F456593

General Info

Members Datasets Scaffolds Average Seq Length
506 349 1012 251

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0333470|Ga0501070_0333470_18_797
Length 259
Sequence MSGFLPDQAGAEVRVSPNFGPRRDIAAPDMIVLHYTGMASGDAAEAWLCNPASEVSSHYLVHEDGHVVQMVRESDRAWHAGKSSWHGRTDINSCSVGIEIVNPGHAIGYKAFPKRQIAALTALCLGVAARHRIRPERVLAHSDIAPGRKVDPGEKFPWRRLAEAGIGLFVEPARIMRGAVLDVGEAGPPVEELQSLLSHYGYGIDITGVFDEQTRTVVAAFQRHFRPRRVDGIADRSTLETLRQLIAAVPTGASKQPLF

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
40 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
68 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
69 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
70 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
71 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
72 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
90 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
91 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
111 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
112 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
113 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
114 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
116 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
119 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
120 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
121 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
122 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
123 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
124 2512875024
125 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
126 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
127 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
128 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
129 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
130 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
131 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
132 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
133 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
134 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
135 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
136 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
137 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
138 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
139 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
140 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
141 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
142 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
143 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
144 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
145 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
146 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
147 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
148 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
149 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
150 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
151 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
152 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
153 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
154 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
155 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
156 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
157 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
158 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
159 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
160 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
161 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
162 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
163 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
164 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
165 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
166 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
167 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
168 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
169 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
170 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
171 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
172 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
173 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
174 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
175 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
176 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
177 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
178 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
179 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
180 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
181 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
182 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
183 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
184 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
185 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
186 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
187 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
188 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
189 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
190 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
191 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
192 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
193 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
194 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
195 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
196 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
197 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
198 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
199 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
200 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
201 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
202 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
203 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
204 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
205 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
206 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
207 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
208 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
209 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
210 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
211 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
212 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
213 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
214 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
