F456570

General Info

Members Datasets Scaffolds Average Seq Length
506 329 1012 87

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0016425|Ga0495609_0016425_2897_3193
Length 98
Sequence LPITSTSLENQAVQALEHEIKELIISSLSLEDITPEDIDAEAPLFVEGLGLDSIDALELGLALQKKYGVSLSADSEETRRHFSSVRALGEFVAARQSS

Samples

Sample ID Description Type Environment
1 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
107 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
108 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
109 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
110 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
134 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
135 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
147 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
150 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
238 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
239 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
240 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
241 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
242 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
243 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
244 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
247 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
248 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
249 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
250 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
251 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
252 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
253 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
254 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
255 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
256 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
257 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
258 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
259 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
260 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
265 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
266 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
267 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
268 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
269 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
270 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
271 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
272 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
273 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
274 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
275 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
276 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
277 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
278 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
279 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
292 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
293 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
294 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
298 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
299 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
300 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
301 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
302 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
303 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
304 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
305 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
306 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
307 2831864461 Roseateles noduli HZ7 Isolate Nodule
308 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
309 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
310 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
311 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
312 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
313 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
314 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
315 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
316 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
317 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
318 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
319 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
320 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
321 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
322 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
323 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
324 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
325 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
326 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
327 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
328 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
329 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.89
Metatranscriptomes 0.59
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 10.87
Nodule 0.59
Rhizoplane 3.95
Rhizosphere 70.75
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495609_0016425 3300046538 Bacteria 3448
