:mga0sz30_1793_c1 3300050516 Bacteria 5870
474 nmdc:mga0sz30_19641_c1 3300050516 Bacteria 975
475 nmdc:mga0sz30_43895_c1 3300050516 Bacteria 1883
476 nmdc:mga0sz30_48664_c2 3300050516 Bacteria 815
477 nmdc:mga0sz30_68439_c1 3300050516 Bacteria 1525
478 nmdc:mga0sz30_69953_c1 3300050516 Bacteria 1509
479 nmdc:mga0sz30_72672_c1 3300050516 Bacteria 1482
480 Ga0500635_0001512 3300053080 Bacteria 5589
481 Ga0500643_007330 3300053087 Bacteria 4471
482 Ga0500643_009627 3300053087 Bacteria 3674
483 Ga0500643_047533 3300053087 Bacteria 1236
484 Ga0500644_0028390 3300053088 Bacteria 1750
485 Ga0500581_181737 3300053089 Bacteria 954
486 Ga0500652_000498 3300053131 Bacteria 13812
487 Ga0500604_0050937 3300053151 Bacteria 1278
488 Ga0500616_0008769 3300053153 Bacteria 6228
489 Ga0500616_0077157 3300053153 Bacteria 1683
490 Ga0500627_0116345 3300053158 Bacteria 1205
491 Ga0500645_049481 3300053730 Bacteria 1229
492 Ga0466962_0011019 3300061719 Bacteria 4352
493 Ga0466962_0027739 3300061719 Bacteria 2715
494 2644487447 2643221687 Bacteria 6500351
495 2644639056 2643221715 Bacteria 6671032
496 2738665679 2738541264 Bacteria 5935393
497 2738702527 2738541274 Bacteria 6909446
498 2739144813 2738541356 Bacteria 5935017
499 2739331783 2738543028 Bacteria 6917070
500 2842135250 2842134933 Bacteria 5847019
501 2902794325 2902792274 Bacteria 7270173
502 2902802769 2902799365 Bacteria 5419524
503 2902815917 2902810491 Bacteria 6794147
504 2902839546 2902837492 Bacteria 6697721
505 2929213033 2929212328 Bacteria 7708288
506 2939587191 2939582691 Bacteria 7088898
507 Ga0436364_0934330
508 JGI24744J21845_10004535
509 Ga0055540_1000049
510 Ga0055540_1023513
511 Ga0070683_100126894
512 Ga0068869_100006214
513 Ga0068869_100032027
514 Ga0070666_10017511
515 Ga0070666_10054516
516 Ga0070682_100133423
517 Ga0068868_100000598
518 Ga0068868_100007741
519 Ga0070668_100005926
520 Ga0070668_100011482
521 Ga0070668_100038702
522 Ga0070671_100001406
523 Ga0070671_100750531
524 Ga0070688_100013586
525 Ga0070667_100000029
526 Ga0070667_100001266
527 Ga0070667_100002517
528 Ga0070667_100018381
529 Ga0070667_100431978
530 Ga0070709_10049660
531 Ga0070709_10094761
532 Ga0070714_100228958
533 Ga0070714_100453121
534 Ga0070713_100299759
535 Ga0070710_10002134
536 Ga0070710_10008655
537 Ga0070701_10001535
538 Ga0070711_100000399
539 Ga0070700_100023189
540 Ga0070663_100000824
541 Ga0070663_100023309
542 Ga0070663_100455312
543 Ga0070678_100011953
544 Ga0070678_100451214
545 Ga0070662_100001067
546 Ga0070662_100163508
547 Ga0068867_100276022
548 Ga0070685_10122170
549 Ga0070685_10124873
550 Ga0070706_100498796
551 Ga0070672_100231143
552 Ga0070686_100046146
553 Ga0070695_100024971
554 Ga0070696_100014130
555 Ga0070693_100014542
556 Ga0070665_100003492
557 Ga0070665_100293034
558 Ga0070665_100293565
559 Ga0070665_100362036
560 Ga0070665_100482971
561 Ga0070704_100000142
562 Ga0070704_100194581
