F456629

General Info

Members Datasets Scaffolds Average Seq Length
507 214 1014 421

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100015958|Ga0068868_1000159582
Length 454
Sequence MPARGGHTRIVIPAGRVSRSEPLVGGIPQSKIRPLPCYIPFSVTDKKFHPWTALTLLTALNLLNYADRNVLFAVQPLVQQEFHINKEQIGYLTSVFLLCYMCAAPFVGPLADRYSRKMIIAVGAIFWSGLTLLTAVTHTYRELLVRHTLVGIGEATFVTIAPTFVADLFAESRRGRILGIFYLAIPVGSAAGYLLGGYLAPAHGWRFPFYIAAAPGFVLALTVFFLREPPRGQFDSLKETPERGTILGLARNPAFLCATLGMAMMTFSLGGLQAWMPQFLYSERHYSLEKANLYFGMIIVVDGILASLAGGWLGDFLLPRMKSSYYFVSAVSMAIGIPFMVLGLFVPGRMMIPAISIAAFFLLFNTSPLNAAVINSVGAHIRATALAVNIFIIHILGDVPSPTMMGRVADRHSLQSSFVLPVIAMGLSAAILFVGMRFAPAVQVDRKTAGVYSD

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
158 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.55
Rhizosphere 96.06
Stem 0
Stem Tuber 0
Unclassified 16.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100015958 3300005338 Bacteria 5568
2 LJNas_1000917 3300000546 Bacteria 4748
3 JGI24751J29686_10000832 3300002459 Bacteria 7135
4 rootH1_10317107 3300003323 Bacteria 2146
5 Ga0065715_10095678 3300005293 Bacteria 4020
6 Ga0070676_10002769 3300005328 Bacteria 9060
7 Ga0070676_10031985 3300005328 Bacteria 3011
8 Ga0070676_10043432 3300005328 Bacteria 2612
9 Ga0070683_100001749 3300005329 Bacteria 16917
10 Ga0070683_100018618 3300005329 Bacteria 6155
11 Ga0070683_100083942 3300005329 Bacteria 2984
12 Ga0070690_100016048 3300005330 Bacteria 4478
13 Ga0070670_100001284 3300005331 Bacteria 20024
14 Ga0068869_100002642 3300005334 Bacteria 10827
15 Ga0068869_100033428 3300005334 Bacteria 3630
16 Ga0068869_100034049 3300005334 Bacteria 3601
17 Ga0068869_100186118 3300005334 Bacteria 1630
18 Ga0070666_10005152 3300005335 Bacteria 8000
19 Ga0068868_100002662 3300005338 Bacteria 12391
20 Ga0068868_100005032 3300005338 Bacteria 9285
21 Ga0068868_100008528 3300005338 Bacteria 7338
22 Ga0068868_100013830 3300005338 Bacteria 5931
23 Ga0068868_100070425 3300005338 Unclassified 2788
24 Ga0070660_100005847 3300005339 Bacteria 8515
25 Ga0070687_100001260 3300005343 Bacteria 8806
26 Ga0070661_100019863 3300005344 Bacteria 4788
27 Ga0070668_100026117 3300005347 Bacteria 4429
28 Ga0070669_100005366 3300005353 Bacteria 9249
29 Ga0070675_100008975 3300005354 Bacteria 7765
30 Ga0070673_100011817 3300005364 Bacteria 5975
31 Ga0070673_100056768 3300005364 Unclassified 3090
32 Ga0070688_100002092 3300005365 Bacteria 10082
33 Ga0070659_100045029 3300005366 Bacteria 3456
34 Ga0070709_10009490 3300005434 Bacteria 5370
35 Ga0070709_10010335 3300005434 Bacteria 5165
36 Ga0070709_10014494 3300005434 Bacteria 4459
37 Ga0070714_100004856 3300005435 Bacteria 10205
38 Ga0070714_100007417 3300005435 Bacteria 8533
39 Ga0070714_100007652 3300005435 Bacteria 8414
40 Ga0070714_100079159 3300005435 Unclassified 2857
41 Ga0070713_100000565 3300005436 Bacteria 23443
42 Ga0070713_100007816 3300005436 Bacteria 7539
43 Ga0070713_100008421 3300005436 Bacteria 7312
44 Ga0070713_100028839 3300005436 Unclassified 4386
45 Ga0070713_100043551 3300005436 Unclassified 3670
46 Ga0070713_100052174 3300005436 Unclassified 3385
47 Ga0070713_100069750 3300005436 Unclassified 2965
48 Ga0070713_100116496 3300005436 Bacteria 2337
49 Ga0070713_100136014 3300005436 Bacteria 2171
50 Ga0070713_100180996 3300005436 Bacteria 1894
51 Ga0070711_100000134 3300005439 Bacteria 39588
52 Ga0070711_100024156 3300005439 Unclassified 3961
53 Ga0070708_100002249 3300005445 Bacteria 14927
54 Ga0070708_100003123 3300005445 Bacteria 12899
55 Ga0070708_100031369 3300005445 Bacteria 4599
56 Ga0070708_100032203 3300005445 Bacteria 4545
57 Ga0070708_100040535 3300005445 Unclassified 4078
58 Ga0070708_100059796 3300005445 Bacteria 3398
59 Ga0070708_100171882 3300005445 Bacteria 2023
60 Ga0070708_100259747 3300005445 Bacteria 1633
61 Ga0070663_100002508 3300005455 Bacteria 10357
62 Ga0070663_100043996 3300005455 Bacteria 3145
63 Ga0070678_100006017 3300005456 Bacteria 7074
64 Ga0070678_100056594 3300005456 Bacteria 2869
65 Ga0070678_100085729 3300005456 Bacteria 2401
66 Ga0070662_100005006 3300005457 Bacteria 8428
67 Ga0070662_100011758 3300005457 Bacteria 5781
68 Ga0070681_10021022 3300005458 Bacteria 6539
69 Ga0070681_10021670 3300005458 Bacteria 6444
70 Ga0070681_10051511 3300005458 Bacteria 4106
71 Ga0070706_100002012 3300005467 Bacteria 20871
72 Ga0070706_100004231 3300005467 Bacteria 13930
73 Ga0070706_100032973 3300005467 Bacteria 4779
74 Ga0070706_100052831 3300005467 Unclassified 3750
75 Ga0070706_100069012 3300005467 Unclassified 3269
76 Ga0070707_100002271 3300005468 Bacteria 18359
77 Ga0070707_100011400 3300005468 Bacteria 8290
78 Ga0070707_100028349 3300005468 Bacteria 5329
79 Ga0070707_100038047 3300005468 Bacteria 4594
80 Ga0070707_100246625 3300005468 Unclassified 1738
81 Ga0070698_100003753 3300005471 Bacteria 16708
82 Ga0070698_100024517 3300005471 Bacteria 6294
83 Ga0070698_100140536 3300005471 Unclassified 2366
84 Ga0070699_100028274 3300005518 Bacteria 4836
85 Ga0070699_100062594 3300005518 Bacteria 3225
86 Ga0070699_100078274 3300005518 Unclassified 2880
87 Ga0070699_100112950 3300005518 Unclassified 2386
88 Ga0070679_100007414 3300005530 Bacteria 10251
89 Ga0070679_100009247 3300005530 Bacteria 9314
90 Ga0070679_100126681 3300005530 Bacteria 2536
91 Ga0070684_100008745 3300005535 Bacteria 7939
92 Ga0070684_100049012 3300005535 Bacteria 3665
93 Ga0070697_100000215 3300005536 Bacteria 47439