2 SwRhRL2b_contig_2042895 2162886007 Bacteria 877
3 SwRhRL2b_contig_2233858 2162886007 Bacteria 908
4 JGI25157J39369_1017816 3300002741 Bacteria 860
5 JGI25151J46595_10113714 3300003187 Bacteria 702
6 rootL2_10188534 3300003322 Bacteria 2467
7 rootH1_10127098 3300003323 Bacteria 4704
8 Ga0055526_1000962 3300003771 Bacteria 21277
9 Ga0055526_1001392 3300003771 Bacteria 17174
10 Ga0055526_1009716 3300003771 Bacteria 4583
11 Ga0055537_1000247 3300003773 Bacteria 39499
12 Ga0055537_1000362 3300003773 Bacteria 30880
13 Ga0055524_1013310 3300003775 Bacteria 3106
14 Ga0055524_1051186 3300003775 Bacteria 935
15 Ga0055536_1002842 3300003781 Bacteria 9535
16 Ga0055536_1003642 3300003781 Bacteria 8208
17 Ga0055536_1005200 3300003781 Bacteria 6427
18 Ga0055534_1000209 3300003784 Bacteria 43174
19 Ga0055528_1000406 3300003790 Bacteria 34907
20 Ga0055530_10006918 3300003791 Bacteria 4907
21 Ga0055530_10008082 3300003791 Bacteria 4285
22 Ga0055540_1090050 3300003792 Bacteria 579
23 Ga0055531_10005439 3300003794 Bacteria 7456
24 Ga0065704_10071430 3300005289 Bacteria 11205
25 Ga0065704_10073390 3300005289 Bacteria 7213
26 Ga0065704_10191552 3300005289 Bacteria 1187
27 Ga0065704_10226183 3300005289 Bacteria 1058
28 Ga0065704_10672379 3300005289 Bacteria 573
29 Ga0065715_10676297 3300005293 Bacteria 631
30 Ga0070677_10206973 3300005333 Bacteria 950
31 Ga0070682_100005736 3300005337 Bacteria 6925
32 Ga0070682_100052929 3300005337 Bacteria 2542
33 Ga0070660_100106804 3300005339 Bacteria 2224
34 Ga0070689_100369006 3300005340 Bacteria 1207
35 Ga0070661_100000487 3300005344 Bacteria 30404
36 Ga0070669_100779145 3300005353 Bacteria 812
37 Ga0070669_101105612 3300005353 Bacteria 683
38 Ga0070659_100017811 3300005366 Bacteria 5351
39 Ga0070667_100555780 3300005367 Bacteria 1055
40 Ga0070705_100223051 3300005440 Bacteria 1306
41 Ga0070663_101152349 3300005455 Bacteria 680
42 Ga0070678_101146388 3300005456 Bacteria 719
43 Ga0070662_101747366 3300005457 Bacteria 537
44 Ga0070707_100161631 3300005468 Bacteria 2182
45 Ga0070698_100036391 3300005471 Bacteria 5084
46 Ga0070698_100098994 3300005471 Bacteria 2889
47 Ga0070697_102076109 3300005536 Bacteria 509
48 Ga0070695_101260154 3300005545 Bacteria 610
49 Ga0070696_100021742 3300005546 Bacteria 4352
50 Ga0070665_100096139 3300005548 Bacteria 2967
51 Ga0070704_100282976 3300005549 Bacteria 1375
52 Ga0068855_100542894 3300005563 Bacteria 1259
53 Ga0070664_100001906 3300005564 Bacteria 16750
54 Ga0068857_100196098 3300005577 Bacteria 1840
55 Ga0068854_101810434 3300005578 Bacteria 560
56 Ga0068856_100175977 3300005614 Bacteria 2152
57 Ga0068859_100515066 3300005617 Bacteria 1291
58 Ga0068861_100777785 3300005719 Bacteria 896
59 Ga0068860_100061087 3300005843 Bacteria 3580
60 Ga0068862_100383222 3300005844 Bacteria 1312
61 Ga0068862_101569240 3300005844 Bacteria 665
62 Ga0075365_10081246 3300006038 Bacteria 2196
63 Ga0075364_10037513 3300006051 Bacteria 3138
64 Ga0075364_10042643 3300006051 Bacteria 2948
65 Ga0075364_10241510 3300006051 Bacteria 1227
66 Ga0075367_10350119 3300006178 Bacteria 932
67 Ga0075366_10379783 3300006195 Bacteria 869
68 Ga0075428_100149151 3300006844 Bacteria 2540
69 Ga0075428_102544692 3300006844 Bacteria 524
70 Ga0075430_101297492 3300006846 Bacteria 599
71 Ga0075431_101029546 3300006847 Unclassified 789
72 Ga0075431_101511831 3300006847 Bacteria 630
73 Ga0097620_100515077 3300006931 Bacteria 1291
74 Ga0105251_10002377 3300009011 Bacteria 14882
75 Ga0105244_10010622 3300009036 Bacteria 5568
76 Ga0105244_10141968 3300009036 Bacteria 1154
77 Ga0111539_11002245 3300009094 Bacteria 971
78 Ga0114129_10232124 3300009147 Bacteria 2485
79 Ga0114129_11083372 3300009147 Bacteria 1004
80 Ga0105243_10011401 3300009148 Bacteria 6725
81 Ga0105243_11774612 3300009148 Bacteria 647
82 Ga0105249_12940843 3300009553 Bacteria 547
83 Ga0157373_10093988 3300013100 Bacteria 2111
84 Ga0157373_10330064 3300013100 Bacteria 1086
85 Ga0157371_10000158 3300013102 Bacteria 99529
86 Ga0157371_10029655 3300013102 Bacteria 3953
87 Ga0157370_10008312 3300013104 Bacteria 11198
88 Ga0157370_10099750 3300013104 Bacteria 2721
89 Ga0157370_10927340 3300013104 Bacteria 790
90 Ga0157369_10963779 3300013105 Bacteria 874
91 Ga0163162_10677020 3300013306 Bacteria 1154
92 Ga0157380_10324187 3300014326 Bacteria 1429
93 Ga0182008_10000360 3300014497 Bacteria 35424
94 Ga0182008_10009886 3300014497 Bacteria 5128
95 Ga0182006_1003577 3300015261 Bacteria 7921
96 Ga0182006_1016933 3300015261 Bacteria 3104
97 Ga0182006_1062101 3300015261 Bacteria 1407
98 Ga0182007_10000019 3300015262 Bacteria 194770
99 Ga0182005_1000088 3300015265 Bacteria 69427
100 Ga0163161_10010242 3300017792 Bacteria 6492
101 Ga0163161_10031996 3300017792 Bacteria 3752
102 Ga0163161_10073091 3300017792 Bacteria 2512
103 Ga0207425_1016906 3300025245 Bacteria 1612
104 Ga0209026_1004451 3300025250 Bacteria 4141
105 Ga0209565_1000113 3300025263 Bacteria 116343
106 Ga0209673_1000581 3300025273 Bacteria 57816
107 Ga0209130_1014194 3300025284 Bacteria 2009
108 Ga0209675_1000007 3300025291 Bacteria 683430
109 Ga0209676_1000018 3300025292 Bacteria 631385