215 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
216 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
217 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
218 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
219 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
220 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
221 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
222 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
223 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
224 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
225 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
226 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
227 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
228 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
229 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
230 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
231 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
232 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
233 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
234 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
235 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
236 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
237 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
238 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
239 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
240 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
241 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
242 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
243 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
244 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
245 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
246 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
247 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
248 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
249 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
250 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
251 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
252 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
253 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
254 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
255 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
256 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
257 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
258 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
259 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
260 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
261 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
262 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
263 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
264 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
265 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
266 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
267 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
268 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
269 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
270 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
271 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
272 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
273 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
274 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
275 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
276 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
277 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
278 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
279 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
280 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
281 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
282 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
283 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
284 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
285 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
286 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
287 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
288 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
289 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
290 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
291 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
292 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
293 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
294 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
295 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
296 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
297 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
298 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
299 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
300 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
301 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
302 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
303 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
304 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
305 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
306 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
307 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
308 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
309 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
310 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
311 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
312 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
313 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
314 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
315 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
316 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
317 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
318 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
319 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
320 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
321 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
322 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
323 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
324 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
325 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
326 3004167301 Mesorhizobium loti 582 Isolate Unclassified
327 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
328 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
329 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
330 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
331 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
332 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
333 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
334 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
335 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
336 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
337 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
338 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
339 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
340 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
341 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
342 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
343 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
344 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
345 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
346 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
347 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
348 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
349 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.95
Metatranscriptomes 0
Isolates 46.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.1
Nodule 40.91
Rhizoplane 0.4
Rhizosphere 44.27
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0333470 3300049586 Bacteria 1233
2 JGI24740J21852_10007546 3300001979 Bacteria 4406
3 JGI24740J21852_10015712 3300001979 Bacteria 2754
4 JGI25157J39369_1000162 3300002741 Bacteria 55941
5 JGI25406J46586_10003959 3300003203 Bacteria 6928
6 JGI25406J46586_10017325 3300003203 Bacteria 2982
7 JGI25165J46597_1000015 3300003214 Bacteria 380891
8 Ga0055542_1001274 3300003762 Bacteria 13605
9 Ga0070658_10145058 3300005327 Bacteria 1985
10 Ga0070660_100065933 3300005339 Bacteria 2818
11 Ga0070668_100541932 3300005347 Bacteria 1012
12 Ga0070674_100108183 3300005356 Bacteria 2037
13 Ga0070659_100306836 3300005366 Bacteria 1325
14 Ga0068867_100038768 3300005459 Bacteria 3470
15 Ga0068867_100182333 3300005459 Bacteria 1670
16 Ga0068853_100255066 3300005539 Bacteria 1611
17 Ga0068853_100808506 3300005539 Bacteria 898
18 Ga0070665_100208176 3300005548 Bacteria 1956
19 Ga0070665_100347906 3300005548 Bacteria 1487
20 Ga0070665_100719234 3300005548 Bacteria 1012
21 Ga0068855_100143285 3300005563 Bacteria 2722
22 Ga0068857_100424484 3300005577 Bacteria 1240
23 Ga0068852_100275106 3300005616 Bacteria 1621
24 Ga0081540_1046824 3300005983 Bacteria 2179
25 Ga0081539_10001091 3300005985 Bacteria 49336
26 Ga0075365_10017668 3300006038 Bacteria 4370
27 Ga0075365_10046393 3300006038 Bacteria 2853
28 Ga0075365_10060225 3300006038 Bacteria 2532
29 Ga0075365_10101257 3300006038 Bacteria 1972
30 Ga0075365_10456409 3300006038 Bacteria 902
31 Ga0075368_10028907 3300006042 Bacteria 2143
32 Ga0075363_100022834 3300006048 Bacteria 3166
33 Ga0075363_100040728 3300006048 Bacteria 2449
34 Ga0075364_10021165 3300006051 Bacteria 4096
35 Ga0075364_10041910 3300006051 Bacteria 2974
36 Ga0075362_10180109 3300006177 Bacteria 1024
37 Ga0075367_10014851 3300006178 Bacteria 4219
38 Ga0075367_10014995 3300006178 Bacteria 4201
39 Ga0075367_10373606 3300006178 Bacteria 900
40 Ga0075369_10237262 3300006186 Bacteria 845
41 Ga0075370_10025706 3300006353 Bacteria 3258
42 Ga0105240_10055627 3300009093 Bacteria 4954
43 Ga0105240_10462562 3300009093 Bacteria 1417
44 Ga0111539_11015966 3300009094 Bacteria 964
45 Ga0105243_10082552 3300009148 Bacteria 2627
46 Ga0105241_10015060 3300009174 Bacteria 5664
47 Ga0105241_10142483 3300009174 Bacteria 1953
48 Ga0105237_10023788 3300009545 Bacteria 6271
49 Ga0105237_10081959 3300009545 Bacteria 3217
50 Ga0105237_10124981 3300009545 Bacteria 2567
51 Ga0105238_10385074 3300009551 Bacteria 1394
52 Ga0105239_10031279 3300010375 Bacteria 5853
53 Ga0105239_10396445 3300010375 Bacteria 1562
54 Ga0105239_10526807 3300010375 Bacteria 1345
55 Ga0157369_10062986 3300013105 Bacteria 3996
56 Ga0157369_10070043 3300013105 Bacteria 3768
57 Ga0157369_10276440 3300013105 Bacteria 1749
58 Ga0157374_10111785 3300013296 Bacteria 2628
59 Ga0182008_10117909 3300014497 Bacteria 1318
60 Ga0182007_10089735 3300015262 Bacteria 1012
61 Ga0209026_1000025 3300025250 Bacteria 352548
62 Ga0209148_1000128 3300025254 Bacteria 179154
63 Ga0209759_1000121 3300025256 Bacteria 138469
64 Ga0209233_1000010 3300025261 Bacteria 1194329
65 Ga0209455_1000127 3300025272 Bacteria 162518
66 Ga0207688_10195569 3300025901 Bacteria 1211
67 Ga0207647_10021793 3300025904 Bacteria 4268
68 Ga0207705_10192354 3300025909 Bacteria 1543
69 Ga0207654_10150926 3300025911 Bacteria 1491
70 Ga0207695_10612713 3300025913 Bacteria 970
71 Ga0207671_10006286 3300025914 Bacteria 10607
72 Ga0207671_10049860 3300025914 Bacteria 3100
73 Ga0207657_10019042 3300025919 Bacteria 6531
74 Ga0207694_10008217 3300025924 Bacteria 7891
75 Ga0207694_10115610 3300025924 Bacteria 2137
76 Ga0207667_10182996 3300025949 Bacteria 2151
77 Ga0207667_10980535 3300025949 Bacteria 833
78 Ga0207639_10019233 3300026041 Bacteria 4868
79 Ga0207639_10208337 3300026041 Bacteria 1681
80 Ga0207639_10590086 3300026041 Bacteria 1024
81 Ga0207678_10049926 3300026067 Bacteria 3615
82 Ga0207648_10030575 3300026089 Bacteria 4767
83 Ga0207648_10227229 3300026089 Bacteria 1660
84 Ga0207674_10257120 3300026116 Bacteria 1693
85 Ga0268266_10089812 3300028379 Bacteria 2691
86 Ga0268266_10230602 3300028379 Bacteria 1705
87 Ga0307515_10150072 3300028794 Bacteria 2442
88 Ga0307408_100118800 3300031548 Bacteria 2045
89 Ga0395899_0000117 3300037312 Bacteria 130159
90 Ga0395900_0000020 3300037418 Bacteria 353500
91 Ga0395900_0025530 3300037418 Bacteria 6049
92 Ga0395900_0438896 3300037418 Bacteria 1263
93 Ga0395900_0508381 3300037418 Bacteria 1154
94 Ga0395898_0000259 3300037466 Bacteria 130131
95 Ga0395898_0183561 3300037466 Bacteria 1999
96 Ga0395898_0236984 3300037466 Bacteria 1740
97 Ga0395898_0292099 3300037466 Bacteria 1555
98 Ga0395905_0000019 3300037471 Bacteria 353500
99 Ga0395905_0186432 3300037471 Bacteria 1947
100 Ga0395905_0231577 3300037471 Bacteria 1727
101 Ga0395901_0000016 3300038443 Bacteria 354008
102 Ga0395901_0065621 3300038443 Bacteria 3780
103 Ga0395901_0092910 3300038443 Bacteria 3158
104 Ga0395901_0195676 3300038443 Bacteria 2120
105 Ga0495668_0033359 3300046616 Bacteria 2893
106 Ga0495668_0058689 3300046616 Bacteria 2123
107 Ga0495625_0116255 3300046660 Bacteria 1824
108 Ga0495686_0219308 3300047472 Bacteria 1083
109 Ga0496115_0123180 3300048918 Bacteria 2134
110 Ga0496118_0029526 3300048921 Bacteria 4596
111 Ga0496119_0074625 3300048922 Bacteria 1974
112 Ga0496120_0001104 3300048923 Bacteria 35202
113 Ga0496121_0216195 3300048924 Bacteria 1354
114 Ga0496124_0323597 3300048927 Bacteria 1103
115 Ga0496125_0283853 3300048928 Bacteria 1024
116 Ga0501031_0000036 3300049568 Bacteria 73760
117 Ga0501031_0014094 3300049568 Bacteria 5202
118 Ga0501031_0024140 3300049568 Bacteria 3963