94 Ga0070697_100000848 3300005536 Bacteria 23001
95 Ga0070697_100004644 3300005536 Bacteria 10537
96 Ga0070697_100009373 3300005536 Bacteria 7650
97 Ga0070697_100040092 3300005536 Unclassified 3788
98 Ga0070697_100145025 3300005536 Bacteria 1998
99 Ga0070697_100149823 3300005536 Bacteria 1966
100 Ga0068853_100008281 3300005539 Bacteria 8346
101 Ga0068853_100078957 3300005539 Bacteria 2877
102 Ga0070672_100011458 3300005543 Bacteria 6184
103 Ga0070686_100000892 3300005544 Bacteria 17330
104 Ga0070693_100013832 3300005547 Unclassified 4120
105 Ga0070665_100013064 3300005548 Bacteria 8360
106 Ga0068855_100000952 3300005563 Bacteria 36034
107 Ga0068855_100006023 3300005563 Bacteria 14793
108 Ga0068855_100049450 3300005563 Bacteria 4959
109 Ga0068855_100108777 3300005563 Bacteria 3184
110 Ga0070664_100003651 3300005564 Bacteria 12390
111 Ga0070664_100006385 3300005564 Bacteria 9509
112 Ga0068857_100000113 3300005577 Bacteria 48281
113 Ga0068857_100000303 3300005577 Bacteria 34068
114 Ga0068857_100000432 3300005577 Bacteria 29617
115 Ga0068857_100063749 3300005577 Bacteria 3276
116 Ga0068854_100005351 3300005578 Bacteria 8105
117 Ga0068856_100000096 3300005614 Bacteria 83677
118 Ga0068856_100000243 3300005614 Bacteria 59277
119 Ga0068856_100000305 3300005614 Bacteria 53825
120 Ga0068856_100001638 3300005614 Bacteria 23459
121 Ga0068856_100005323 3300005614 Bacteria 12703
122 Ga0068856_100014374 3300005614 Bacteria 7652
123 Ga0068856_100016592 3300005614 Bacteria 7129
124 Ga0068856_100082151 3300005614 Unclassified 3197
125 Ga0068856_100151247 3300005614 Bacteria 2330
126 Ga0068856_100161685 3300005614 Unclassified 2250
127 Ga0070702_100061090 3300005615 Unclassified 2193
128 Ga0068852_100001876 3300005616 Bacteria 14304
129 Ga0068852_100020566 3300005616 Bacteria 5250
130 Ga0068859_100002165 3300005617 Bacteria 19967
131 Ga0068859_100017145 3300005617 Bacteria 7274
132 Ga0068859_100020528 3300005617 Bacteria 6629
133 Ga0068864_100006643 3300005618 Bacteria 9471
134 Ga0068864_100026654 3300005618 Unclassified 4873
135 Ga0068864_100051751 3300005618 Bacteria 3539
136 Ga0068866_10007977 3300005718 Unclassified 4446
137 Ga0068866_10011241 3300005718 Bacteria 3866
138 Ga0068861_100007617 3300005719 Bacteria 7429
139 Ga0068851_10003901 3300005834 Bacteria 6678
140 Ga0068870_10003052 3300005840 Bacteria 7052
141 Ga0068863_100023053 3300005841 Bacteria 5949
142 Ga0068863_100028316 3300005841 Bacteria 5349
143 Ga0068863_100039765 3300005841 Unclassified 4473
144 Ga0068863_100050073 3300005841 Bacteria 3961
145 Ga0068863_100080970 3300005841 Bacteria 3076
146 Ga0068863_100094221 3300005841 Bacteria 2842
147 Ga0068858_100010774 3300005842 Bacteria 8645
148 Ga0068858_100056794 3300005842 Bacteria 3617
149 Ga0068858_100071211 3300005842 Bacteria 3224
150 Ga0068860_100019202 3300005843 Bacteria 6635
151 Ga0068860_100020951 3300005843 Bacteria 6334
152 Ga0068860_100102410 3300005843 Unclassified 2732
153 Ga0068862_100013954 3300005844 Bacteria 6661
154 Ga0081455_10036729 3300005937 Unclassified 4358
155 Ga0081540_1033174 3300005983 Unclassified 2808
156 Ga0081540_1076520 3300005983 Bacteria 1524
157 Ga0070717_10000272 3300006028 Bacteria 35378
158 Ga0070717_10000742 3300006028 Bacteria 21257
159 Ga0070717_10003353 3300006028 Bacteria 11437
160 Ga0070717_10010042 3300006028 Bacteria 7127
161 Ga0070717_10010634 3300006028 Bacteria 6955
162 Ga0070717_10041014 3300006028 Unclassified 3773
163 Ga0070717_10049789 3300006028 Unclassified 3441
164 Ga0070717_10050110 3300006028 Unclassified 3430
165 Ga0070717_10055111 3300006028 Bacteria 3280
166 Ga0070717_10058130 3300006028 Bacteria 3198
167 Ga0070717_10147833 3300006028 Bacteria 2031
168 Ga0070715_10042133 3300006163 Bacteria 1917
169 Ga0070715_10081570 3300006163 Bacteria 1469
170 Ga0070716_100006887 3300006173 Bacteria 5572
171 Ga0070716_100019633 3300006173 Unclassified 3534
172 Ga0070716_100042920 3300006173 Bacteria 2526
173 Ga0070712_100001320 3300006175 Bacteria 15024
174 Ga0070712_100002354 3300006175 Bacteria 11640
175 Ga0070712_100206053 3300006175 Bacteria 1548
176 Ga0097621_100000022 3300006237 Bacteria 85005
177 Ga0097621_100011427 3300006237 Bacteria 6538
178 Ga0097621_100038451 3300006237 Bacteria 3840
179 Ga0097621_100040347 3300006237 Bacteria 3753
180 Ga0068871_100000401 3300006358 Bacteria 30136
181 Ga0068871_100001873 3300006358 Bacteria 14228
182 Ga0075433_10034785 3300006852 Unclassified 4329
183 Ga0075433_10056772 3300006852 Bacteria 3421
184 Ga0075434_100001721 3300006871 Bacteria 18763
185 Ga0075434_100088092 3300006871 Bacteria 3105
186 Ga0075434_100094356 3300006871 Bacteria 2997
187 Ga0075434_100249481 3300006871 Bacteria 1794
188 Ga0068865_100004485 3300006881 Bacteria 8424
189 Ga0075436_100000403 3300006914 Bacteria 27858
190 Ga0097620_100002165 3300006931 Bacteria 19967
191 Ga0097620_100017145 3300006931 Bacteria 7274
192 Ga0097620_100020528 3300006931 Bacteria 6629
193 Ga0075435_100003080 3300007076 Bacteria 11251
194 Ga0075435_100004660 3300007076 Bacteria 9449
195 Ga0099795_10009246 3300007788 Bacteria 2850
196 Ga0105240_10017033 3300009093 Bacteria 9816
197 Ga0105240_10020886 3300009093 Bacteria 8721
198 Ga0105240_10075769 3300009093 Bacteria 4149
199 Ga0105245_10025894 3300009098 Bacteria 5160
200 Ga0105245_10086168 3300009098 Unclassified 2880
201 Ga0105245_10212885 3300009098 Bacteria 1861