110 Ga0209676_1000170 3300025292 Bacteria 154647
111 Ga0209676_1000771 3300025292 Bacteria 42845
112 Ga0209676_1001924 3300025292 Bacteria 16781
113 Ga0209025_1051857 3300025294 Bacteria 1625
114 Ga0209564_1000120 3300025295 Bacteria 204226
115 Ga0209564_1000404 3300025295 Bacteria 76827
116 Ga0209564_1000770 3300025295 Bacteria 44617
117 Ga0209050_1000109 3300025298 Bacteria 219706
118 Ga0209050_1000448 3300025298 Bacteria 74673
119 Ga0209256_1006067 3300025299 Bacteria 6588
120 Ga0209256_1009268 3300025299 Bacteria 4347
121 Ga0207426_1158043 3300025302 Bacteria 522
122 Ga0209051_1007977 3300025303 Bacteria 5688
123 Ga0209257_1000035 3300025304 Bacteria 631463
124 Ga0209257_1001532 3300025304 Bacteria 26952
125 Ga0209257_1008267 3300025304 Bacteria 5978
126 Ga0207655_1071783 3300025728 Bacteria 1283
127 Ga0207655_1076795 3300025728 Bacteria 1220
128 Ga0207713_1015612 3300025735 Bacteria 3889
129 Ga0207682_10131860 3300025893 Bacteria 1116
130 Ga0207705_10766304 3300025909 Bacteria 749
131 Ga0207657_10107461 3300025919 Bacteria 2308
132 Ga0207649_10000415 3300025920 Bacteria 31502
133 Ga0207646_10146018 3300025922 Bacteria 2132
134 Ga0207681_10101873 3300025923 Bacteria 2072
135 Ga0207690_10116011 3300025932 Bacteria 1936
136 Ga0207690_11380916 3300025932 Bacteria 589
137 Ga0207706_10616350 3300025933 Bacteria 931
138 Ga0207709_10000543 3300025935 Bacteria 32326
139 Ga0207679_10000241 3300025945 Bacteria 41728
140 Ga0207712_10502978 3300025961 Bacteria 1036
141 Ga0207640_11358654 3300025981 Bacteria 636
142 Ga0207658_11993016 3300025986 Bacteria 528
143 Ga0207702_10119264 3300026078 Bacteria 2359
144 Ga0207648_10814540 3300026089 Bacteria 870
145 Ga0207675_100385790 3300026118 Bacteria 1378
146 Ga0207428_10867605 3300027907 Bacteria 639
147 Ga0268266_10055336 3300028379 Bacteria 3410
148 Ga0268265_10427150 3300028380 Bacteria 1232
149 Ga0268265_10995007 3300028380 Bacteria 828
150 Ga0316176_1067502 3300030732 Bacteria 587
151 Ga0316176_1109402 3300030732 Bacteria 3297
152 Ga0316178_1063047 3300030735 Bacteria 558
153 Ga0316178_1158911 3300030735 Bacteria 551
154 Ga0316183_1155477 3300030742 Bacteria 7006
155 Ga0316181_1129821 3300030744 Bacteria 1424
156 Ga0316181_1235374 3300030744 Bacteria 534
157 Ga0316182_1044973 3300030745 Bacteria 793
158 Ga0316182_1396544 3300030745 Bacteria 1328
159 Ga0307408_100181611 3300031548 Bacteria 1688
160 Ga0307408_100221163 3300031548 Bacteria 1545
161 Ga0307408_100342361 3300031548 Bacteria 1266
162 Ga0307408_100458149 3300031548 Bacteria 1108
163 Ga0307408_102216371 3300031548 Bacteria 531
164 Ga0307516_10000315 3300031730 Bacteria 62821
165 Ga0307405_10601905 3300031731 Bacteria 897
166 Ga0307412_10524601 3300031911 Bacteria 990
167 Ga0307409_101474231 3300031995 Bacteria 707
168 Ga0307416_103322023 3300032002 Bacteria 538
169 Ga0307416_103877307 3300032002 Bacteria 501
170 Ga0307414_10002877 3300032004 Bacteria 9088
171 Ga0307414_10095045 3300032004 Bacteria 2226
172 Ga0307414_10107720 3300032004 Bacteria 2112
173 Ga0307414_10286593 3300032004 Bacteria 1386
174 Ga0307411_10000161 3300032005 Bacteria 21426
175 Ga0307411_10255647 3300032005 Bacteria 1380
176 Ga0307411_11029305 3300032005 Bacteria 739
177 Ga0307415_100173094 3300032126 Bacteria 1686
178 Ga0373940_0293906 3300035088 Bacteria 558
179 Ga0395899_0042641 3300037312 Bacteria 3386
180 Ga0395900_0028034 3300037418 Bacteria 5766
181 Ga0395900_0110801 3300037418 Bacteria 2820
182 Ga0395898_0050228 3300037466 Bacteria 4082
183 Ga0395898_1132769 3300037466 Bacteria 715
184 Ga0395905_0005573 3300037471 Bacteria 12828
185 Ga0395905_0011743 3300037471 Bacteria 8455
186 Ga0395905_0063416 3300037471 Bacteria 3457
187 Ga0395901_0024025 3300038443 Bacteria 6251
188 Ga0395901_0430226 3300038443 Bacteria 1352
189 Ga0395901_0784201 3300038443 Bacteria 943
190 Ga0395901_0879127 3300038443 Bacteria 879
191 Ga0237816_00592 3300039145 Bacteria 3065
192 Ga0436361_0296551 3300039447 Bacteria 700
193 Ga0436361_0329036 3300039447 Bacteria 870
194 Ga0439436_0019812 3300041404 Bacteria 2005
195 Ga0439461_0123431 3300041410 Bacteria 649
196 Ga0439465_0019596 3300041413 Bacteria 2115
197 Ga0439465_0083467 3300041413 Bacteria 1086
198 Ga0451789_0872419 3300041443 Bacteria 1018
199 Ga0451791_1586600 3300041451 Bacteria 510
200 Ga0451797_0498349 3300041453 Bacteria 1078
201 Ga0451797_1021478 3300041453 Bacteria 590
202 Ga0451797_1136064 3300041453 Bacteria 567
203 Ga0451798_0757820 3300041458 Bacteria 651
204 Ga0451802_0962581 3300041460 Bacteria 597
205 Ga0451802_2091740 3300041460 Bacteria 677
206 Ga0451807_0037322 3300041486 Bacteria 987
207 Ga0451807_0535299 3300041486 Bacteria 761
208 Ga0451807_2109338 3300041486 Bacteria 535
209 Ga0451837_1615268 3300041494 Bacteria 699
210 Ga0451843_1529628 3300041509 Bacteria 1071
211 Ga0451853_3337827 3300041512 Bacteria 1913
212 Ga0439431_0065112 3300041997 Bacteria 964
213 Ga0439431_0212963 3300041997 Bacteria 565
214 Ga0439433_0032378 3300041999 Bacteria 1199
215 Ga0439445_0070205 3300042004 Bacteria 968
216 Ga0439432_004146 3300042006 Bacteria 5297
217 Ga0439449_0014996 3300042007 Bacteria 2912
218 Ga0439449_0021197 3300042007 Bacteria 2433
219 Ga0439462_0027143 3300042015 Bacteria 1510