119 Ga0501031_0102816 3300049568 Bacteria 1864
120 Ga0501031_0467018 3300049568 Bacteria 815
121 Ga0501032_0000075 3300049569 Bacteria 84153
122 Ga0501032_0000100 3300049569 Bacteria 73505
123 Ga0501032_0003439 3300049569 Bacteria 12122
124 Ga0501032_0056318 3300049569 Bacteria 2643
125 Ga0501032_0057824 3300049569 Bacteria 2604
126 Ga0501033_0000088 3300049570 Bacteria 87638
127 Ga0501033_0002694 3300049570 Bacteria 14890
128 Ga0501033_0002727 3300049570 Bacteria 14814
129 Ga0501033_0003388 3300049570 Bacteria 13152
130 Ga0501033_0022697 3300049570 Bacteria 4732
131 Ga0501033_0039559 3300049570 Bacteria 3522
132 Ga0501033_0234786 3300049570 Bacteria 1302
133 Ga0501033_0400506 3300049570 Bacteria 957
134 Ga0501034_0000397 3300049571 Bacteria 73511
135 Ga0501034_0000476 3300049571 Bacteria 65960
136 Ga0501034_0004618 3300049571 Bacteria 15265
137 Ga0501034_0038991 3300049571 Bacteria 4812
138 Ga0501034_0040617 3300049571 Bacteria 4708
139 Ga0501034_0087806 3300049571 Bacteria 3109
140 Ga0501034_0141039 3300049571 Bacteria 2389
141 Ga0501034_0406608 3300049571 Bacteria 1283
142 Ga0501034_0529917 3300049571 Bacteria 1089
143 Ga0501036_0000056 3300049572 Bacteria 73511
144 Ga0501036_0000398 3300049572 Bacteria 30616
145 Ga0501036_0029729 3300049572 Bacteria 4616
146 Ga0501036_0036766 3300049572 Bacteria 4143
147 Ga0501036_0185399 3300049572 Bacteria 1751
148 Ga0501037_0000021 3300049573 Bacteria 150037
149 Ga0501037_0000119 3300049573 Bacteria 73510
150 Ga0501037_0000181 3300049573 Bacteria 58438
151 Ga0501037_0019946 3300049573 Bacteria 4947
152 Ga0501037_0079478 3300049573 Bacteria 2380
153 Ga0501037_0306890 3300049573 Bacteria 1101
154 Ga0501038_0000032 3300049574 Bacteria 131432
155 Ga0501038_0000098 3300049574 Bacteria 73471
156 Ga0501038_0086725 3300049574 Bacteria 2629
157 Ga0501038_0087277 3300049574 Bacteria 2620
158 Ga0501038_0356858 3300049574 Unclassified 1137
159 Ga0501039_0000013 3300049575 Bacteria 234418
160 Ga0501039_0000025 3300049575 Bacteria 152236
161 Ga0501039_0014917 3300049575 Bacteria 5942
162 Ga0501040_0004362 3300049576 Bacteria 9195
163 Ga0501042_0115526 3300049578 Bacteria 1932
164 Ga0501043_0000008 3300049579 Bacteria 223654
165 Ga0501043_0000570 3300049579 Bacteria 32944
166 Ga0501043_0001191 3300049579 Bacteria 22880
167 Ga0501043_0076495 3300049579 Bacteria 2629
168 Ga0501043_0086695 3300049579 Bacteria 2460
169 Ga0501043_0108330 3300049579 Bacteria 2182
170 Ga0501043_0209512 3300049579 Bacteria 1511
171 Ga0501043_0242415 3300049579 Bacteria 1390
172 Ga0501046_0012624 3300049580 Bacteria 7182
173 Ga0501046_0101737 3300049580 Bacteria 2204
174 Ga0501046_0108746 3300049580 Bacteria 2120
175 Ga0501046_0116593 3300049580 Bacteria 2035
176 Ga0501047_0001349 3300049581 Bacteria 24106
177 Ga0501047_0007010 3300049581 Bacteria 10579
178 Ga0501047_0010484 3300049581 Bacteria 8772
179 Ga0501047_0031799 3300049581 Bacteria 5091
180 Ga0501047_0060351 3300049581 Bacteria 3660
181 Ga0501047_0071994 3300049581 Bacteria 3327
182 Ga0501047_0179839 3300049581 Bacteria 1981
183 Ga0501047_0481769 3300049581 Bacteria 1068
184 Ga0501047_0512096 3300049581 Bacteria 1026
185 Ga0501047_0521144 3300049581 Bacteria 1014
186 Ga0501048_0009254 3300049582 Bacteria 7401
187 Ga0501067_0010410 3300049583 Bacteria 5147
188 Ga0501067_0068759 3300049583 Bacteria 1961
189 Ga0501067_0133766 3300049583 Bacteria 1380
190 Ga0501067_0206970 3300049583 Bacteria 1093
191 Ga0501068_0032028 3300049584 Bacteria 3125
192 Ga0501069_0000028 3300049585 Bacteria 106038
193 Ga0501069_0025131 3300049585 Bacteria 3253
194 Ga0501069_0026962 3300049585 Bacteria 3148
195 Ga0501069_0031794 3300049585 Bacteria 2904
196 Ga0501070_0000208 3300049586 Bacteria 55386
197 Ga0501070_0000264 3300049586 Bacteria 49510
198 Ga0501070_0000476 3300049586 Bacteria 36484
199 Ga0501070_0015604 3300049586 Bacteria 6388
200 Ga0501070_0018003 3300049586 Bacteria 5927
201 Ga0501070_0055721 3300049586 Bacteria 3277
202 Ga0501070_0168849 3300049586 Bacteria 1802
203 Ga0501071_0041485 3300049587 Bacteria 3296
204 Ga0501073_0006821 3300049589 Bacteria 8492
205 Ga0501073_0019496 3300049589 Bacteria 4896
206 Ga0501073_0051508 3300049589 Bacteria 2884
207 Ga0501073_0146649 3300049589 Bacteria 1635
208 Ga0501073_0224618 3300049589 Bacteria 1297
209 Ga0501074_0000016 3300049590 Bacteria 78666
210 Ga0501074_0015420 3300049590 Bacteria 5554
211 Ga0501074_0019501 3300049590 Bacteria 4925
212 Ga0501074_0328574 3300049590 Bacteria 1086
213 Ga0501076_0052618 3300049592 Bacteria 3226
214 Ga0501079_0132076 3300049741 Bacteria 1943
215 Ga0501080_0000065 3300049742 Bacteria 69171
216 Ga0501080_0015563 3300049742 Bacteria 7014
217 Ga0501080_0039625 3300049742 Bacteria 4398
218 Ga0501080_0078454 3300049742 Bacteria 3071
219 Ga0501080_0091904 3300049742 Bacteria 2819
220 Ga0501080_0193458 3300049742 Bacteria 1869
221 Ga0501080_0404693 3300049742 Bacteria 1227
222 Ga0501083_0001363 3300049744 Bacteria 16565
223 Ga0501083_0053635 3300049744 Bacteria 2707
224 Ga0501083_0090827 3300049744 Bacteria 2017
225 Ga0501083_0371512 3300049744 Bacteria 930
226 Ga0501035_0000011 3300049822 Bacteria 305794
227 Ga0501035_0000053 3300049822 Bacteria 142860
228 Ga0501035_0000085 3300049822 Bacteria 116189
229 Ga0501035_0001564 3300049822 Bacteria 23277
230 Ga0501035_0001865 3300049822 Bacteria 21239
231 Ga0501035_0006304 3300049822 Bacteria 11149
232 Ga0501035_0032690 3300049822 Bacteria 4732
233 Ga0501035_0035643 3300049822 Bacteria 4514
234 Ga0501035_0046185 3300049822 Bacteria 3917
235 Ga0501035_0156111 3300049822 Bacteria 1978
236 Ga0501044_0000011 3300049823 Bacteria 257385
237 Ga0501044_0000214 3300049823 Bacteria 73483
238 Ga0501044_0003679 3300049823 Bacteria 17236
239 Ga0501044_0009668 3300049823 Bacteria 10490
240 Ga0501044_0013902 3300049823 Bacteria 8698
241 Ga0501044_0017825 3300049823 Bacteria 7617
242 Ga0501044_0040673 3300049823 Bacteria 4844
243 Ga0501044_0042796 3300049823 Bacteria 4708
244 Ga0501044_0127133 3300049823 Bacteria 2545
245 Ga0501044_0143692 3300049823 Bacteria 2373
246 Ga0501044_0203238 3300049823 Bacteria 1938
247 Ga0501044_0229762 3300049823 Bacteria 1803
248 Ga0501044_0698925 3300049823 Bacteria 900
249 Ga0501045_0129122 3300049824 Bacteria 1878
250 Ga0501045_0278099 3300049824 Bacteria 1246
251 nmdc:mga03683_25830_c1 3300050489 Bacteria 2311
252 nmdc:mga03n38_15816_c1 3300050490 Bacteria 2921
253 nmdc:mga00v17_341818_c1 3300050491 Bacteria 973
254 nmdc:mga00v17_5809_c2 3300050491 Bacteria 3850
255 nmdc:mga0yw44_100860_c1 3300050492 Bacteria 1839
256 nmdc:mga0yw44_130582_c1 3300050492 Bacteria 1626
257 nmdc:mga0yw44_313267_c1 3300050492 Bacteria 1053
258 nmdc:mga0yw44_72724_c1 3300050492 Bacteria 2138
259 nmdc:mga06z11_38734_c1 3300050494 Bacteria 2369
260 nmdc:mga06z11_69699_c1 3300050494 Bacteria 1857
261 nmdc:mga04h51_18024_c1 3300050495 Bacteria 2073