202 Ga0105247_10002146 3300009101 Bacteria 13625
203 Ga0105247_10017217 3300009101 Bacteria 4337
204 Ga0105241_10002355 3300009174 Bacteria 14187
205 Ga0105241_10010279 3300009174 Bacteria 6873
206 Ga0105241_10013886 3300009174 Bacteria 5901
207 Ga0105242_10008947 3300009176 Bacteria 7685
208 Ga0105242_10016910 3300009176 Bacteria 5676
209 Ga0105248_10013122 3300009177 Bacteria 9124
210 Ga0105248_10130159 3300009177 Unclassified 2839
211 Ga0105248_10186026 3300009177 Bacteria 2341
212 Ga0105237_10013929 3300009545 Unclassified 8414
213 Ga0105237_10042500 3300009545 Bacteria 4583
214 Ga0105237_10262892 3300009545 Unclassified 1728
215 Ga0105238_10000644 3300009551 Bacteria 36743
216 Ga0105238_10121540 3300009551 Unclassified 2591
217 Ga0105238_10309138 3300009551 Unclassified 1565
218 Ga0105249_10069871 3300009553 Bacteria 3242
219 Ga0105249_10127382 3300009553 Bacteria 2426
220 Ga0099796_10011455 3300010159 Bacteria 2475
221 Ga0105239_10017386 3300010375 Bacteria 7955
222 Ga0105239_10025325 3300010375 Bacteria 6533
223 Ga0105246_10002089 3300011119 Unclassified 12031
224 Ga0105246_10131431 3300011119 Unclassified 1870
225 Ga0157373_10002901 3300013100 Bacteria 12981
226 Ga0157373_10006728 3300013100 Bacteria 8560
227 Ga0157373_10027667 3300013100 Bacteria 4091
228 Ga0157371_10005320 3300013102 Bacteria 10892
229 Ga0157371_10026169 3300013102 Bacteria 4242
230 Ga0157371_10107589 3300013102 Unclassified 1979
231 Ga0157369_10000034 3300013105 Bacteria 200710
232 Ga0157369_10026089 3300013105 Bacteria 6483
233 Ga0157369_10067771 3300013105 Unclassified 3835
234 Ga0157369_10100759 3300013105 Unclassified 3079
235 Ga0157369_10102830 3300013105 Bacteria 3043
236 Ga0157369_10215338 3300013105 Bacteria 2012
237 Ga0157369_10327220 3300013105 Unclassified 1593
238 Ga0157374_10000052 3300013296 Bacteria 125138
239 Ga0157374_10001074 3300013296 Bacteria 23713
240 Ga0157374_10001307 3300013296 Bacteria 21210
241 Ga0157374_10013402 3300013296 Bacteria 7157
242 Ga0157374_10014497 3300013296 Bacteria 6897
243 Ga0157374_10043878 3300013296 Bacteria 4131
244 Ga0157374_10273437 3300013296 Bacteria 1666
245 Ga0157378_10000227 3300013297 Bacteria 54885
246 Ga0157378_10005197 3300013297 Bacteria 11424
247 Ga0157378_10023112 3300013297 Bacteria 5471
248 Ga0163162_10013250 3300013306 Bacteria 8052
249 Ga0163162_10016006 3300013306 Bacteria 7331
250 Ga0157372_10001472 3300013307 Bacteria 25548
251 Ga0157372_10003253 3300013307 Bacteria 17560
252 Ga0157372_10003823 3300013307 Bacteria 16183
253 Ga0157372_10005010 3300013307 Bacteria 14071
254 Ga0157372_10006509 3300013307 Bacteria 12436
255 Ga0157372_10011754 3300013307 Bacteria 9323
256 Ga0157372_10017766 3300013307 Bacteria 7635
257 Ga0157372_10021350 3300013307 Bacteria 6995
258 Ga0157372_10044067 3300013307 Bacteria 4943
259 Ga0157372_10207289 3300013307 Unclassified 2271
260 Ga0157375_10011227 3300013308 Bacteria 7903
261 Ga0157375_10072944 3300013308 Bacteria 3450
262 Ga0163163_10002887 3300014325 Bacteria 14528
263 Ga0163163_10118621 3300014325 Bacteria 2678
264 Ga0163163_10158425 3300014325 Unclassified 2309
265 Ga0182008_10008915 3300014497 Bacteria 5440
266 Ga0157377_10017482 3300014745 Bacteria 3709
267 Ga0157379_10001079 3300014968 Bacteria 22250
268 Ga0157379_10014042 3300014968 Bacteria 7018
269 Ga0157379_10022066 3300014968 Bacteria 5642
270 Ga0157376_10002189 3300014969 Bacteria 13169
271 Ga0157376_10020200 3300014969 Bacteria 5148
272 Ga0157376_10023457 3300014969 Unclassified 4828
273 Ga0157376_10074273 3300014969 Bacteria 2898
274 Ga0163161_10000865 3300017792 Bacteria 23563
275 Ga0228598_1001812 3300024227 Bacteria 4657
276 Ga0228598_1002449 3300024227 Bacteria 4046
277 Ga0207697_10004240 3300025315 Bacteria 6889
278 Ga0207656_10017402 3300025321 Bacteria 2815
279 Ga0207656_10056708 3300025321 Unclassified 1708
280 Ga0207682_10009207 3300025893 Unclassified 3900
281 Ga0207692_10006341 3300025898 Bacteria 4795
282 Ga0207642_10006134 3300025899 Bacteria 3977
283 Ga0207642_10106463 3300025899 Unclassified 1419
284 Ga0207688_10000776 3300025901 Bacteria 15893
285 Ga0207680_10024692 3300025903 Unclassified 3303
286 Ga0207647_10002181 3300025904 Bacteria 14929
287 Ga0207647_10005256 3300025904 Bacteria 9529
288 Ga0207685_10029801 3300025905 Bacteria 1936
289 Ga0207699_10014416 3300025906 Bacteria 4075
290 Ga0207699_10017819 3300025906 Bacteria 3749
291 Ga0207699_10032195 3300025906 Unclassified 2953
292 Ga0207699_10084181 3300025906 Unclassified 1980
293 Ga0207645_10000073 3300025907 Bacteria 71786
294 Ga0207645_10037820 3300025907 Bacteria 3097
295 Ga0207643_10001320 3300025908 Bacteria 14375
296 Ga0207684_10000426 3300025910 Bacteria 56031
297 Ga0207684_10002508 3300025910 Bacteria 18472
298 Ga0207654_10008789 3300025911 Bacteria 5124
299 Ga0207654_10081580 3300025911 Unclassified 1948
300 Ga0207707_10000496 3300025912 Bacteria 40443
301 Ga0207707_10022459 3300025912 Bacteria 5515
302 Ga0207707_10034929 3300025912 Bacteria 4397
303 Ga0207707_10039329 3300025912 Bacteria 4135
304 Ga0207707_10135497 3300025912 Unclassified 2153
305 Ga0207695_10030643 3300025913 Bacteria 5918
306 Ga0207695_10052926 3300025913 Bacteria 4249
307 Ga0207695_10064346 3300025913 Unclassified 3777
308 Ga0207693_10000010 3300025915 Bacteria 162031
309 Ga0207693_10000096 3300025915 Bacteria 78447
310 Ga0207693_10059829 3300025915 Bacteria 2984