220 Ga0439462_0177907 3300042015 Bacteria 602
221 Ga0450890_091933 3300042127 Bacteria 504
222 Ga0450891_001960 3300042129 Bacteria 2108
223 Ga0450891_021179 3300042129 Bacteria 640
224 Ga0439446_0258067 3300042156 Bacteria 603
225 Ga0450893_0015074 3300042532 Bacteria 1301
226 Ga0450901_031309 3300042533 Bacteria 588
227 Ga0451577_0001379 3300042876 Bacteria 32538
228 Ga0466969_0010327 3300044656 Bacteria 4953
229 Ga0466972_0396309 3300044658 Bacteria 647
230 Ga0453683_0000766 3300044673 Bacteria 31975
231 Ga0466965_0228438 3300044683 Bacteria 993
232 Ga0466966_0016897 3300044684 Bacteria 4822
233 Ga0466961_0053071 3300044693 Bacteria 2587
234 Ga0453684_0000377 3300044712 Bacteria 183445
235 Ga0453684_0001213 3300044712 Bacteria 79157
236 Ga0466971_0006373 3300044719 Bacteria 5124
237 Ga0466957_0402457 3300044842 Bacteria 936
238 Ga0466959_0158754 3300045049 Bacteria 1590
239 Ga0451576_0000033 3300045051 Bacteria 393131
240 Ga0451576_0002196 3300045051 Bacteria 30086
241 Ga0451576_0180043 3300045051 Bacteria 2207
242 Ga0466958_0497132 3300045836 Bacteria 791
243 Ga0495617_000136 3300046452 Bacteria 48660
244 Ga0495617_002222 3300046452 Bacteria 7895
245 Ga0495627_051454 3300046453 Bacteria 1237
246 Ga0495603_0025584 3300046455 Bacteria 3569
247 Ga0495590_0012377 3300046457 Bacteria 3166
248 Ga0495638_0001267 3300046460 Bacteria 23581
249 Ga0495638_0011326 3300046460 Bacteria 6146
250 Ga0495638_0032890 3300046460 Bacteria 3319
251 Ga0495638_0306193 3300046460 Bacteria 854
252 Ga0495605_0004340 3300046474 Bacteria 8343
253 Ga0495605_0046234 3300046474 Bacteria 2141
254 Ga0495584_0000021 3300046491 Bacteria 130377
255 Ga0495584_0059005 3300046491 Bacteria 1930
256 Ga0495584_0092989 3300046491 Bacteria 1521
257 Ga0495585_0000005 3300046492 Bacteria 328103
258 Ga0495585_0043835 3300046492 Bacteria 2500
259 Ga0495594_0001115 3300046499 Bacteria 14012
260 Ga0495594_0036691 3300046499 Bacteria 2673
261 Ga0495594_0051830 3300046499 Bacteria 2258
262 Ga0495607_0002140 3300046501 Bacteria 16475
263 Ga0495607_0342598 3300046501 Bacteria 692
264 Ga0495583_0000155 3300046506 Bacteria 114870
265 Ga0495583_0001514 3300046506 Bacteria 23104
266 Ga0495583_0028812 3300046506 Bacteria 2725
267 Ga0495606_0001419 3300046507 Bacteria 32193
268 Ga0495606_0411384 3300046507 Bacteria 702
269 Ga0495610_0000982 3300046512 Bacteria 26313
270 Ga0495616_0001023 3300046513 Bacteria 20012
271 Ga0495616_0030110 3300046513 Bacteria 2856
272 Ga0495616_0178052 3300046513 Bacteria 946
273 Ga0495631_0000800 3300046518 Bacteria 20056
274 Ga0495631_0040735 3300046518 Bacteria 2057
275 Ga0495632_0282573 3300046519 Bacteria 738
276 Ga0495637_0147508 3300046520 Bacteria 889
277 Ga0495643_0000431 3300046522 Bacteria 54537
278 Ga0495644_0003276 3300046523 Bacteria 6403
279 Ga0495644_0015254 3300046523 Bacteria 2942
280 Ga0495648_0000076 3300046524 Bacteria 129413
281 Ga0495648_0003974 3300046524 Bacteria 12794
282 Ga0495663_0001047 3300046525 Bacteria 9086
283 Ga0495663_0001360 3300046525 Bacteria 7709
284 Ga0495663_0001783 3300046525 Bacteria 6658
285 Ga0495666_0089262 3300046526 Bacteria 1455
286 Ga0495666_0092058 3300046526 Bacteria 1430
287 Ga0495654_0105336 3300046530 Bacteria 1293
288 Ga0495654_0109207 3300046530 Bacteria 1264
289 Ga0495654_0247099 3300046530 Bacteria 744
290 Ga0495665_0045193 3300046531 Bacteria 2339
291 Ga0495586_0027395 3300046535 Bacteria 3050
292 Ga0495609_0005728 3300046538 Bacteria 6465
293 Ga0495609_0164104 3300046538 Bacteria 940
294 Ga0495597_0044333 3300046542 Bacteria 1978
295 Ga0495622_0000054 3300046557 Bacteria 102782
296 Ga0495622_0120436 3300046557 Bacteria 1198
297 Ga0495622_0249381 3300046557 Bacteria 781
298 Ga0495633_0000416 3300046558 Bacteria 44195
299 Ga0495633_0035907 3300046558 Bacteria 2377
300 Ga0495633_0046549 3300046558 Bacteria 2052
301 Ga0495633_0062769 3300046558 Bacteria 1739
302 Ga0495633_0125818 3300046558 Bacteria 1186
303 Ga0495633_0549711 3300046558 Bacteria 520
304 Ga0495656_0004425 3300046615 Bacteria 4813
305 Ga0495656_0048727 3300046615 Bacteria 1801
306 Ga0495611_0013556 3300046648 Bacteria 3472
307 Ga0495611_0022007 3300046648 Bacteria 2756
308 Ga0495611_0035363 3300046648 Bacteria 2213
309 Ga0495611_0068446 3300046648 Bacteria 1620
310 Ga0495611_0075700 3300046648 Bacteria 1542
311 Ga0495625_0026955 3300046660 Bacteria 4332
312 Ga0495625_0067737 3300046660 Bacteria 2511
313 Ga0495659_0012250 3300046664 Bacteria 2775
314 Ga0495659_0270732 3300046664 Bacteria 712
315 Ga0495661_0022165 3300046665 Bacteria 4134
316 Ga0495661_0051687 3300046665 Bacteria 2480
317 Ga0495661_0232634 3300046665 Bacteria 949
318 Ga0495588_0008482 3300046674 Bacteria 4720
319 Ga0495588_0073884 3300046674 Bacteria 1775
320 Ga0495588_0388687 3300046674 Bacteria 733
321 Ga0495624_0398818 3300046690 Bacteria 826
322 Ga0495670_0001500 3300046691 Bacteria 11387
323 Ga0495670_0071938 3300046691 Bacteria 1751
324 Ga0495670_0126717 3300046691 Bacteria 1329
325 Ga0495670_0243155 3300046691 Bacteria 958
326 Ga0495670_0398366 3300046691 Bacteria 743
327 Ga0495671_0025498 3300046692 Bacteria 3072
328 Ga0495589_0045988 3300046794 Bacteria 2167
329 Ga0495589_0091635 3300046794 Bacteria 1476
