F456652

General Info

Members Datasets Scaffolds Average Seq Length
507 310 498 401

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100150694|Ga0068860_1001506942
Length 438
Sequence MPLAWHRSISLHYVLYTKSGAAAAHVGSILGARMFKLDSHPSGRHFLQIPGPTNVPDRVLRAMDQPTIDHRGPEFAQLTKEILDGLRPVFQTTSPVVIYAASGTGAWEAALVNTLSPGDRVLMFETGHFATLWRAMAEKLGLVVDFVPGDWRSGVDPAVLEAKLAEDRAHAIKAVMAVHNETSTGVTSRIPALRQAIDRTAHPALFMVDTISSLASIDYRHDEWGVDVTVAGSQKGLMLPPGISFNAVSDKAIAASKQAKLPRSYWRWDETMAMNRQGYFPSTPATNLLYGLHEALAMLHEEGLPNVFARHQRHAEATRRAVRGWGLEILCRNPAEYSGSLTAVMMPDGHDADAFRRDVLDRFDMSLGTGLGKLGGRVFRIGHLGFFNDLMLCGTLCGVEMGLALRNVPHQSNGVAAALAYLAAAGATADKAAHRRAA

Samples

Sample ID Description Type Environment
1 2643221594 Achromobacter sp. Root170 Isolate Unclassified
2 2643221621 Achromobacter sp. Root83 Isolate Unclassified
3 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
4 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
5 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
6 2858950400 Achromobacter sp. K91 Isolate Unclassified
7 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
253 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
299 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
300 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
301 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
302 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
303 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
304 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
305 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
309 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
310 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 0
Isolates 1.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.52
Nodule 0.2
Rhizoplane 4.34
Rhizosphere 83.43
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002421 3300003187 Bacteria 11250
2 rootH1_10118372 3300003316 Bacteria 3303
3 Ga0055526_1007501 3300003771 Bacteria 5652
4 Ga0055526_1010796 3300003771 Bacteria 4202
5 Ga0055537_1002687 3300003773 Bacteria 5802
6 Ga0055536_1000078 3300003781 Bacteria 83510
7 Ga0055534_1000733 3300003784 Bacteria 15839
8 Ga0055534_1001294 3300003784 Bacteria 10127
9 Ga0065714_10006356 3300005288 Bacteria 3901
10 Ga0065712_10085128 3300005290 Bacteria 2717
11 Ga0070683_100040826 3300005329 Bacteria 4266
12 Ga0070690_100017811 3300005330 Bacteria 4281
13 Ga0070670_100000953 3300005331 Bacteria 22667
14 Ga0070670_100014777 3300005331 Bacteria 6700
15 Ga0070670_100038332 3300005331 Bacteria 4122
16 Ga0070670_100321629 3300005331 Bacteria 1356
17 Ga0070677_10037504 3300005333 Bacteria 1891
18 Ga0068869_100000255 3300005334 Bacteria 28046
19 Ga0070666_10016572 3300005335 Bacteria 4715
20 Ga0070666_10026969 3300005335 Bacteria 3758
21 Ga0070682_100044265 3300005337 Bacteria 2755
22 Ga0070660_100032108 3300005339 Bacteria 3949
23 Ga0070689_100014168 3300005340 Bacteria 5787
24 Ga0070661_100042473 3300005344 Bacteria 3318
25 Ga0070668_100019831 3300005347 Bacteria 5066
26 Ga0070668_100031659 3300005347 Bacteria 4024
27 Ga0070668_100034883 3300005347 Bacteria 3834
28 Ga0070668_100217232 3300005347 Bacteria 1575
29 Ga0070669_100044963 3300005353 Bacteria 3217
30 Ga0070669_100276755 3300005353 Bacteria 1344
31 Ga0070675_100009451 3300005354 Bacteria 7589
32 Ga0070675_100107154 3300005354 Bacteria 2360
33 Ga0070671_100065325 3300005355 Bacteria 3030
34 Ga0070674_100125911 3300005356 Bacteria 1903
35 Ga0070674_100158589 3300005356 Bacteria 1715
36 Ga0070673_100005875 3300005364 Bacteria 7915
37 Ga0070673_100040913 3300005364 Bacteria 3559
38 Ga0070688_100000814 3300005365 Bacteria 15398
39 Ga0070688_100180442 3300005365 Bacteria 1464
40 Ga0070667_100003769 3300005367 Bacteria 12877
41 Ga0070667_100113627 3300005367 Bacteria 2350
42 Ga0070667_100142414 3300005367 Bacteria 2101
43 Ga0070667_100230627 3300005367 Bacteria 1651
44 Ga0070709_10039869 3300005434 Bacteria 2884
45 Ga0070709_10059538 3300005434 Bacteria 2425