311 Ga0207663_10005280 3300025916 Bacteria 6504
312 Ga0207660_10001478 3300025917 Bacteria 15818
313 Ga0207662_10003418 3300025918 Bacteria 8170
314 Ga0207657_10000321 3300025919 Bacteria 51030
315 Ga0207657_10000379 3300025919 Bacteria 47118
316 Ga0207649_10000727 3300025920 Bacteria 21654
317 Ga0207649_10014973 3300025920 Unclassified 4353
318 Ga0207652_10003101 3300025921 Bacteria 13852
319 Ga0207652_10003223 3300025921 Bacteria 13560
320 Ga0207646_10000614 3300025922 Bacteria 46404
321 Ga0207646_10030097 3300025922 Unclassified 4924
322 Ga0207646_10082581 3300025922 Bacteria 2873
323 Ga0207646_10144230 3300025922 Bacteria 2145
324 Ga0207681_10003920 3300025923 Bacteria 9227
325 Ga0207694_10000250 3300025924 Bacteria 51411
326 Ga0207650_10000045 3300025925 Bacteria 181507
327 Ga0207650_10010630 3300025925 Bacteria 6321
328 Ga0207687_10088400 3300025927 Bacteria 2254
329 Ga0207700_10000772 3300025928 Bacteria 18453
330 Ga0207700_10013578 3300025928 Bacteria 5306
331 Ga0207700_10014185 3300025928 Bacteria 5214
332 Ga0207700_10033064 3300025928 Bacteria 3697
333 Ga0207700_10069846 3300025928 Bacteria 2698
334 Ga0207700_10089601 3300025928 Unclassified 2425
335 Ga0207700_10194380 3300025928 Bacteria 1706
336 Ga0207700_10201258 3300025928 Bacteria 1678
337 Ga0207664_10003719 3300025929 Bacteria 10236
338 Ga0207664_10023044 3300025929 Bacteria 4660
339 Ga0207664_10165583 3300025929 Bacteria 1888
340 Ga0207690_10071209 3300025932 Unclassified 2397
341 Ga0207706_10000213 3300025933 Bacteria 63821
342 Ga0207706_10000370 3300025933 Bacteria 48701
343 Ga0207670_10101036 3300025936 Bacteria 2060
344 Ga0207704_10035755 3300025938 Unclassified 2850
345 Ga0207704_10049686 3300025938 Bacteria 2525
346 Ga0207704_10153428 3300025938 Bacteria 1628
347 Ga0207665_10001655 3300025939 Bacteria 14995
348 Ga0207665_10026997 3300025939 Unclassified 3792
349 Ga0207665_10105519 3300025939 Unclassified 1973
350 Ga0207691_10000151 3300025940 Bacteria 64391
351 Ga0207711_10013070 3300025941 Bacteria 6896
352 Ga0207689_10000129 3300025942 Bacteria 63859
353 Ga0207689_10015289 3300025942 Bacteria 6496
354 Ga0207689_10038118 3300025942 Bacteria 3982
355 Ga0207689_10064418 3300025942 Bacteria 3016
356 Ga0207689_10214067 3300025942 Bacteria 1592
357 Ga0207661_10000099 3300025944 Bacteria 54986
358 Ga0207679_10000096 3300025945 Bacteria 76971
359 Ga0207679_10022760 3300025945 Unclassified 4272
360 Ga0207667_10000996 3300025949 Bacteria 36261
361 Ga0207667_10007025 3300025949 Bacteria 13599
362 Ga0207667_10076786 3300025949 Bacteria 3466
363 Ga0207651_10000745 3300025960 Unclassified 13950
364 Ga0207651_10109635 3300025960 Bacteria 2069
365 Ga0207712_10267606 3300025961 Unclassified 1389
366 Ga0207640_10006153 3300025981 Bacteria 6569
367 Ga0207640_10047744 3300025981 Bacteria 2763
368 Ga0207658_10003091 3300025986 Bacteria 11906
369 Ga0207677_10001021 3300026023 Bacteria 15424
370 Ga0207677_10009026 3300026023 Bacteria 5594
371 Ga0207677_10118218 3300026023 Bacteria 1988
372 Ga0207677_10172549 3300026023 Bacteria 1692
373 Ga0207703_10013732 3300026035 Bacteria 6313
374 Ga0207703_10014988 3300026035 Bacteria 6050
375 Ga0207703_10182622 3300026035 Bacteria 1852
376 Ga0207639_10010619 3300026041 Bacteria 6378
377 Ga0207678_10000026 3300026067 Bacteria 116850
378 Ga0207678_10002740 3300026067 Bacteria 15957
379 Ga0207702_10000664 3300026078 Bacteria 37414
380 Ga0207702_10000917 3300026078 Bacteria 30463
381 Ga0207702_10001294 3300026078 Bacteria 25044
382 Ga0207702_10047224 3300026078 Bacteria 3627
383 Ga0207702_10084455 3300026078 Bacteria 2764
384 Ga0207641_10000075 3300026088 Bacteria 145149
385 Ga0207641_10004898 3300026088 Bacteria 11509
386 Ga0207641_10011117 3300026088 Bacteria 7386
387 Ga0207641_10094664 3300026088 Bacteria 2620
388 Ga0207641_10120050 3300026088 Bacteria 2344
389 Ga0207648_10000890 3300026089 Bacteria 33695
390 Ga0207648_10023483 3300026089 Bacteria 5523
391 Ga0207676_10000212 3300026095 Bacteria 50034
392 Ga0207676_10008603 3300026095 Bacteria 7252
393 Ga0207674_10000670 3300026116 Bacteria 44517
394 Ga0207674_10001595 3300026116 Bacteria 29202
395 Ga0207674_10002031 3300026116 Bacteria 25688
396 Ga0207674_10073382 3300026116 Bacteria 3435
397 Ga0207675_100043346 3300026118 Bacteria 4201
398 Ga0207683_10001901 3300026121 Bacteria 18484
399 Ga0207683_10041431 3300026121 Bacteria 4021
400 Ga0265356_1000526 3300028017 Bacteria 6878
401 Ga0265355_1002012 3300028036 Bacteria 1385
402 Ga0268266_10003200 3300028379 Bacteria 16567
403 Ga0268266_10031131 3300028379 Bacteria 4530
404 Ga0268265_10046607 3300028380 Bacteria 3241
405 Ga0268264_10022962 3300028381 Bacteria 5090
406 Ga0268264_10065095 3300028381 Unclassified 3070
407 Ga0265338_10003529 3300028800 Bacteria 21905
408 Ga0265338_10046692 3300028800 Unclassified 3965
409 Ga0265338_10048095 3300028800 Bacteria 3885
410 Ga0265338_10050177 3300028800 Bacteria 3774
411 Ga0265338_10146060 3300028800 Unclassified 1844
412 Ga0265762_1000332 3300030760 Bacteria 7953
413 Ga0265762_1001522 3300030760 Unclassified 4212
414 Ga0265770_1006367 3300030878 Unclassified 1640
415 Ga0265760_10000304 3300031090 Bacteria 13522
416 Ga0265760_10001039 3300031090 Bacteria 8068
417 Ga0265325_10005941 3300031241 Bacteria 7478
418 Ga0265325_10089929 3300031241 Unclassified 1515
419 Ga0265339_10011864 3300031249 Bacteria 5345