330 Ga0495660_0004302 3300046810 Bacteria 8635
331 Ga0495581_0077960 3300047315 Bacteria 1917
332 Ga0495581_0422355 3300047315 Bacteria 777
333 Ga0495636_0000998 3300047318 Bacteria 10579
334 Ga0495636_0003923 3300047318 Bacteria 5806
335 Ga0495636_0010948 3300047318 Bacteria 3591
336 Ga0495672_0000069 3300047320 Bacteria 189627
337 Ga0495672_0006771 3300047320 Bacteria 8783
338 Ga0495676_0065088 3300047321 Bacteria 2831
339 Ga0495676_0371990 3300047321 Bacteria 952
340 Ga0495683_0012690 3300047323 Bacteria 4423
341 Ga0495683_0028550 3300047323 Bacteria 2851
342 Ga0495687_000296 3300047443 Bacteria 65626
343 Ga0495677_0017435 3300047445 Bacteria 2603
344 Ga0495677_0100181 3300047445 Bacteria 1096
345 Ga0495679_037879 3300047446 Bacteria 1514
346 Ga0495685_000076 3300047447 Bacteria 37313
347 Ga0495673_0035372 3300047469 Bacteria 2302
348 Ga0495681_0052139 3300047470 Bacteria 1921
349 Ga0495686_0007261 3300047472 Bacteria 8332
350 Ga0495686_0030803 3300047472 Bacteria 3482
351 Ga0495686_0610942 3300047472 Bacteria 564
352 Ga0495626_0000711 3300048091 Bacteria 31405
353 Ga0496104_0266151 3300048907 Bacteria 1627
354 Ga0496104_0523039 3300048907 Bacteria 1097
355 Ga0496105_0008564 3300048908 Bacteria 7945
356 Ga0496105_0036543 3300048908 Bacteria 4046
357 Ga0496110_0248507 3300048913 Bacteria 1619
358 Ga0496111_0160491 3300048914 Bacteria 1669
359 Ga0496113_0068380 3300048916 Bacteria 2695
360 Ga0496113_0120161 3300048916 Bacteria 2053
361 Ga0496114_0000701 3300048917 Bacteria 24988
362 Ga0496116_0011211 3300048919 Bacteria 7444
363 Ga0496116_0022029 3300048919 Bacteria 4792
364 Ga0496116_0184251 3300048919 Bacteria 1113
365 Ga0496117_0000176 3300048920 Bacteria 131822
366 Ga0496117_0001903 3300048920 Bacteria 27999
367 Ga0496117_0010267 3300048920 Bacteria 8568
368 Ga0496117_0019628 3300048920 Bacteria 5543
369 Ga0496118_0002286 3300048921 Bacteria 26127
370 Ga0496118_0002382 3300048921 Bacteria 25392
371 Ga0496118_0012199 3300048921 Bacteria 8281
372 Ga0496118_0024465 3300048921 Bacteria 5208
373 Ga0496118_0307259 3300048921 Bacteria 867
374 Ga0496119_0000587 3300048922 Bacteria 49190
375 Ga0496119_0003794 3300048922 Bacteria 15455
376 Ga0496120_0001074 3300048923 Bacteria 36034
377 Ga0496120_0012273 3300048923 Bacteria 5839
378 Ga0496120_0296343 3300048923 Bacteria 742
379 Ga0496121_0005813 3300048924 Bacteria 15638
380 Ga0496121_0045441 3300048924 Bacteria 3773
381 Ga0496121_0047130 3300048924 Bacteria 3680
382 Ga0496122_0010479 3300048925 Bacteria 9545
383 Ga0496122_0013142 3300048925 Bacteria 8139
384 Ga0496122_0058334 3300048925 Bacteria 2858
385 Ga0496122_0350164 3300048925 Bacteria 771
386 Ga0496123_0010164 3300048926 Bacteria 8355
387 Ga0496123_0020278 3300048926 Bacteria 5206
388 Ga0496123_0234226 3300048926 Bacteria 916
389 Ga0496124_0000486 3300048927 Bacteria 68189
390 Ga0496124_0005555 3300048927 Bacteria 14124
391 Ga0496124_0011133 3300048927 Bacteria 9024
392 Ga0496124_0015848 3300048927 Bacteria 7199
393 Ga0496124_0041114 3300048927 Bacteria 3993
394 Ga0496124_0584838 3300048927 Bacteria 729
395 Ga0496125_0004219 3300048928 Bacteria 16745
396 Ga0496125_0023358 3300048928 Bacteria 5709
397 Ga0496125_0278609 3300048928 Bacteria 1037
398 Ga0496126_0001695 3300048929 Bacteria 32750
399 Ga0496126_0017113 3300048929 Bacteria 7229
400 Ga0496126_0068757 3300048929 Bacteria 3161
401 Ga0496126_0073472 3300048929 Bacteria 3040
402 Ga0496126_0663411 3300048929 Bacteria 814
403 Ga0501308_023135 3300049128 Bacteria 791
404 Ga0501310_001774 3300049130 Bacteria 1993
405 Ga0495678_000365 3300049459 Bacteria 46300
406 Ga0495682_0000188 3300049460 Bacteria 50664
407 Ga0495682_0001280 3300049460 Bacteria 14063
408 Ga0501290_012469 3300049513 Bacteria 1103
409 Ga0501291_002697 3300049514 Bacteria 2154
410 Ga0501293_031132 3300049516 Bacteria 571
411 Ga0501295_195526 3300049518 Bacteria 509
412 Ga0501296_056822 3300049519 Bacteria 584
413 Ga0501297_032482 3300049520 Bacteria 701
414 Ga0501300_002797 3300049523 Bacteria 2607
415 Ga0501317_043299 3300049533 Bacteria 695
416 Ga0501034_0000321 3300049571 Bacteria 84273
417 Ga0501034_0664119 3300049571 Unclassified 943
418 Ga0501198_000057 3300049649 Bacteria 32474
419 Ga0501199_033398 3300049650 Bacteria 643
420 Ga0501201_002553 3300049651 Bacteria 1669
421 Ga0501206_044385 3300049653 Bacteria 693
422 Ga0501210_001407 3300049657 Bacteria 1368
423 Ga0501211_001143 3300049658 Bacteria 2815
424 Ga0501217_082557 3300049661 Bacteria 891
425 Ga0501222_000017 3300049662 Bacteria 75770
426 Ga0501222_003199 3300049662 Bacteria 2250
427 Ga0501223_040317 3300049663 Bacteria 906
428 Ga0501224_015750 3300049664 Bacteria 1121
429 Ga0501227_035033 3300049665 Bacteria 1220
430 Ga0501228_010628 3300049666 Bacteria 918
431 Ga0501233_003729 3300049668 Bacteria 2754
432 Ga0501235_039959 3300049669 Bacteria 1071
433 Ga0501236_008439 3300049670 Bacteria 1309
434 Ga0501249_022931 3300049679 Bacteria 1368
435 Ga0501253_158490 3300049683 Bacteria 575
436 Ga0501257_066014 3300049686 Bacteria 919
437 Ga0501258_002905 3300049687 Bacteria 1539
438 Ga0501259_029178 3300049688 Bacteria 1031
439 Ga0501260_045191 3300049689 Bacteria 543