563 Ga0068855_100066468
564 Ga0068855_100072792
565 Ga0070664_100219190
566 Ga0068854_100000132
567 Ga0068854_100111339
568 Ga0070702_100000433
569 Ga0068852_100069980
570 Ga0068859_100005413
571 Ga0068859_100275622
572 Ga0068864_100196977
573 Ga0068864_100406791
574 Ga0068866_10000146
575 Ga0068861_100000573
576 Ga0068863_100000120
577 Ga0068863_100003571
578 Ga0068863_100149967
579 Ga0068858_100001434
580 Ga0068858_100005582
581 Ga0068858_100084198
582 Ga0068860_100000088
583 Ga0068860_100000994
584 Ga0068860_100054681
585 Ga0068860_100442785
586 Ga0068862_100000056
587 Ga0068862_100010459
588 Ga0068862_100272021
589 Ga0081455_10016190
590 Ga0081455_10084080
591 Ga0075365_10318677
592 Ga0075368_10008931
593 Ga0075363_100000256
594 Ga0075363_100058361
595 Ga0075363_100104581
596 Ga0075364_10004082
597 Ga0075364_10009617
598 Ga0075364_10010721
599 Ga0075364_10184873
600 Ga0070715_10024162
601 Ga0070712_100001186
602 Ga0075362_10011125
603 Ga0075362_10239880
604 Ga0075367_10063776
605 Ga0075367_10140232
606 Ga0075369_10002198
607 Ga0075369_10002992
608 Ga0075369_10035053
609 Ga0075369_10050251
610 Ga0075370_10009794
611 Ga0075370_10015073
612 Ga0075430_100083726
613 Ga0075430_100143082
614 Ga0097620_100005413
615 Ga0097620_100275626
616 Ga0105250_10067546
617 Ga0105240_10626983
618 Ga0105245_10019281
619 Ga0105245_10025209
620 Ga0105247_10000008
621 Ga0105247_10000186
622 Ga0105243_10042425
623 Ga0105243_10262314
624 Ga0105242_10000731
625 Ga0105248_10000051
626 Ga0105248_10004274
627 Ga0105248_10047837
628 Ga0105248_10675043
629 Ga0105237_10011100
630 Ga0105237_10031535
631 Ga0105237_10063295
632 Ga0105238_10180670
633 Ga0105249_10000040
634 Ga0105249_10016009
635 Ga0105249_10105712
636 Ga0105249_11027905
637 Ga0105239_10058877
638 Ga0105239_10112590
639 Ga0105246_10100794
640 Ga0157374_10039377
641 Ga0157378_10019603
642 Ga0157378_10152185
643 Ga0157378_10741037
644 Ga0163162_10164128
645 Ga0163162_10294545
646 Ga0163162_10393625
647 Ga0157372_10002789
648 Ga0157372_10231028
649 Ga0157375_10756241
650 Ga0163163_10045164
651 Ga0163163_10158563
652 Ga0157380_10002376
653 Ga0157380_10510672
654 Ga0157377_10015328
655 Ga0157379_10369506
656 Ga0157376_10024770
657 Ga0163161_10001312
658 Ga0163161_10022234
659 Ga0213874_10078399
660 Ga0213876_10010144
661 Ga0213876_10091944
662 Ga0209673_1008167
663 Ga0209051_1000034
664 Ga0209051_1001481
665 Ga0209051_1064655
666 Ga0207692_10003683
667 Ga0207642_10000332
668 Ga0207710_10000006
669 Ga0207710_10007005
670 Ga0207688_10020408
671 Ga0207680_10031355
672 Ga0207680_10115270
673 Ga0207685_10001049
674 Ga0207699_10044912
675 Ga0207684_10381763
676 Ga0207654_10288868
677 Ga0207671_10206361
678 Ga0207693_10000172
679 Ga0207663_10001208
680 Ga0207662_10077690
681 Ga0207657_10148878
682 Ga0207681_10006037
683 Ga0207650_10516042
684 Ga0207687_10004141
685 Ga0207700_10742316
686 Ga0207664_10225555