420 Ga0265339_10055891 3300031249 Bacteria 2139
421 Ga0265316_10012325 3300031344 Bacteria 7673
422 Ga0265316_10037218 3300031344 Bacteria 3929
423 Ga0265313_10049790 3300031595 Unclassified 2014
424 Ga0265314_10002741 3300031711 Bacteria 17605
425 Ga0265314_10059162 3300031711 Bacteria 2623
426 Ga0265314_10075338 3300031711 Unclassified 2245
427 Ga0373926_0006459 3300035083 Bacteria 3895
428 Ga0373926_0017989 3300035083 Bacteria 2428
429 Ga0373923_0001070 3300035111 Bacteria 7504
430 Ga0373936_0002672 3300035113 Bacteria 6664
431 Ga0373936_0023552 3300035113 Unclassified 2400
432 Ga0373936_0056180 3300035113 Bacteria 1599
433 Ga0373945_0000858 3300035116 Bacteria 8960
434 Ga0373943_0000002 3300035170 Bacteria 106064
435 Ga0373943_0024921 3300035170 Bacteria 2793
436 Ga0373946_0027567 3300035171 Bacteria 2248
437 Ga0373955_0053293 3300035172 Bacteria 2208
438 Ga0373935_0002267 3300035692 Bacteria 10943
439 Ga0373935_0014245 3300035692 Unclassified 4799
440 Ga0373927_0000021 3300035695 Bacteria 124647
441 Ga0373927_0008231 3300035695 Bacteria 7021
442 Ga0373927_0056441 3300035695 Bacteria 2539
443 Ga0373927_0068059 3300035695 Bacteria 2304
444 Ga0373933_0060300 3300035724 Bacteria 2287
445 Ga0373947_0000232 3300035725 Bacteria 31261
446 Ga0373947_0001710 3300035725 Bacteria 13456
447 Ga0373947_0041016 3300035725 Bacteria 2759
448 Ga0373937_0027229 3300036401 Bacteria 5169
449 Ga0373937_0061562 3300036401 Bacteria 3450
450 Ga0373937_0127477 3300036401 Bacteria 2375
451 Ga0373925_0000151 3300037068 Bacteria 74246
452 Ga0373925_0001460 3300037068 Bacteria 20404
453 Ga0373925_0007842 3300037068 Bacteria 7775
454 Ga0373925_0014706 3300037068 Bacteria 5654
455 Ga0373925_0034142 3300037068 Bacteria 3750
456 Ga0436365_1326356 3300039437 Bacteria 1537
457 Ga0436362_0708925 3300039453 Bacteria 5421
458 Ga0466963_0006065 3300044694 Bacteria 7125
459 Ga0466963_0100933 3300044694 Bacteria 1975
460 Ga0466964_0012090 3300044706 Bacteria 3266
461 Ga0451576_0162993 3300045051 Bacteria 2327
462 Ga0466967_0298264 3300045976 Unclassified 1550
463 Ga0495580_0000285 3300046472 Bacteria 41012
464 Ga0495580_0000306 3300046472 Bacteria 39953
465 Ga0495580_0004467 3300046472 Bacteria 11747
466 Ga0495580_0017814 3300046472 Bacteria 5299
467 Ga0495580_0022049 3300046472 Bacteria 4693
468 Ga0495580_0118613 3300046472 Bacteria 1837
469 Ga0495580_0170854 3300046472 Unclassified 1503
470 Ga0495582_0000532 3300046473 Bacteria 21082
471 Ga0495582_0000929 3300046473 Bacteria 16338
472 Ga0495665_0001019 3300046531 Bacteria 14833
473 Ga0495635_0088811 3300046663 Bacteria 2115
474 Ga0495623_0047345 3300046679 Bacteria 2729
475 Ga0495658_0019232 3300046683 Unclassified 3562
476 Ga0495581_0015674 3300047315 Bacteria 4399
477 Ga0495674_0007494 3300047319 Bacteria 10420
478 Ga0495602_0015602 3300048088 Bacteria 7662
479 Ga0495602_0057049 3300048088 Bacteria 3430
480 Ga0496102_0004485 3300048905 Bacteria 11784
481 Ga0496102_0258177 3300048905 Unclassified 1643
482 Ga0496104_0082326 3300048907 Bacteria 3069
483 Ga0496105_0136328 3300048908 Bacteria 2022
484 Ga0496107_0013044 3300048910 Bacteria 5806
485 Ga0496108_0000304 3300048911 Bacteria 42250
486 Ga0496109_0000132 3300048912 Bacteria 76436
487 Ga0496110_0001210 3300048913 Bacteria 18366
488 Ga0496111_0138811 3300048914 Unclassified 1801
489 Ga0496112_0000078 3300048915 Bacteria 64712
490 Ga0496112_0002126 3300048915 Bacteria 15733
491 Ga0496112_0007777 3300048915 Bacteria 9540
492 Ga0496112_0016690 3300048915 Bacteria 6884
493 Ga0496112_0162820 3300048915 Bacteria 2197
494 Ga0496112_0350120 3300048915 Unclassified 1420
495 Ga0496113_0005535 3300048916 Bacteria 7887
496 Ga0496113_0108904 3300048916 Bacteria 2154
497 Ga0496115_0011880 3300048918 Bacteria 6541
498 nmdc:mga0n895_2583_c1 3300050512 Bacteria 14216
499 nmdc:mga0n895_264280_c1 3300050512 Bacteria 1746
500 nmdc:mga0rr50_2526_c1 3300050513 Bacteria 10358
501 nmdc:mga0rr50_581_c1 3300050513 Bacteria 19572
502 nmdc:mga08x19_122819_c1 3300050514 Unclassified 1742
503 nmdc:mga08x19_3471_c1 3300050514 Bacteria 9395
504 nmdc:mga08x19_6422_c1 3300050514 Bacteria 6961
505 nmdc:mga0a205_113670_c1 3300050515 Bacteria 2606
506 nmdc:mga0a205_1463_c2 3300050515 Bacteria 19541
507 Ga0495601_0038994 3300053077 Bacteria 2973
508 Ga0068868_100015958
509 LJNas_1000917
510 JGI24751J29686_10000832
511 rootH1_10317107
512 Ga0065715_10095678
513 Ga0070676_10002769
514 Ga0070676_10031985
515 Ga0070676_10043432
516 Ga0070683_100001749
517 Ga0070683_100018618
518 Ga0070683_100083942
519 Ga0070690_100016048
520 Ga0070670_100001284
521 Ga0068869_100002642
522 Ga0068869_100033428
523 Ga0068869_100034049
524 Ga0068869_100186118
525 Ga0070666_10005152
526 Ga0068868_100002662
527 Ga0068868_100005032
528 Ga0068868_100008528
529 Ga0068868_100013830
530 Ga0068868_100070425
531 Ga0070660_100005847
532 Ga0070687_100001260
533 Ga0070661_100019863
534 Ga0070668_100026117
535 Ga0070669_100005366
536 Ga0070675_100008975
537 Ga0070673_100011817
538 Ga0070673_100056768
539 Ga0070688_100002092
540 Ga0070659_100045029
541 Ga0070709_10009490
542 Ga0070709_10010335
543 Ga0070709_10014494
544 Ga0070714_100004856
545 Ga0070714_100007417
546 Ga0070714_100007652
547 Ga0070714_100079159
548 Ga0070713_100000565
549 Ga0070713_100007816
550 Ga0070713_100008421
551 Ga0070713_100028839
552 Ga0070713_100043551
553 Ga0070713_100052174
554 Ga0070713_100069750