440 Ga0501261_055909 3300049690 Bacteria 658
441 Ga0501221_000531 3300049704 Bacteria 6053
442 Ga0501225_0003524 3300049705 Bacteria 4719
443 Ga0501229_026104 3300049706 Bacteria 787
444 Ga0501232_036032 3300049757 Bacteria 709
445 Ga0501262_004886 3300049759 Bacteria 1569
446 Ga0501263_039517 3300049760 Bacteria 690
447 Ga0501264_005569 3300049761 Bacteria 1149
448 Ga0501267_000542 3300049764 Bacteria 2969
449 Ga0501269_004910 3300049766 Bacteria 1609
450 Ga0501274_002345 3300049771 Bacteria 1483
451 Ga0501279_001886 3300049775 Bacteria 2768
452 Ga0501282_003819 3300049778 Bacteria 1618
453 Ga0501044_0438585 3300049823 Bacteria 1214
454 Ga0501226_017257 3300049853 Bacteria 794
455 nmdc:mga00v17_332531_c1 3300050491 Bacteria 987
456 nmdc:mga00v17_881467_c1 3300050491 Bacteria 567
457 nmdc:mga00v17_89763_c1 3300050491 Bacteria 1929
458 nmdc:mga0yw44_43334_c1 3300050492 Bacteria 2686
459 nmdc:mga0k408_118978_c1 3300050493 Bacteria 1564
460 nmdc:mga07m45_335223_c1 3300050496 Bacteria 879
461 nmdc:mga05p37_1627120_c1 3300050507 Bacteria 634
462 nmdc:mga09592_158637_c1 3300050508 Bacteria 1953
463 nmdc:mga0qj67_423319_c1 3300050509 Bacteria 1073
464 nmdc:mga06r32_1456539_c1 3300050510 Bacteria 626
465 nmdc:mga06r32_462617_c1 3300050510 Bacteria 1247
466 nmdc:mga08y16_598945_c1 3300050511 Bacteria 1111
467 Ga0500626_165886 3300053128 Bacteria 903
468 Ga0500622_0040796 3300053156 Bacteria 2416
469 Ga0500622_0225010 3300053156 Bacteria 839
470 Ga0500565_000072 3300053734 Bacteria 4830
471 Ga0590071_185777 3300059421 Bacteria 545
472 Ga0590075_026526 3300059424 Bacteria 1459
473 Ga0466962_0021511 3300061719 Bacteria 3097
474 2547501998 2547132130 Bacteria 4660562
475 2578456445 2576861471 Bacteria 4648976
476 2643741983 2643221544 Bacteria 5886209
477 2643791623 2643221554 Bacteria 6603920
478 2643906036 2643221579 Bacteria 4443405
479 2643916603 2643221581 Bacteria 3893603
480 2644261191 2643221646 Bacteria 6433402
481 2747950109 2747842428 Bacteria 4689383
482 2765581058 2765235840 Bacteria 4663337
483 2816517946 2816332141 Bacteria 4436036
484 2831868930 2831864461 Bacteria 6502356
485 2839098056 2839094727 Bacteria 5534556
486 2842394093 2842391507 Bacteria 4486072
487 2842761272 2842757796 Bacteria 3981385
488 2852651690 2852649853 Bacteria 4036942
489 2857444571 2857442823 Bacteria 4562550
490 2874223709 2874220319 Bacteria 4594709
491 2919089260 2919089067 Bacteria 4560942
492 2919136495 2919134579 Bacteria 4480386
493 2923518379 2923516293 Bacteria 3716336
494 2928499358 2928496128 Bacteria 4631123
495 2931382889 2931380184 Bacteria 4455911
496 2937613819 2937610967 Bacteria 4618818
497 2939590315 2939589442 Bacteria 4214238
498 2939626713 2939622612 Bacteria 4698046
499 2939628528 2939626828 Bacteria 4695272
500 2941479408 2941475908 Bacteria 4145589
501 2961050473 2961047084 Bacteria 4594415
502 2961064373 2961064222 Bacteria 4749990
503 2974307103 2974307012 Bacteria 4172388
504 2977247848 2977247770 Bacteria 4160543
505 2984517696 2984514374 Bacteria 4172479
506 8002872117 8002869464 Bacteria 3588529
507 Ga0495609_0016425
508 SwRhRL2b_contig_2042895
509 SwRhRL2b_contig_2233858
510 JGI25157J39369_1017816
511 JGI25151J46595_10113714
512 rootL2_10188534
513 rootH1_10127098
514 Ga0055526_1000962
515 Ga0055526_1001392
516 Ga0055526_1009716
517 Ga0055537_1000247
518 Ga0055537_1000362
519 Ga0055524_1013310
520 Ga0055524_1051186
521 Ga0055536_1002842
522 Ga0055536_1003642
523 Ga0055536_1005200
524 Ga0055534_1000209
525 Ga0055528_1000406
526 Ga0055530_10006918
527 Ga0055530_10008082
528 Ga0055540_1090050
529 Ga0055531_10005439
530 Ga0065704_10071430
531 Ga0065704_10073390
532 Ga0065704_10191552
533 Ga0065704_10226183
534 Ga0065704_10672379
535 Ga0065715_10676297
536 Ga0070677_10206973
537 Ga0070682_100005736
538 Ga0070682_100052929
539 Ga0070660_100106804
540 Ga0070689_100369006
541 Ga0070661_100000487
542 Ga0070669_100779145
543 Ga0070669_101105612
544 Ga0070659_100017811
545 Ga0070667_100555780
546 Ga0070705_100223051
547 Ga0070663_101152349
548 Ga0070678_101146388
549 Ga0070662_101747366
550 Ga0070707_100161631
551 Ga0070698_100036391
552 Ga0070698_100098994
553 Ga0070697_102076109
554 Ga0070695_101260154
555 Ga0070696_100021742
556 Ga0070665_100096139
557 Ga0070704_100282976
558 Ga0068855_100542894
559 Ga0070664_100001906
560 Ga0068857_100196098
561 Ga0068854_101810434
562 Ga0068856_100175977
563 Ga0068859_100515066
564 Ga0068861_100777785
565 Ga0068860_100061087
566 Ga0068862_100383222
567 Ga0068862_101569240
568 Ga0075365_10081246
569 Ga0075364_10037513
570 Ga0075364_10042643
571 Ga0075364_10241510
572 Ga0075367_10350119
573 Ga0075366_10379783
574 Ga0075428_100149151
575 Ga0075428_102544692
576 Ga0075430_101297492
577 Ga0075431_101029546
578 Ga0075431_101511831
579 Ga0097620_100515077
580 Ga0105251_10002377
581 Ga0105244_10010622
582 Ga0105244_10141968
583 Ga0111539_11002245
584 Ga0114129_10232124
585 Ga0114129_11083372
586 Ga0105243_10011401
587 Ga0105243_11774612
588 Ga0105249_12940843
589 Ga0157373_10093988
590 Ga0157373_10330064
591 Ga0157371_10000158
592 Ga0157371_10029655
593 Ga0157370_10008312
594 Ga0157370_10099750
595 Ga0157370_10927340
596 Ga0157369_10963779