262 nmdc:mga07m45_10313_c1 3300050496 Bacteria 4875
263 nmdc:mga08y16_889424_c1 3300050511 Bacteria 877
264 Ga0500610_0016369 3300053079 Bacteria 3533
265 Ga0495655_0009512 3300053083 Bacteria 1888
266 Ga0500658_0078630 3300053134 Bacteria 1406
267 Ga0500568_0000093 3300053139 Bacteria 83403
268 Ga0500604_0017632 3300053151 Bacteria 1979
269 Ga0500616_0010028 3300053153 Bacteria 5695
270 Ga0500627_0024552 3300053158 Bacteria 2468
271 Ga0500627_0052447 3300053158 Bacteria 1780
272 Ga0500627_0097909 3300053158 Bacteria 1315
273 Ga0501082_0068200 3300060353 Bacteria 3063
274 2503201560 2503198000 Bacteria 6884444
275 2509113159 2508501123 Bacteria 6283661
276 2509367799 2509276018 Bacteria 6910194
277 2509396332 2509276022 Bacteria 6200534
278 2510315477 2510065059 Bacteria 6847884
279 2512931468 2512875016 Bacteria 6529530
280 2512959302 2512875024 Bacteria 7195110
281 2513612746 2513237090 Bacteria 7096802
282 2514033650 2513237164 Bacteria 7563725
283 2514420903 2513237305 Bacteria 7293571
284 2588517307 2588253730 Bacteria 6881675
285 2599936727 2599185301 Bacteria 6161860
286 2643771095 2643221550 Bacteria 4619371
287 2643794546 2643221555 Bacteria 3749717
288 2643984423 2643221595 Bacteria 6565519
289 2644153280 2643221627 Bacteria 6761570
290 2688598468 2687453392 Bacteria 6880454
291 2694632929 2693429783 Bacteria 7019804
292 2694636035 2693429784 Bacteria 7241525
293 2723575401 2721755686 Bacteria 7343952
294 2756675443 2756170246 Bacteria 7451806
295 2792749263 2791355123 Bacteria 8049106
296 2841739222 2841734538 Bacteria 6784580
297 2844007400 2844002411 Bacteria 7168230
298 2844013728 2844009547 Bacteria 6728125
299 2847675634 2847670302 Bacteria 6165597
300 2856319520 2856314179 Bacteria 6477897
301 2856323869 2856320880 Bacteria 7263508
302 2856330928 2856328259 Bacteria 6528202
303 2856340745 2856334872 Bacteria 7037011
304 2856357943 2856356410 Bacteria 6297484
305 2856369484 2856364286 Bacteria 6939991
306 2857351130 2857349434 Bacteria 7926032
307 2857370403 2857367948 Bacteria 6965560
308 2869169243 2869162929 Bacteria 6399702
309 2869235842 2869234852 Bacteria 6654993
310 2869246860 2869242130 Bacteria 6609239
311 2869260271 2869256925 Bacteria 6981691
312 2869266192 2869264136 Bacteria 6880765
313 2869284955 2869278585 Bacteria 7077053
314 2869286162 2869285874 Bacteria 6901219
315 2871434595 2871429161 Bacteria 6547891
316 2871440678 2871435913 Bacteria 6880295
317 2871454043 2871451962 Bacteria 7336357
318 2871460628 2871459585 Bacteria 6866887
319 2871467865 2871466892 Bacteria 6923287
320 2871480420 2871474448 Bacteria 6806570
321 2871482340 2871481445 Bacteria 6700002
322 2871494521 2871488783 Bacteria 6929816
323 2871501374 2871495908 Bacteria 6935695
324 2874114170 2874109183 Bacteria 6517025
325 2874122286 2874116593 Bacteria 6674494
326 2874135126 2874131515 Bacteria 6820270
327 2874145896 2874139085 Bacteria 7021506
328 2874149800 2874146452 Bacteria 7533118
329 2874158059 2874155637 Bacteria 6724144
330 2874167508 2874162495 Bacteria 6174670
331 2874169885 2874168670 Bacteria 8062617
332 2876368448 2876363079 Bacteria 6544991
333 2876370626 2876369609 Bacteria 6807521
334 2876383927 2876377896 Bacteria 6565995
335 2876389912 2876386047 Bacteria 6698674
336 2876398466 2876392853 Bacteria 6660880
337 2876406552 2876399893 Bacteria 6927900
338 2876412601 2876406927 Bacteria 6191900
339 2876416263 2876413966 Bacteria 6831344
340 2876426889 2876420981 Bacteria 6687741
341 2878040755 2878035449 Bacteria 6555736
342 2878745239 2878738818 Bacteria 7136951
343 2878751728 2878745973 Bacteria 6867388
344 2878758897 2878753008 Bacteria 6922523
345 2878765354 2878760144 Bacteria 6823465
346 2878773062 2878767105 Bacteria 6898628
347 2878788988 2878788777 Bacteria 6567085
348 2881151357 2881147464 Bacteria 7779814
349 2881155329 2881155292 Bacteria 6461656
350 2881167556 2881161766 Bacteria 7127907
351 2881849716 2881845957 Bacteria 6611900
352 2881858157 2881853255 Bacteria 6698367
353 2881865014 2881861095 Bacteria 7128710
354 2882636296 2882632389 Bacteria 8154593
355 2882917439 2882912400 Bacteria 6801539
356 2885309457 2885305155 Bacteria 7348390
357 2885317966 2885312484 Bacteria 6415165
358 2885324695 2885318864 Bacteria 6729568
359 2885330948 2885326080 Bacteria 7134805
360 2885341918 2885334103 Bacteria 7216818
361 2885354774 2885350715 Bacteria 6787678
362 2888339449 2888337043 Bacteria 6629336
363 2888355780 2888350351 Bacteria 7372807
364 2889010721 2889010040 Bacteria 6749192
365 2889017584 2889016732 Bacteria 6700763
366 2903451348 2903448605 Bacteria 7357801
367 2903503864 2903492973 Bacteria 13473544
368 2903504673 2903492973 Bacteria 13473544
369 2903527447 2903521522 Bacteria 6525694
370 2903533901 2903528002 Bacteria 6586099
371 2903546185 2903540706 Bacteria 7062119
372 2904665021 2904659560 Bacteria 6685615
373 2906314126 2906308376 Bacteria 6841989
374 2906327292 2906321335 Bacteria 6579571
375 2906355192 2906354277 Bacteria 6991324
376 2906366550 2906363423 Bacteria 6856682
377 2906378722 2906378014 Bacteria 6911440
378 2906391068 2906386501 Bacteria 5977019
379 2906400927 2906393657 Bacteria 6790866
380 2906405417 2906401398 Bacteria 6693206
381 2906414040 2906408224 Bacteria 6162342
382 2906420240 2906414383 Bacteria 6580790
383 2906434149 2906427513 Bacteria 6375796
384 2922136966 2922130491 Bacteria 7173936
385 2922174262 2922172374 Bacteria 6167644
386 2922182195 2922178524 Bacteria 6025201
387 2922186308 2922185730 Bacteria 7113964
388 2924715630 2924710171 Bacteria 6752351
389 2924723704 2924718760 Bacteria 6331356
390 2924736414 2924733363 Bacteria 7574837
391 2924743566 2924741084 Bacteria 6661321
392 2924749660 2924748358 Bacteria 6154725
393 2924764223 2924762789 Bacteria 6561353
394 2924783376 2924776078 Bacteria 7492003
395 2924789101 2924784321 Bacteria 7416538
396 2937815764 2937813078 Bacteria 7783518
397 2937838198 2937836603 Bacteria 6811263
398 2937853158 2937848649 Bacteria 6983481
399 2937866536 2937861824 Bacteria 6660327
400 2937875347 2937868953 Bacteria 6639878
401 2937882100 2937877337 Bacteria 7246526
402 2937978560 2937972304 Bacteria 7532020
403 2937985682 2937980651 Bacteria 6517427
404 2938000043 2937994558 Bacteria 7036190
405 2938017959 2938014810 Bacteria 6700592
406 2958040657 2958034702 Bacteria 6989922
407 2958056739 2958041894 Bacteria 13082850
408 2958064351 2958064165 Bacteria 7158582
409 2958078175 2958071322 Bacteria 6815895
410 2958089222 2958084443 Bacteria 7312792
411 2958096077 2958092219 Bacteria 6861151
412 2958104755 2958100919 Bacteria 6800575
413 2958113957 2958108152 Bacteria 6681128
414 2958124970 2958122699 Bacteria 7280457
415 2958130561 2958130278 Bacteria 6897202
416 2958137653 2958137437 Bacteria 6050276
417 2958147267 2958144490 Bacteria 6677056