687 Ga0207664_10474214
688 Ga0207664_10550193
689 Ga0207644_10002477
690 Ga0207644_10052303
691 Ga0207690_10131161
692 Ga0207706_10003347
693 Ga0207706_10022970
694 Ga0207686_10010473
695 Ga0207709_10003310
696 Ga0207669_10000124
697 Ga0207669_10115509
698 Ga0207704_10010674
699 Ga0207704_10058218
700 Ga0207665_10003955
701 Ga0207691_10085377
702 Ga0207691_10204558
703 Ga0207711_10000095
704 Ga0207711_10022486
705 Ga0207711_10243614
706 Ga0207689_10008704
707 Ga0207661_10062876
708 Ga0207712_10000017
709 Ga0207712_10020990
710 Ga0207712_10082962
711 Ga0207712_10190420
712 Ga0207668_10001759
713 Ga0207668_10002901
714 Ga0207640_10001238
715 Ga0207658_10000060
716 Ga0207658_10004718
717 Ga0207658_10010557
718 Ga0207658_10265201
719 Ga0207677_10086083
720 Ga0207677_10411641
721 Ga0207703_10025578
722 Ga0207639_10767654
723 Ga0207678_10007789
724 Ga0207678_10030318
725 Ga0207678_10038500
726 Ga0207708_10023419
727 Ga0207708_10034411
728 Ga0207641_10001248
729 Ga0207641_10004117
730 Ga0207641_10117418
731 Ga0207648_10043829
732 Ga0207676_10278487
733 Ga0207675_100001953
734 Ga0207675_100218003
735 Ga0207683_10001213
736 Ga0207683_10257829
737 Ga0207683_10273173
738 Ga0207698_10249348
739 Ga0268266_10017465
740 Ga0268266_10026106
741 Ga0268266_10114306
742 Ga0268265_10000068
743 Ga0268265_10007213
744 Ga0268265_10125994
745 Ga0268264_10000056
746 Ga0268264_10006786
747 Ga0268264_10251326
748 Ga0268264_10351630
749 Ga0265327_10000954
750 Ga0307413_10117362
751 Ga0307410_10542234
752 Ga0307409_100273441
753 Ga0436365_0100200
754 Ga0436365_1177772
755 Ga0436361_1042260
756 Ga0436363_0993558
757 Ga0439461_0004147
758 Ga0439466_0001778
759 Ga0439466_0007796
760 Ga0451793_0833982
761 Ga0451793_1502081
762 Ga0451795_0491412
763 Ga0451800_0653049
764 Ga0439431_0000818
765 Ga0439442_029246
766 Ga0439448_0007443
767 Ga0439434_0003546
768 Ga0466969_0019912
769 Ga0466972_0022436
770 Ga0466972_0264036
771 Ga0466965_0001481
772 Ga0466965_0024314
773 Ga0466965_0026272
774 Ga0466965_0102008
775 Ga0466966_0013907
776 Ga0466966_0014048
777 Ga0466961_0146289
778 Ga0466963_0042198
779 Ga0466963_0135115
780 Ga0466963_0186402
781 Ga0466963_0546554
782 Ga0466964_0004151
783 Ga0466964_0208969
784 Ga0466971_0008376
785 Ga0466971_0110079
786 Ga0466971_0157774
787 Ga0466968_0002213
788 Ga0466968_0014354
789 Ga0466968_0058237
790 Ga0466970_0043340
791 Ga0466970_0085933
792 Ga0466957_0010642
793 Ga0466957_0065067
794 Ga0466957_0234089
795 Ga0466960_0000731
796 Ga0466960_0002339
797 Ga0466960_0036173
798 Ga0466960_0094006
799 Ga0466959_0027235
800 Ga0466959_0039079
801 Ga0466959_0100425
802 Ga0466959_0247557
803 Ga0466958_0017959
804 Ga0466958_0198049
805 Ga0466967_0004105
806 Ga0466967_0013771
807 Ga0466967_0019262
808 Ga0466967_0037800
809 Ga0466967_0405670
810 Ga0495629_0010144
811 Ga0495638_0007305
812 Ga0495638_0014201
813 Ga0495582_0015620
814 Ga0495583_0028336
815 Ga0495606_0039253