597 Ga0163162_10677020
598 Ga0157380_10324187
599 Ga0182008_10000360
600 Ga0182008_10009886
601 Ga0182006_1003577
602 Ga0182006_1016933
603 Ga0182006_1062101
604 Ga0182007_10000019
605 Ga0182005_1000088
606 Ga0163161_10010242
607 Ga0163161_10031996
608 Ga0163161_10073091
609 Ga0207425_1016906
610 Ga0209026_1004451
611 Ga0209565_1000113
612 Ga0209673_1000581
613 Ga0209130_1014194
614 Ga0209675_1000007
615 Ga0209676_1000018
616 Ga0209676_1000170
617 Ga0209676_1000771
618 Ga0209676_1001924
619 Ga0209025_1051857
620 Ga0209564_1000120
621 Ga0209564_1000404
622 Ga0209564_1000770
623 Ga0209050_1000109
624 Ga0209050_1000448
625 Ga0209256_1006067
626 Ga0209256_1009268
627 Ga0207426_1158043
628 Ga0209051_1007977
629 Ga0209257_1000035
630 Ga0209257_1001532
631 Ga0209257_1008267
632 Ga0207655_1071783
633 Ga0207655_1076795
634 Ga0207713_1015612
635 Ga0207682_10131860
636 Ga0207705_10766304
637 Ga0207657_10107461
638 Ga0207649_10000415
639 Ga0207646_10146018
640 Ga0207681_10101873
641 Ga0207690_10116011
642 Ga0207690_11380916
643 Ga0207706_10616350
644 Ga0207709_10000543
645 Ga0207679_10000241
646 Ga0207712_10502978
647 Ga0207640_11358654
648 Ga0207658_11993016
649 Ga0207702_10119264
650 Ga0207648_10814540
651 Ga0207675_100385790
652 Ga0207428_10867605
653 Ga0268266_10055336
654 Ga0268265_10427150
655 Ga0268265_10995007
656 Ga0316176_1067502
657 Ga0316176_1109402
658 Ga0316178_1063047
659 Ga0316178_1158911
660 Ga0316183_1155477
661 Ga0316181_1129821
662 Ga0316181_1235374
663 Ga0316182_1044973
664 Ga0316182_1396544
665 Ga0307408_100181611
666 Ga0307408_100221163
667 Ga0307408_100342361
668 Ga0307408_100458149
669 Ga0307408_102216371
670 Ga0307516_10000315
671 Ga0307405_10601905
672 Ga0307412_10524601
673 Ga0307409_101474231
674 Ga0307416_103322023
675 Ga0307416_103877307
676 Ga0307414_10002877
677 Ga0307414_10095045
678 Ga0307414_10107720
679 Ga0307414_10286593
680 Ga0307411_10000161
681 Ga0307411_10255647
682 Ga0307411_11029305
683 Ga0307415_100173094
684 Ga0373940_0293906
685 Ga0395899_0042641
686 Ga0395900_0028034
687 Ga0395900_0110801
688 Ga0395898_0050228
689 Ga0395898_1132769
690 Ga0395905_0005573
691 Ga0395905_0011743
692 Ga0395905_0063416
693 Ga0395901_0024025
694 Ga0395901_0430226
695 Ga0395901_0784201
696 Ga0395901_0879127
697 Ga0237816_00592
698 Ga0436361_0296551
699 Ga0436361_0329036
700 Ga0439436_0019812
701 Ga0439461_0123431
702 Ga0439465_0019596
703 Ga0439465_0083467
704 Ga0451789_0872419
705 Ga0451791_1586600
706 Ga0451797_0498349
707 Ga0451797_1021478
708 Ga0451797_1136064
709 Ga0451798_0757820
710 Ga0451802_0962581
711 Ga0451802_2091740
712 Ga0451807_0037322
713 Ga0451807_0535299
714 Ga0451807_2109338
715 Ga0451837_1615268
716 Ga0451843_1529628
717 Ga0451853_3337827
718 Ga0439431_0065112
719 Ga0439431_0212963
720 Ga0439433_0032378
721 Ga0439445_0070205
722 Ga0439432_004146
723 Ga0439449_0014996
724 Ga0439449_0021197
725 Ga0439462_0027143
726 Ga0439462_0177907
727 Ga0450890_091933
728 Ga0450891_001960
729 Ga0450891_021179
730 Ga0439446_0258067
731 Ga0450893_0015074
732 Ga0450901_031309
733 Ga0451577_0001379
734 Ga0466969_0010327
735 Ga0466972_0396309
736 Ga0453683_0000766
737 Ga0466965_0228438
738 Ga0466966_0016897
739 Ga0466961_0053071
740 Ga0453684_0000377
741 Ga0453684_0001213
742 Ga0466971_0006373
743 Ga0466957_0402457
744 Ga0466959_0158754
745 Ga0451576_0000033
746 Ga0451576_0002196
747 Ga0451576_0180043
748 Ga0466958_0497132
749 Ga0495617_000136
750 Ga0495617_002222
751 Ga0495627_051454
752 Ga0495603_0025584
753 Ga0495590_0012377
754 Ga0495638_0001267
755 Ga0495638_0011326
756 Ga0495638_0032890
757 Ga0495638_0306193
758 Ga0495605_0004340
759 Ga0495605_0046234
760 Ga0495584_0000021
761 Ga0495584_0059005
762 Ga0495584_0092989
763 Ga0495585_0000005
764 Ga0495585_0043835
765 Ga0495594_0001115
766 Ga0495594_0036691
767 Ga0495594_0051830
768 Ga0495607_0002140
769 Ga0495607_0342598
770 Ga0495583_0000155
771 Ga0495583_0001514
772 Ga0495583_0028812
773 Ga0495606_0001419
774 Ga0495606_0411384
775 Ga0495610_0000982
776 Ga0495616_0001023
777 Ga0495616_0030110
778 Ga0495616_0178052
779 Ga0495631_0000800
780 Ga0495631_0040735
781 Ga0495632_0282573
782 Ga0495637_0147508
783 Ga0495643_0000431
784 Ga0495644_0003276
785 Ga0495644_0015254
786 Ga0495648_0000076
787 Ga0495648_0003974
788 Ga0495663_0001047
789 Ga0495663_0001360
790 Ga0495663_0001783
791 Ga0495666_0089262
792 Ga0495666_0092058
793 Ga0495654_0105336
794 Ga0495654_0109207
795 Ga0495654_0247099
796 Ga0495665_0045193
797 Ga0495586_0027395
798 Ga0495609_0005728
799 Ga0495609_0164104
800 Ga0495597_0044333
801 Ga0495622_0000054
802 Ga0495622_0120436
803 Ga0495622_0249381
804 Ga0495633_0000416
805 Ga0495633_0035907
806 Ga0495633_0046549
807 Ga0495633_0062769
808 Ga0495633_0125818
809 Ga0495633_0549711
810 Ga0495656_0004425
811 Ga0495656_0048727
812 Ga0495611_0013556
813 Ga0495611_0022007
814 Ga0495611_0035363
815 Ga0495611_0068446
816 Ga0495611_0075700
817 Ga0495625_0026955
818 Ga0495625_0067737
819 Ga0495659_0012250
820 Ga0495659_0270732
821 Ga0495661_0022165
822 Ga0495661_0051687
823 Ga0495661_0232634
824 Ga0495588_0008482
825 Ga0495588_0073884
826 Ga0495588_0388687
827 Ga0495624_0398818
828 Ga0495670_0001500
829 Ga0495670_0071938