555 Ga0070713_100116496
556 Ga0070713_100136014
557 Ga0070713_100180996
558 Ga0070711_100000134
559 Ga0070711_100024156
560 Ga0070708_100002249
561 Ga0070708_100003123
562 Ga0070708_100031369
563 Ga0070708_100032203
564 Ga0070708_100040535
565 Ga0070708_100059796
566 Ga0070708_100171882
567 Ga0070708_100259747
568 Ga0070663_100002508
569 Ga0070663_100043996
570 Ga0070678_100006017
571 Ga0070678_100056594
572 Ga0070678_100085729
573 Ga0070662_100005006
574 Ga0070662_100011758
575 Ga0070681_10021022
576 Ga0070681_10021670
577 Ga0070681_10051511
578 Ga0070706_100002012
579 Ga0070706_100004231
580 Ga0070706_100032973
581 Ga0070706_100052831
582 Ga0070706_100069012
583 Ga0070707_100002271
584 Ga0070707_100011400
585 Ga0070707_100028349
586 Ga0070707_100038047
587 Ga0070707_100246625
588 Ga0070698_100003753
589 Ga0070698_100024517
590 Ga0070698_100140536
591 Ga0070699_100028274
592 Ga0070699_100062594
593 Ga0070699_100078274
594 Ga0070699_100112950
595 Ga0070679_100007414
596 Ga0070679_100009247
597 Ga0070679_100126681
598 Ga0070684_100008745
599 Ga0070684_100049012
600 Ga0070697_100000215
601 Ga0070697_100000848
602 Ga0070697_100004644
603 Ga0070697_100009373
604 Ga0070697_100040092
605 Ga0070697_100145025
606 Ga0070697_100149823
607 Ga0068853_100008281
608 Ga0068853_100078957
609 Ga0070672_100011458
610 Ga0070686_100000892
611 Ga0070693_100013832
612 Ga0070665_100013064
613 Ga0068855_100000952
614 Ga0068855_100006023
615 Ga0068855_100049450
616 Ga0068855_100108777
617 Ga0070664_100003651
618 Ga0070664_100006385
619 Ga0068857_100000113
620 Ga0068857_100000303
621 Ga0068857_100000432
622 Ga0068857_100063749
623 Ga0068854_100005351
624 Ga0068856_100000096
625 Ga0068856_100000243
626 Ga0068856_100000305
627 Ga0068856_100001638
628 Ga0068856_100005323
629 Ga0068856_100014374
630 Ga0068856_100016592
631 Ga0068856_100082151
632 Ga0068856_100151247
633 Ga0068856_100161685
634 Ga0070702_100061090
635 Ga0068852_100001876
636 Ga0068852_100020566
637 Ga0068859_100002165
638 Ga0068859_100017145
639 Ga0068859_100020528
640 Ga0068864_100006643
641 Ga0068864_100026654
642 Ga0068864_100051751
643 Ga0068866_10007977
644 Ga0068866_10011241
645 Ga0068861_100007617
646 Ga0068851_10003901
647 Ga0068870_10003052
648 Ga0068863_100023053
649 Ga0068863_100028316
650 Ga0068863_100039765
651 Ga0068863_100050073
652 Ga0068863_100080970
653 Ga0068863_100094221
654 Ga0068858_100010774
655 Ga0068858_100056794
656 Ga0068858_100071211
657 Ga0068860_100019202
658 Ga0068860_100020951
659 Ga0068860_100102410
660 Ga0068862_100013954
661 Ga0081455_10036729
662 Ga0081540_1033174
663 Ga0081540_1076520
664 Ga0070717_10000272
665 Ga0070717_10000742
666 Ga0070717_10003353
667 Ga0070717_10010042
668 Ga0070717_10010634
669 Ga0070717_10041014
670 Ga0070717_10049789
671 Ga0070717_10050110
672 Ga0070717_10055111
673 Ga0070717_10058130
674 Ga0070717_10147833
675 Ga0070715_10042133
676 Ga0070715_10081570
677 Ga0070716_100006887
678 Ga0070716_100019633
679 Ga0070716_100042920
680 Ga0070712_100001320
681 Ga0070712_100002354
682 Ga0070712_100206053
683 Ga0097621_100000022
684 Ga0097621_100011427
685 Ga0097621_100038451
686 Ga0097621_100040347
687 Ga0068871_100000401
688 Ga0068871_100001873
689 Ga0075433_10034785
690 Ga0075433_10056772
691 Ga0075434_100001721
692 Ga0075434_100088092
693 Ga0075434_100094356
694 Ga0075434_100249481
695 Ga0068865_100004485
696 Ga0075436_100000403
697 Ga0097620_100002165
698 Ga0097620_100017145
699 Ga0097620_100020528
700 Ga0075435_100003080
701 Ga0075435_100004660
702 Ga0099795_10009246
703 Ga0105240_10017033
704 Ga0105240_10020886
705 Ga0105240_10075769
706 Ga0105245_10025894
707 Ga0105245_10086168
708 Ga0105245_10212885
709 Ga0105247_10002146
710 Ga0105247_10017217
711 Ga0105241_10002355
712 Ga0105241_10010279
713 Ga0105241_10013886
714 Ga0105242_10008947
715 Ga0105242_10016910
716 Ga0105248_10013122
717 Ga0105248_10130159
718 Ga0105248_10186026
719 Ga0105237_10013929
720 Ga0105237_10042500
721 Ga0105237_10262892
722 Ga0105238_10000644
723 Ga0105238_10121540
724 Ga0105238_10309138
725 Ga0105249_10069871
726 Ga0105249_10127382
727 Ga0099796_10011455
728 Ga0105239_10017386
729 Ga0105239_10025325
730 Ga0105246_10002089
731 Ga0105246_10131431
732 Ga0157373_10002901
733 Ga0157373_10006728
734 Ga0157373_10027667
735 Ga0157371_10005320
736 Ga0157371_10026169
737 Ga0157371_10107589
738 Ga0157369_10000034
739 Ga0157369_10026089
740 Ga0157369_10067771
741 Ga0157369_10100759
742 Ga0157369_10102830
743 Ga0157369_10215338
744 Ga0157369_10327220
745 Ga0157374_10000052
746 Ga0157374_10001074
747 Ga0157374_10001307
748 Ga0157374_10013402
749 Ga0157374_10014497
750 Ga0157374_10043878
751 Ga0157374_10273437
752 Ga0157378_10000227
753 Ga0157378_10005197
754 Ga0157378_10023112
755 Ga0163162_10013250
756 Ga0163162_10016006
757 Ga0157372_10001472
758 Ga0157372_10003253
759 Ga0157372_10003823
760 Ga0157372_10005010
761 Ga0157372_10006509
762 Ga0157372_10011754
763 Ga0157372_10017766
764 Ga0157372_10021350
765 Ga0157372_10044067
766 Ga0157372_10207289
767 Ga0157375_10011227
768 Ga0157375_10072944
769 Ga0163163_10002887
770 Ga0163163_10118621
771 Ga0163163_10158425
772 Ga0182008_10008915
773 Ga0157377_10017482
774 Ga0157379_10001079
775 Ga0157379_10014042
776 Ga0157379_10022066
777 Ga0157376_10002189
778 Ga0157376_10020200
779 Ga0157376_10023457
780 Ga0157376_10074273
781 Ga0163161_10000865
782 Ga0228598_1001812