418 2958162270 2958158011 Bacteria 6058449
419 2958170507 2958165035 Bacteria 6906348
420 2958173210 2958172287 Bacteria 6716688
421 2958184766 2958179912 Bacteria 6874908
422 2961082933 2961077736 Bacteria 7079850
423 2961120020 2961114664 Bacteria 6680456
424 2961141497 2961136820 Bacteria 6775228
425 2961168962 2961163497 Bacteria 6901077
426 2961176024 2961170736 Bacteria 7072258
427 2961187783 2961183825 Bacteria 6688536
428 2963647745 2963644680 Bacteria 6530403
429 2965024249 2965018300 Bacteria 6883036
430 2965031723 2965025482 Bacteria 6532201
431 2965037449 2965032056 Bacteria 6887443
432 2965044097 2965040258 Bacteria 6855979
433 2965053799 2965047637 Bacteria 6623551
434 2965091365 2965089291 Bacteria 6866420
435 2965122368 2965119406 Bacteria 6956431
436 2968001912 2967996073 Bacteria 6787468
437 2968009064 2968003550 Bacteria 6929263
438 2968018421 2968016561 Bacteria 7022047
439 2968090378 2968083720 Bacteria 7351627
440 2968116377 2968110612 Bacteria 6814636
441 2968120654 2968117919 Bacteria 6536078
442 2968146776 2968138860 Bacteria 6605449
443 2968177356 2968171901 Bacteria 6894245
444 2970471405 2970469710 Bacteria 6969209
445 2970491094 2970489779 Bacteria 6517260
446 2970508690 2970503327 Bacteria 7099517
447 2970514648 2970510686 Bacteria 7006402
448 2970535366 2970532167 Bacteria 6553173
449 2970552685 2970547951 Bacteria 6931819
450 2970560202 2970554993 Bacteria 6814252
451 2970599570 2970593180 Bacteria 7073582
452 2970625452 2970619444 Bacteria 6986144
453 2970630480 2970627176 Bacteria 6680862
454 2977827437 2977821940 Bacteria 6906439
455 2977832386 2977828996 Bacteria 7007971
456 2977845999 2977843712 Bacteria 6753583
457 2977853120 2977851361 Bacteria 6694324
458 2977876256 2977872689 Bacteria 7270173
459 2977898694 2977898635 Bacteria 6675551
460 2977910676 2977907340 Bacteria 6577984
461 2977921338 2977915119 Bacteria 6829656
462 2977924250 2977922695 Bacteria 6956781
463 2977939904 2977935797 Bacteria 6252826
464 2977942771 2977942078 Bacteria 7570577
465 2977952792 2977950692 Bacteria 6893264
466 2977977060 2977971508 Bacteria 7472917
467 2977992021 2977986579 Bacteria 6581278
468 2979712709 2979710463 Bacteria 6785254
469 2979746742 2979742915 Bacteria 7301278
470 2979769941 2979764755 Bacteria 6610066
471 2979775851 2979772303 Bacteria 6618277
472 2979796495 2979793036 Bacteria 6808957
473 2979811662 2979808191 Bacteria 7179355
474 2987638314 2987636660 Bacteria 8088555
475 2987645880 2987645492 Bacteria 6117018
476 2987655384 2987652177 Bacteria 6969023
477 2987664993 2987659509 Bacteria 6966464
478 2987669218 2987666974 Bacteria 6509233
479 2987677066 2987673487 Bacteria 6884027
480 2996339118 2996336353 Bacteria 5511628
481 2996350194 2996348954 Bacteria 7239054
482 2996393290 2996386984 Bacteria 6978667
483 3004168931 3004167301 Bacteria 8330599
484 3004194050 3004188549 Bacteria 6952365
485 3004199623 3004195979 Bacteria 6776956
486 3004205442 3004203850 Bacteria 7307914
487 3004215985 3004211236 Bacteria 7417683
488 3004223735 3004218560 Bacteria 7421728
489 3004238226 3004232784 Bacteria 6662140
490 3004242320 3004239961 Bacteria 6892290
491 3004252201 3004248173 Bacteria 6563236
492 3004274969 3004268573 Bacteria 7043476
493 3004276892 3004275668 Bacteria 7114440
494 3004295260 3004289098 Bacteria 6135450
495 637074570 637000159 Bacteria 7596297
496 649872994 649633066 Bacteria 6690028
497 8004301578 8004300914 Bacteria 6132239
498 8004319034 8004312739 Bacteria 7444653
499 8004367145 8004361976 Bacteria 6858373
500 8004380418 8004374579 Bacteria 6898112
501 8004393616 8004387939 Bacteria 7049250
502 8004633632 8004633249 Bacteria 6723080
503 8004640793 8004640170 Bacteria 6723001
504 8004720384 8004714634 Bacteria 6776161
505 8004734078 8004727605 Bacteria 6643904
506 8055620805 8055617313 Bacteria 7548464
507 Ga0501070_0333470
508 JGI24740J21852_10007546
509 JGI24740J21852_10015712
510 JGI25157J39369_1000162
511 JGI25406J46586_10003959
512 JGI25406J46586_10017325
513 JGI25165J46597_1000015
514 Ga0055542_1001274
515 Ga0070658_10145058
516 Ga0070660_100065933
517 Ga0070668_100541932
518 Ga0070674_100108183
519 Ga0070659_100306836
520 Ga0068867_100038768
521 Ga0068867_100182333
522 Ga0068853_100255066
523 Ga0068853_100808506
524 Ga0070665_100208176
525 Ga0070665_100347906
526 Ga0070665_100719234
527 Ga0068855_100143285
528 Ga0068857_100424484
529 Ga0068852_100275106
530 Ga0081540_1046824
531 Ga0081539_10001091
532 Ga0075365_10017668
533 Ga0075365_10046393
534 Ga0075365_10060225
535 Ga0075365_10101257
536 Ga0075365_10456409
537 Ga0075368_10028907
538 Ga0075363_100022834
539 Ga0075363_100040728
540 Ga0075364_10021165
541 Ga0075364_10041910
542 Ga0075362_10180109
543 Ga0075367_10014851
544 Ga0075367_10014995
545 Ga0075367_10373606
546 Ga0075369_10237262
547 Ga0075370_10025706
548 Ga0105240_10055627
549 Ga0105240_10462562
550 Ga0111539_11015966
551 Ga0105243_10082552
552 Ga0105241_10015060
553 Ga0105241_10142483
554 Ga0105237_10023788
555 Ga0105237_10081959
556 Ga0105237_10124981
557 Ga0105238_10385074
558 Ga0105239_10031279
559 Ga0105239_10396445
560 Ga0105239_10526807
561 Ga0157369_10062986
562 Ga0157369_10070043
563 Ga0157369_10276440
564 Ga0157374_10111785
565 Ga0182008_10117909
566 Ga0182007_10089735
567 Ga0209026_1000025
568 Ga0209148_1000128
569 Ga0209759_1000121
570 Ga0209233_1000010
571 Ga0209455_1000127
572 Ga0207688_10195569
573 Ga0207647_10021793
574 Ga0207705_10192354
575 Ga0207654_10150926
576 Ga0207695_10612713
577 Ga0207671_10006286
578 Ga0207671_10049860
579 Ga0207657_10019042
580 Ga0207694_10008217
581 Ga0207694_10115610
582 Ga0207667_10182996
583 Ga0207667_10980535
584 Ga0207639_10019233
585 Ga0207639_10208337
586 Ga0207639_10590086
587 Ga0207678_10049926
588 Ga0207648_10030575
589 Ga0207648_10227229
590 Ga0207674_10257120
591 Ga0268266_10089812
592 Ga0268266_10230602
593 Ga0307515_10150072
594 Ga0307408_100118800
595 Ga0395899_0000117
596 Ga0395900_0000020
597 Ga0395900_0025530
598 Ga0395900_0438896
599 Ga0395900_0508381
600 Ga0395898_0000259
601 Ga0395898_0183561
602 Ga0395898_0236984
603 Ga0395898_0292099
604 Ga0395905_0000019
605 Ga0395905_0186432
606 Ga0395905_0231577
607 Ga0395901_0000016
608 Ga0395901_0065621
609 Ga0395901_0092910
610 Ga0395901_0195676
611 Ga0495668_0033359
612 Ga0495668_0058689
613 Ga0495625_0116255
614 Ga0495686_0219308
615 Ga0496115_0123180
616 Ga0496118_0029526
617 Ga0496119_0074625
618 Ga0496120_0001104
619 Ga0496121_0216195
620 Ga0496124_0323597
621 Ga0496125_0283853
622 Ga0501031_0000036
623 Ga0501031_0014094
624 Ga0501031_0024140
625 Ga0501031_0102816
626 Ga0501031_0467018
627 Ga0501032_0000075
628 Ga0501032_0000100
629 Ga0501032_0003439
630 Ga0501032_0056318
631 Ga0501032_0057824
632 Ga0501033_0000088
633 Ga0501033_0002694
634 Ga0501033_0002727
635 Ga0501033_0003388