816 Ga0495648_0004576
817 Ga0495640_0033119
818 Ga0495668_0074628
819 Ga0495635_0332766
820 Ga0495649_0233061
821 Ga0495581_0030942
822 Ga0495674_0020448
823 Ga0495672_0004629
824 Ga0495676_0062428
825 Ga0495673_0050610
826 Ga0495686_0008750
827 Ga0495593_0006265
828 Ga0495626_0085578
829 Ga0496100_0000201
830 Ga0496100_0030387
831 Ga0496100_0067324
832 Ga0496100_0074576
833 Ga0496101_0000115
834 Ga0496101_0000167
835 Ga0496101_0003276
836 Ga0496101_0006585
837 Ga0496101_0110213
838 Ga0496101_0124521
839 Ga0496102_0000009
840 Ga0496102_0000274
841 Ga0496102_0001208
842 Ga0496102_0002475
843 Ga0496102_0014684
844 Ga0496102_0067101
845 Ga0496102_0095680
846 Ga0496102_0110838
847 Ga0496102_0133966
848 Ga0496102_0244094
849 Ga0496103_0000051
850 Ga0496103_0000288
851 Ga0496103_0000694
852 Ga0496103_0002189
853 Ga0496103_0058185
854 Ga0496103_0177629
855 Ga0496103_0178831
856 Ga0496104_0003950
857 Ga0496104_0015115
858 Ga0496104_0043047
859 Ga0496104_0248480
860 Ga0496105_0035125
861 Ga0496105_0259840
862 Ga0496105_0365168
863 Ga0496106_0001133
864 Ga0496106_0007463
865 Ga0496106_0011332
866 Ga0496106_0021573
867 Ga0496106_0029089
868 Ga0496107_0005423
869 Ga0496107_0058257
870 Ga0496107_0184363
871 Ga0496107_0193914
872 Ga0496107_0446489
873 Ga0496108_0001105
874 Ga0496108_0011728
875 Ga0496108_0025460
876 Ga0496108_0209450
877 Ga0496109_0000213
878 Ga0496109_0036900
879 Ga0496109_0048342
880 Ga0496109_0056225
881 Ga0496109_0190455
882 Ga0496110_0018283
883 Ga0496110_0018948
884 Ga0496110_0042561
885 Ga0496110_0067304
886 Ga0496110_0523018
887 Ga0496112_0007232
888 Ga0496112_0029795
889 Ga0496112_0056554
890 Ga0496113_0012141
891 Ga0496113_0581660
892 Ga0496114_0001282
893 Ga0496114_0006864
894 Ga0496114_0031618
895 Ga0496114_0246830
896 Ga0496115_0005314
897 Ga0496115_0006111
898 Ga0496115_0031789
899 Ga0496115_0647460
900 Ga0496116_0000141
901 Ga0496116_0002753
902 Ga0496116_0007771
903 Ga0496117_0000019
904 Ga0496117_0000631
905 Ga0496117_0003539
906 Ga0496117_0011868
907 Ga0496117_0208114
908 Ga0496118_0000020
909 Ga0496118_0000255
910 Ga0496118_0006274
911 Ga0496119_0005449
912 Ga0496119_0006621
913 Ga0496119_0029851
914 Ga0496119_0127537
915 Ga0496120_0002480
916 Ga0496120_0002534
917 Ga0496120_0014521
918 Ga0496120_0051407
919 Ga0496121_0000002
920 Ga0496121_0000510
921 Ga0496121_0002244
922 Ga0496121_0294412
923 Ga0496122_0000639
924 Ga0496122_0155234
925 Ga0496123_0002153
926 Ga0496123_0038258
927 Ga0496124_0000002
928 Ga0496125_0000002
929 Ga0496125_0043205
930 Ga0496126_0000009
931 Ga0496126_0001641
932 Ga0496126_0004274
933 Ga0496126_0013246
934 Ga0501032_0000183
935 Ga0501032_0006575
936 Ga0501033_0151992
937 Ga0501034_0004273
938 Ga0501034_0065454
939 Ga0501036_0016856
940 Ga0501037_0003871
941 Ga0501038_0000279
942 Ga0501039_0000790
943 Ga0501043_0002246
944 Ga0501043_0017664
945 Ga0501046_0026653
946 Ga0501047_0014204
947 Ga0501047_0074297