783 Ga0228598_1002449
784 Ga0207697_10004240
785 Ga0207656_10017402
786 Ga0207656_10056708
787 Ga0207682_10009207
788 Ga0207692_10006341
789 Ga0207642_10006134
790 Ga0207642_10106463
791 Ga0207688_10000776
792 Ga0207680_10024692
793 Ga0207647_10002181
794 Ga0207647_10005256
795 Ga0207685_10029801
796 Ga0207699_10014416
797 Ga0207699_10017819
798 Ga0207699_10032195
799 Ga0207699_10084181
800 Ga0207645_10000073
801 Ga0207645_10037820
802 Ga0207643_10001320
803 Ga0207684_10000426
804 Ga0207684_10002508
805 Ga0207654_10008789
806 Ga0207654_10081580
807 Ga0207707_10000496
808 Ga0207707_10022459
809 Ga0207707_10034929
810 Ga0207707_10039329
811 Ga0207707_10135497
812 Ga0207695_10030643
813 Ga0207695_10052926
814 Ga0207695_10064346
815 Ga0207693_10000010
816 Ga0207693_10000096
817 Ga0207693_10059829
818 Ga0207663_10005280
819 Ga0207660_10001478
820 Ga0207662_10003418
821 Ga0207657_10000321
822 Ga0207657_10000379
823 Ga0207649_10000727
824 Ga0207649_10014973
825 Ga0207652_10003101
826 Ga0207652_10003223
827 Ga0207646_10000614
828 Ga0207646_10030097
829 Ga0207646_10082581
830 Ga0207646_10144230
831 Ga0207681_10003920
832 Ga0207694_10000250
833 Ga0207650_10000045
834 Ga0207650_10010630
835 Ga0207687_10088400
836 Ga0207700_10000772
837 Ga0207700_10013578
838 Ga0207700_10014185
839 Ga0207700_10033064
840 Ga0207700_10069846
841 Ga0207700_10089601
842 Ga0207700_10194380
843 Ga0207700_10201258
844 Ga0207664_10003719
845 Ga0207664_10023044
846 Ga0207664_10165583
847 Ga0207690_10071209
848 Ga0207706_10000213
849 Ga0207706_10000370
850 Ga0207670_10101036
851 Ga0207704_10035755
852 Ga0207704_10049686
853 Ga0207704_10153428
854 Ga0207665_10001655
855 Ga0207665_10026997
856 Ga0207665_10105519
857 Ga0207691_10000151
858 Ga0207711_10013070
859 Ga0207689_10000129
860 Ga0207689_10015289
861 Ga0207689_10038118
862 Ga0207689_10064418
863 Ga0207689_10214067
864 Ga0207661_10000099
865 Ga0207679_10000096
866 Ga0207679_10022760
867 Ga0207667_10000996
868 Ga0207667_10007025
869 Ga0207667_10076786
870 Ga0207651_10000745
871 Ga0207651_10109635
872 Ga0207712_10267606
873 Ga0207640_10006153
874 Ga0207640_10047744
875 Ga0207658_10003091
876 Ga0207677_10001021
877 Ga0207677_10009026
878 Ga0207677_10118218
879 Ga0207677_10172549
880 Ga0207703_10013732
881 Ga0207703_10014988
882 Ga0207703_10182622
883 Ga0207639_10010619
884 Ga0207678_10000026
885 Ga0207678_10002740
886 Ga0207702_10000664
887 Ga0207702_10000917
888 Ga0207702_10001294
889 Ga0207702_10047224
890 Ga0207702_10084455
891 Ga0207641_10000075
892 Ga0207641_10004898
893 Ga0207641_10011117
894 Ga0207641_10094664
895 Ga0207641_10120050
896 Ga0207648_10000890
897 Ga0207648_10023483
898 Ga0207676_10000212
899 Ga0207676_10008603
900 Ga0207674_10000670
901 Ga0207674_10001595
902 Ga0207674_10002031
903 Ga0207674_10073382
904 Ga0207675_100043346
905 Ga0207683_10001901
906 Ga0207683_10041431
907 Ga0265356_1000526
908 Ga0265355_1002012
909 Ga0268266_10003200
910 Ga0268266_10031131
911 Ga0268265_10046607
912 Ga0268264_10022962
913 Ga0268264_10065095
914 Ga0265338_10003529
915 Ga0265338_10046692
916 Ga0265338_10048095
917 Ga0265338_10050177
918 Ga0265338_10146060
919 Ga0265762_1000332
920 Ga0265762_1001522
921 Ga0265770_1006367
922 Ga0265760_10000304
923 Ga0265760_10001039
924 Ga0265325_10005941
925 Ga0265325_10089929
926 Ga0265339_10011864
927 Ga0265339_10055891
928 Ga0265316_10012325
929 Ga0265316_10037218
930 Ga0265313_10049790
931 Ga0265314_10002741
932 Ga0265314_10059162
933 Ga0265314_10075338
934 Ga0373926_0006459
935 Ga0373926_0017989
936 Ga0373923_0001070
937 Ga0373936_0002672
938 Ga0373936_0023552
939 Ga0373936_0056180
940 Ga0373945_0000858
941 Ga0373943_0000002
942 Ga0373943_0024921
943 Ga0373946_0027567
944 Ga0373955_0053293
945 Ga0373935_0002267
946 Ga0373935_0014245
947 Ga0373927_0000021
948 Ga0373927_0008231
949 Ga0373927_0056441
950 Ga0373927_0068059
951 Ga0373933_0060300
952 Ga0373947_0000232
953 Ga0373947_0001710
954 Ga0373947_0041016
955 Ga0373937_0027229
956 Ga0373937_0061562
957 Ga0373937_0127477
958 Ga0373925_0000151
959 Ga0373925_0001460
960 Ga0373925_0007842
961 Ga0373925_0014706
962 Ga0373925_0034142
963 Ga0436365_1326356
964 Ga0436362_0708925
965 Ga0466963_0006065
966 Ga0466963_0100933
967 Ga0466964_0012090
968 Ga0451576_0162993
969 Ga0466967_0298264
970 Ga0495580_0000285
971 Ga0495580_0000306
972 Ga0495580_0004467
973 Ga0495580_0017814
974 Ga0495580_0022049
975 Ga0495580_0118613
976 Ga0495580_0170854
977 Ga0495582_0000532
978 Ga0495582_0000929
979 Ga0495665_0001019
980 Ga0495635_0088811
981 Ga0495623_0047345
982 Ga0495658_0019232
983 Ga0495581_0015674
984 Ga0495674_0007494
985 Ga0495602_0015602
986 Ga0495602_0057049
987 Ga0496102_0004485
988 Ga0496102_0258177
989 Ga0496104_0082326
990 Ga0496105_0136328
991 Ga0496107_0013044
992 Ga0496108_0000304
993 Ga0496109_0000132
994 Ga0496110_0001210
995 Ga0496111_0138811
996 Ga0496112_0000078
997 Ga0496112_0002126
998 Ga0496112_0007777
999 Ga0496112_0016690
1000 Ga0496112_0162820
1001 Ga0496112_0350120
1002 Ga0496113_0005535
1003 Ga0496113_0108904
1004 Ga0496115_0011880
1005 nmdc:mga0n895_2583_c1
1006 nmdc:mga0n895_264280_c1
1007 nmdc:mga0rr50_2526_c1
1008 nmdc:mga0rr50_581_c1
1009 nmdc:mga08x19_122819_c1
1010 nmdc:mga08x19_3471_c1
1011 nmdc:mga08x19_6422_c1
1012 nmdc:mga0a205_113670_c1
1013 nmdc:mga0a205_1463_c2
1014 Ga0495601_0038994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