636 Ga0501033_0022697
637 Ga0501033_0039559
638 Ga0501033_0234786
639 Ga0501033_0400506
640 Ga0501034_0000397
641 Ga0501034_0000476
642 Ga0501034_0004618
643 Ga0501034_0038991
644 Ga0501034_0040617
645 Ga0501034_0087806
646 Ga0501034_0141039
647 Ga0501034_0406608
648 Ga0501034_0529917
649 Ga0501036_0000056
650 Ga0501036_0000398
651 Ga0501036_0029729
652 Ga0501036_0036766
653 Ga0501036_0185399
654 Ga0501037_0000021
655 Ga0501037_0000119
656 Ga0501037_0000181
657 Ga0501037_0019946
658 Ga0501037_0079478
659 Ga0501037_0306890
660 Ga0501038_0000032
661 Ga0501038_0000098
662 Ga0501038_0086725
663 Ga0501038_0087277
664 Ga0501038_0356858
665 Ga0501039_0000013
666 Ga0501039_0000025
667 Ga0501039_0014917
668 Ga0501040_0004362
669 Ga0501042_0115526
670 Ga0501043_0000008
671 Ga0501043_0000570
672 Ga0501043_0001191
673 Ga0501043_0076495
674 Ga0501043_0086695
675 Ga0501043_0108330
676 Ga0501043_0209512
677 Ga0501043_0242415
678 Ga0501046_0012624
679 Ga0501046_0101737
680 Ga0501046_0108746
681 Ga0501046_0116593
682 Ga0501047_0001349
683 Ga0501047_0007010
684 Ga0501047_0010484
685 Ga0501047_0031799
686 Ga0501047_0060351
687 Ga0501047_0071994
688 Ga0501047_0179839
689 Ga0501047_0481769
690 Ga0501047_0512096
691 Ga0501047_0521144
692 Ga0501048_0009254
693 Ga0501067_0010410
694 Ga0501067_0068759
695 Ga0501067_0133766
696 Ga0501067_0206970
697 Ga0501068_0032028
698 Ga0501069_0000028
699 Ga0501069_0025131
700 Ga0501069_0026962
701 Ga0501069_0031794
702 Ga0501070_0000208
703 Ga0501070_0000264
704 Ga0501070_0000476
705 Ga0501070_0015604
706 Ga0501070_0018003
707 Ga0501070_0055721
708 Ga0501070_0168849
709 Ga0501071_0041485
710 Ga0501073_0006821
711 Ga0501073_0019496
712 Ga0501073_0051508
713 Ga0501073_0146649
714 Ga0501073_0224618
715 Ga0501074_0000016
716 Ga0501074_0015420
717 Ga0501074_0019501
718 Ga0501074_0328574
719 Ga0501076_0052618
720 Ga0501079_0132076
721 Ga0501080_0000065
722 Ga0501080_0015563
723 Ga0501080_0039625
724 Ga0501080_0078454
725 Ga0501080_0091904
726 Ga0501080_0193458
727 Ga0501080_0404693
728 Ga0501083_0001363
729 Ga0501083_0053635
730 Ga0501083_0090827
731 Ga0501083_0371512
732 Ga0501035_0000011
733 Ga0501035_0000053
734 Ga0501035_0000085
735 Ga0501035_0001564
736 Ga0501035_0001865
737 Ga0501035_0006304
738 Ga0501035_0032690
739 Ga0501035_0035643
740 Ga0501035_0046185
741 Ga0501035_0156111
742 Ga0501044_0000011
743 Ga0501044_0000214
744 Ga0501044_0003679
745 Ga0501044_0009668
746 Ga0501044_0013902
747 Ga0501044_0017825
748 Ga0501044_0040673
749 Ga0501044_0042796
750 Ga0501044_0127133
751 Ga0501044_0143692
752 Ga0501044_0203238
753 Ga0501044_0229762
754 Ga0501044_0698925
755 Ga0501045_0129122
756 Ga0501045_0278099
757 nmdc:mga03683_25830_c1
758 nmdc:mga03n38_15816_c1
759 nmdc:mga00v17_341818_c1
760 nmdc:mga00v17_5809_c2
761 nmdc:mga0yw44_100860_c1
762 nmdc:mga0yw44_130582_c1
763 nmdc:mga0yw44_313267_c1
764 nmdc:mga0yw44_72724_c1
765 nmdc:mga06z11_38734_c1
766 nmdc:mga06z11_69699_c1
767 nmdc:mga04h51_18024_c1
768 nmdc:mga07m45_10313_c1
769 nmdc:mga08y16_889424_c1
770 Ga0500610_0016369
771 Ga0495655_0009512
772 Ga0500658_0078630
773 Ga0500568_0000093
774 Ga0500604_0017632
775 Ga0500616_0010028
776 Ga0500627_0024552
777 Ga0500627_0052447
778 Ga0500627_0097909
779 Ga0501082_0068200
780 2503201560
781 2509113159
782 2509367799
783 2509396332
784 2510315477
785 2512931468
786 2512959302
787 2513612746
788 2514033650
789 2514420903
790 2588517307
791 2599936727
792 2643771095
793 2643794546
794 2643984423
795 2644153280
796 2688598468
797 2694632929
798 2694636035
799 2723575401
800 2756675443
801 2792749263
802 2841739222
803 2844007400
804 2844013728
805 2847675634
806 2856319520
807 2856323869
808 2856330928
809 2856340745
810 2856357943
811 2856369484
812 2857351130
813 2857370403
814 2869169243
815 2869235842
816 2869246860
817 2869260271
818 2869266192
819 2869284955
820 2869286162
821 2871434595
822 2871440678
823 2871454043
824 2871460628
825 2871467865
826 2871480420
827 2871482340
828 2871494521
829 2871501374
830 2874114170
831 2874122286
832 2874135126
833 2874145896
834 2874149800
835 2874158059
836 2874167508
837 2874169885
838 2876368448
839 2876370626
840 2876383927
841 2876389912
842 2876398466
843 2876406552
844 2876412601
845 2876416263
846 2876426889
847 2878040755
848 2878745239
849 2878751728
850 2878758897
851 2878765354
852 2878773062
853 2878788988
854 2881151357
855 2881155329
856 2881167556
857 2881849716
858 2881858157
859 2881865014
860 2882636296
861 2882917439
862 2885309457
863 2885317966
864 2885324695
865 2885330948
866 2885341918
867 2885354774
868 2888339449
869 2888355780
870 2889010721
871 2889017584
872 2903451348
873 2903503864
874 2903504673
875 2903527447
876 2903533901
877 2903546185
878 2904665021
879 2906314126
880 2906327292
881 2906355192
882 2906366550
883 2906378722
884 2906391068
885 2906400927
886 2906405417
887 2906414040
888 2906420240
889 2906434149
890 2922136966
891 2922174262
892 2922182195
893 2922186308
894 2924715630
895 2924723704
896 2924736414
897 2924743566
898 2924749660
899 2924764223
900 2924783376
901 2924789101
902 2937815764
903 2937838198
904 2937853158
905 2937866536
906 2937875347
907 2937882100
908 2937978560
909 2937985682
910 2938000043
911 2938017959
912 2958040657
913 2958056739
914 2958064351
915 2958078175
916 2958089222
917 2958096077
918 2958104755
919 2958113957
920 2958124970
921 2958130561
922 2958137653
923 2958147267
924 2958162270
925 2958170507
926 2958173210
927 2958184766
928 2961082933
929 2961120020
930 2961141497
931 2961168962
932 2961176024
933 2961187783
934 2963647745
935 2965024249
936 2965031723
937 2965037449
938 2965044097
939 2965053799
940 2965091365
941 2965122368
942 2968001912
943 2968009064
944 2968018421
945 2968090378
946 2968116377
947 2968120654
948 2968146776
949 2968177356
950 2970471405
951 2970491094
952 2970508690
953 2970514648
954 2970535366
955 2970552685
956 2970560202
957 2970599570
958 2970625452
959 2970630480
960 2977827437
961 2977832386
962 2977845999
963 2977853120
964 2977876256
965 2977898694
966 2977910676
967 2977921338
968 2977924250
969 2977939904
970 2977942771
971 2977952792
972 2977977060
973 2977992021
974 2979712709
975 2979746742
976 2979769941
977 2979775851
978 2979796495
979 2979811662
980 2987638314
981 2987645880
982 2987655384
983 2987664993
984 2987669218
985 2987677066
986 2996339118
987 2996350194
988 2996393290
989 3004168931
990 3004194050
991 3004199623
992 3004205442
993 3004215985
994 3004223735
995 3004238226
996 3004242320
997 3004252201
998 3004274969
999 3004276892
1000 3004295260
1001 637074570
1002 649872994
1003 8004301578
1004 8004319034
1005 8004367145
1006 8004380418
1007 8004393616
1008 8004633632
1009 8004640793
1010 8004720384
1011 8004734078
1012 8055620805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01471