830 Ga0495670_0126717
831 Ga0495670_0243155
832 Ga0495670_0398366
833 Ga0495671_0025498
834 Ga0495589_0045988
835 Ga0495589_0091635
836 Ga0495660_0004302
837 Ga0495581_0077960
838 Ga0495581_0422355
839 Ga0495636_0000998
840 Ga0495636_0003923
841 Ga0495636_0010948
842 Ga0495672_0000069
843 Ga0495672_0006771
844 Ga0495676_0065088
845 Ga0495676_0371990
846 Ga0495683_0012690
847 Ga0495683_0028550
848 Ga0495687_000296
849 Ga0495677_0017435
850 Ga0495677_0100181
851 Ga0495679_037879
852 Ga0495685_000076
853 Ga0495673_0035372
854 Ga0495681_0052139
855 Ga0495686_0007261
856 Ga0495686_0030803
857 Ga0495686_0610942
858 Ga0495626_0000711
859 Ga0496104_0266151
860 Ga0496104_0523039
861 Ga0496105_0008564
862 Ga0496105_0036543
863 Ga0496110_0248507
864 Ga0496111_0160491
865 Ga0496113_0068380
866 Ga0496113_0120161
867 Ga0496114_0000701
868 Ga0496116_0011211
869 Ga0496116_0022029
870 Ga0496116_0184251
871 Ga0496117_0000176
872 Ga0496117_0001903
873 Ga0496117_0010267
874 Ga0496117_0019628
875 Ga0496118_0002286
876 Ga0496118_0002382
877 Ga0496118_0012199
878 Ga0496118_0024465
879 Ga0496118_0307259
880 Ga0496119_0000587
881 Ga0496119_0003794
882 Ga0496120_0001074
883 Ga0496120_0012273
884 Ga0496120_0296343
885 Ga0496121_0005813
886 Ga0496121_0045441
887 Ga0496121_0047130
888 Ga0496122_0010479
889 Ga0496122_0013142
890 Ga0496122_0058334
891 Ga0496122_0350164
892 Ga0496123_0010164
893 Ga0496123_0020278
894 Ga0496123_0234226
895 Ga0496124_0000486
896 Ga0496124_0005555
897 Ga0496124_0011133
898 Ga0496124_0015848
899 Ga0496124_0041114
900 Ga0496124_0584838
901 Ga0496125_0004219
902 Ga0496125_0023358
903 Ga0496125_0278609
904 Ga0496126_0001695
905 Ga0496126_0017113
906 Ga0496126_0068757
907 Ga0496126_0073472
908 Ga0496126_0663411
909 Ga0501308_023135
910 Ga0501310_001774
911 Ga0495678_000365
912 Ga0495682_0000188
913 Ga0495682_0001280
914 Ga0501290_012469
915 Ga0501291_002697
916 Ga0501293_031132
917 Ga0501295_195526
918 Ga0501296_056822
919 Ga0501297_032482
920 Ga0501300_002797
921 Ga0501317_043299
922 Ga0501034_0000321
923 Ga0501034_0664119
924 Ga0501198_000057
925 Ga0501199_033398
926 Ga0501201_002553
927 Ga0501206_044385
928 Ga0501210_001407
929 Ga0501211_001143
930 Ga0501217_082557
931 Ga0501222_000017
932 Ga0501222_003199
933 Ga0501223_040317
934 Ga0501224_015750
935 Ga0501227_035033
936 Ga0501228_010628
937 Ga0501233_003729
938 Ga0501235_039959
939 Ga0501236_008439
940 Ga0501249_022931
941 Ga0501253_158490
942 Ga0501257_066014
943 Ga0501258_002905
944 Ga0501259_029178
945 Ga0501260_045191
946 Ga0501261_055909
947 Ga0501221_000531
948 Ga0501225_0003524
949 Ga0501229_026104
950 Ga0501232_036032
951 Ga0501262_004886
952 Ga0501263_039517
953 Ga0501264_005569
954 Ga0501267_000542
955 Ga0501269_004910
956 Ga0501274_002345
957 Ga0501279_001886
958 Ga0501282_003819
959 Ga0501044_0438585
960 Ga0501226_017257
961 nmdc:mga00v17_332531_c1
962 nmdc:mga00v17_881467_c1
963 nmdc:mga00v17_89763_c1
964 nmdc:mga0yw44_43334_c1
965 nmdc:mga0k408_118978_c1
966 nmdc:mga07m45_335223_c1
967 nmdc:mga05p37_1627120_c1
968 nmdc:mga09592_158637_c1
969 nmdc:mga0qj67_423319_c1
970 nmdc:mga06r32_1456539_c1
971 nmdc:mga06r32_462617_c1
972 nmdc:mga08y16_598945_c1
973 Ga0500626_165886
974 Ga0500622_0040796
975 Ga0500622_0225010
976 Ga0500565_000072
977 Ga0590071_185777
978 Ga0590075_026526
979 Ga0466962_0021511
980 2547501998
981 2578456445
982 2643741983
983 2643791623
984 2643906036
985 2643916603
986 2644261191
987 2747950109
988 2765581058
989 2816517946
990 2831868930
991 2839098056
992 2842394093
993 2842761272
994 2852651690
995 2857444571
996 2874223709
997 2919089260
998 2919136495
999 2923518379
1000 2928499358
1001 2931382889
1002 2937613819
1003 2939590315
1004 2939626713
1005 2939628528
1006 2941479408
1007 2961050473
1008 2961064373
1009 2974307103
1010 2977247848
1011 2984517696
1012 8002872117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

18

92

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l0i-assembly1.cif.gz_A crystal structure of butyryl-acp i62m mutant 0.8823 4 82
8jfh-assembly1.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.8737 1 82
2qnw-assembly1.cif.gz_A toxoplasma gondii apicoplast-targeted acyl carrier protein 0.8724 2 84
3gzl-assembly1.cif.gz_A crystal structure of holo pfacp disulfide-linked dimer 0.869 3 81
3eje-assembly1.cif.gz_A crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein 0.865 4 81
ID Description Score Start End Superfamily
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8864 2 85 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8809 2 82 1.10.1200.10
af_P0A6A8_1_78_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8745 4 84 1.10.1200.10
3ejeA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.865 4 81 1.10.1200.10
1f80F00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8558 3 80 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A7X0AS83-F1-model_v4 Acyl carrier protein 0.9966 2 86
AF-A0A4Z0BNH8-F1-model_v4 Acyl carrier protein 0.9946 1 86
AF-A0A4Q3LHS5-F1-model_v4 Acyl carrier protein 0.9929 1 86
AF-R5KS56-F1-model_v4 Acyl carrier protein putative 0.9901 4 83
AF-A0A0Q8E753-F1-model_v4 Acyl carrier protein 0.9893 3 86

Map