60

249

0.92

PF03137

OATP

Organic Anion Transporter Polypeptide (OATP) family

232

347

0.87

PF07690

MFS_1

Major Facilitator Superfamily

57

399

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8301 22 430
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8196 22 430
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.815 20 430
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.8075 60 426
7lo7-assembly1.cif.gz_Z nora in complex with fab25 0.8067 25 430
ID Description Score Start End Superfamily
af_O23203_10_235_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9398 25 201 1.20.1250.20
af_A0A1D6L8U4_23_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9394 25 197 1.20.1250.20
af_P41036_15_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.936 21 202 1.20.1250.20
af_A0A1D6I3B4_2_197_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9359 17 201 1.20.1250.20
af_Q7XKJ7_33_226_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9245 25 200 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1Q8QWG6-F1-model_v4 Sialic acid transporter (Permease) NanT 0.924 17 201 GO:0005886
GO:0046943
AF-A0A3M7M301-F1-model_v4 HC-toxin efflux carrier TOXA 0.9194 22 175 GO:0005886
GO:0022857
AF-A0A7S3BE16-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9174 22 196 GO:0016020
GO:0022857
AF-A0A7S1GC47-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9172 17 199 GO:0016020
GO:0022857
AF-A0A7C2E0I3-F1-model_v4 MFS transporter 0.9002 25 200 GO:0016020
GO:0022857

Map