PG_binding_1

Putative peptidoglycan binding domain

186

242

0.97

PF01510

Amidase_2

N-acetylmuramoyl-L-alanine amidase

24

154

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tv7-assembly2.cif.gz_B 2.05 angstrom resolution crystal structure of peptidoglycan-binding protein from clostridioides difficile in complex with glutamine hydroxamate. 0.906 179 242
4xxt-assembly1.cif.gz_A crystal structure of fused zn-dependent amidase/peptidase/peptodoglycan-binding domain-containing protein from clostridium acetobutylicum atcc 824 0.8952 177 242
3bkv-assembly1.cif.gz_A x-ray structure of the bacteriophage phikz lytic transglycosylase, gp144, in complex with chitotetraose, (nag)4 0.8866 179 245
5nm7-assembly2.cif.gz_A crystal structure of burkholderia ap3 phage endolysin 0.8821 179 242
5nm7-assembly1.cif.gz_G crystal structure of burkholderia ap3 phage endolysin 0.8721 178 243
ID Description Score Start End Superfamily
4bxjB02 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.9028 192 248 1.10.101.10
3bkvA01 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.8866 179 245 1.10.101.10
4bxeB02 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.8833 192 251 1.10.101.10
af_P75820_43_192_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.8777 27 167 3.40.80.10
4bpaB01 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.8477 28 166 3.40.80.10
ID Description Score Start End GO Terms
AF-A0A3D5URL7-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.9961 181 250
AF-A0A3S2I6I8-F1-model_v4 deleted 0.9923 170 251
AF-A0A2W4NVM3-F1-model_v4 deleted 0.9923 164 251
AF-A0A3S2I6I8-F1-model_v4 deleted 0.9805 170 251
AF-A0A528FI17-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.9634 1 133 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0019867
GO:0071555

Map