948 Ga0501048_0001569
949 Ga0501069_0055952
950 Ga0501070_0001570
951 Ga0501070_0029824
952 Ga0501070_0055515
953 Ga0501073_0024354
954 Ga0501073_0058762
955 Ga0501080_0103646
956 Ga0501035_0021057
957 Ga0501044_0004782
958 Ga0501044_0009790
959 Ga0501044_0013430
960 Ga0501045_0301854
961 nmdc:mga03n38_25939_c1
962 nmdc:mga03n38_286022_c1
963 nmdc:mga03n38_47137_c1
964 nmdc:mga00v17_139903_c1
965 nmdc:mga00v17_3403_c1
966 nmdc:mga00v17_40344_c1
967 nmdc:mga00v17_413474_c1
968 nmdc:mga00v17_41900_c1
969 nmdc:mga00v17_4503_c2
970 nmdc:mga00v17_53005_c1
971 nmdc:mga0yw44_42200_c1
972 nmdc:mga06z11_13909_c1
973 nmdc:mga06z11_4449_c1
974 nmdc:mga06z11_73608_c1
975 nmdc:mga04h51_6588_c1
976 nmdc:mga07m45_182432_c1
977 nmdc:mga07m45_59065_c1
978 nmdc:mga0sz30_13580_c2
979 nmdc:mga0sz30_1793_c1
980 nmdc:mga0sz30_19641_c1
981 nmdc:mga0sz30_43895_c1
982 nmdc:mga0sz30_48664_c2
983 nmdc:mga0sz30_68439_c1
984 nmdc:mga0sz30_69953_c1
985 nmdc:mga0sz30_72672_c1
986 Ga0500635_0001512
987 Ga0500643_007330
988 Ga0500643_009627
989 Ga0500643_047533
990 Ga0500644_0028390
991 Ga0500581_181737
992 Ga0500652_000498
993 Ga0500604_0050937
994 Ga0500616_0008769
995 Ga0500616_0077157
996 Ga0500627_0116345
997 Ga0500645_049481
998 Ga0466962_0011019
999 Ga0466962_0027739
1000 2644487447
1001 2644639056
1002 2738665679
1003 2738702527
1004 2739144813
1005 2739331783
1006 2842135250
1007 2902794325
1008 2902802769
1009 2902815917
1010 2902839546
1011 2929213033
1012 2939587191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.4332 122 210
7w6x-assembly1.cif.gz_A crystal structure of e. coli rsep in complex with batimastat 0.4257 129 217
6j4j-assembly1.cif.gz_H soybean seed h-2 ferritin 0.4218 32 208
4v6b-assembly6.cif.gz_Cr crystal structure of human ferritin phe167serfsx26 mutant. 0.4146 34 194
2jd7-assembly1.cif.gz_L crystal structure of the fe-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus 0.4134 52 210
ID Description Score Start End Superfamily
af_Q7Z392_1_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.626 129 203 3.40.50.300
af_P34367_830_1023_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4479 124 251 1.20.58.60
af_A0A0R4J3Q1_3_122_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.4406 135 230 1.20.58.80
af_A0A1D6P003_256_419_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4243 16 193 1.20.1250.20
af_Q651I6_271_428_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4144 19 210 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A378V1E6-F1-model_v4 Peptidase M50 0.9904 122 259 GO:0016020
AF-A0A378V1E6-F1-model_v4 Peptidase M50 0.9834 122 259 GO:0016020
AF-A0A2R5HBH0-F1-model_v4 deleted 0.97 30 259
AF-A0A7W3RCC4-F1-model_v4 Zn-dependent protease 0.9647 7 253 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A4R4V6W6-F1-model_v4 Site-2 protease family protein 0.9641 11 256 GO:0005886
GO:0006508
GO:0008237
GO:0046872

Map