46 Ga0070714_100006675 3300005435 Bacteria 8932
47 Ga0070714_100010042 3300005435 Bacteria 7469
48 Ga0070714_100091600 3300005435 Bacteria 2664
49 Ga0070713_100000039 3300005436 Bacteria 83384
50 Ga0070713_100003780 3300005436 Bacteria 10021
51 Ga0070713_100041327 3300005436 Bacteria 3756
52 Ga0070713_100061970 3300005436 Bacteria 3131
53 Ga0070713_100089626 3300005436 Unclassified 2642
54 Ga0070713_100214895 3300005436 Bacteria 1742
55 Ga0070710_10021544 3300005437 Bacteria 3360
56 Ga0070711_100008555 3300005439 Bacteria 6273
57 Ga0070711_100019511 3300005439 Bacteria 4350
58 Ga0070711_100113255 3300005439 Bacteria 1994
59 Ga0070705_100031777 3300005440 Bacteria 2927
60 Ga0070708_100000818 3300005445 Bacteria 23467
61 Ga0070708_100004729 3300005445 Bacteria 10731
62 Ga0070708_100072430 3300005445 Bacteria 3105
63 Ga0070708_100192912 3300005445 Bacteria 1906
64 Ga0070678_100000991 3300005456 Bacteria 14681
65 Ga0070681_10040583 3300005458 Bacteria 4662
66 Ga0068867_100002215 3300005459 Bacteria 13640
67 Ga0070685_10009162 3300005466 Bacteria 5109
68 Ga0070706_100000907 3300005467 Bacteria 32408
69 Ga0070706_100199858 3300005467 Bacteria 1867
70 Ga0070707_100012317 3300005468 Bacteria 7985
71 Ga0070707_100089746 3300005468 Bacteria 2974
72 Ga0070698_100075628 3300005471 Bacteria 3371
73 Ga0070698_100148025 3300005471 Bacteria 2297
74 Ga0070699_100008847 3300005518 Bacteria 8719
75 Ga0070699_100062841 3300005518 Bacteria 3219
76 Ga0070679_100012385 3300005530 Bacteria 8149
77 Ga0070679_100028486 3300005530 Bacteria 5507
78 Ga0070684_100098560 3300005535 Bacteria 2607
79 Ga0070697_100013087 3300005536 Bacteria 6503
80 Ga0068853_100029855 3300005539 Bacteria 4599
81 Ga0070672_100007989 3300005543 Bacteria 7225
82 Ga0070672_100073509 3300005543 Bacteria 2725
83 Ga0070672_100245810 3300005543 Bacteria 1506
84 Ga0070696_100032711 3300005546 Bacteria 3569
85 Ga0070693_100002942 3300005547 Bacteria 7872
86 Ga0070665_100018445 3300005548 Bacteria 6994
87 Ga0070665_100041396 3300005548 Bacteria 4631
88 Ga0070704_100000364 3300005549 Bacteria 20603
89 Ga0070704_100001644 3300005549 Bacteria 12120
90 Ga0068855_100069451 3300005563 Bacteria 4100
91 Ga0070664_100012190 3300005564 Bacteria 6987
92 Ga0068857_100037354 3300005577 Bacteria 4302
93 Ga0068856_100337531 3300005614 Bacteria 1525
94 Ga0070702_100008195 3300005615 Bacteria 5047
95 Ga0068859_100001195 3300005617 Bacteria 26504
96 Ga0068864_100000836 3300005618 Bacteria 25975
97 Ga0068864_100007875 3300005618 Bacteria 8780
98 Ga0068866_10003875 3300005718 Bacteria 6135
99 Ga0068861_100007348 3300005719 Bacteria 7546
100 Ga0068861_100037494 3300005719 Bacteria 3604
101 Ga0068851_10047297 3300005834 Bacteria 2178
102 Ga0068870_10003820 3300005840 Bacteria 6417
103 Ga0068863_100018582 3300005841 Bacteria 6652
104 Ga0068863_100060640 3300005841 Bacteria 3577
105 Ga0068863_100229622 3300005841 Bacteria 1790
106 Ga0068858_100002336 3300005842 Bacteria 19181
107 Ga0068858_100002758 3300005842 Bacteria 17655
108 Ga0068860_100001162 3300005843 Bacteria 28802
109 Ga0068860_100018897 3300005843 Bacteria 6696
110 Ga0068860_100023120 3300005843 Bacteria 6010
111 Ga0068860_100057122 3300005843 Bacteria 3709
112 Ga0068860_100124245 3300005843 Bacteria 2473
113 Ga0068860_100150694 3300005843 Bacteria 2239
114 Ga0068862_100004121 3300005844 Bacteria 12314
115 Ga0068862_100025598 3300005844 Bacteria 4954
116 Ga0081540_1046274 3300005983 Bacteria 2198
117 Ga0081539_10007928 3300005985 Bacteria 9459
118 Ga0070717_10026552 3300006028 Bacteria 4619
119 Ga0070717_10088818 3300006028 Bacteria 2606
120 Ga0070715_10021997 3300006163 Bacteria 2481
121 Ga0070712_100007146 3300006175 Bacteria 6962
122 Ga0070712_100012740 3300006175 Bacteria 5354
123 Ga0070712_100018230 3300006175 Bacteria 4556
124 Ga0075428_100007802 3300006844 Bacteria 11861
125 Ga0075428_100011914 3300006844 Bacteria 9674
126 Ga0075431_100001292 3300006847 Bacteria 22857
127 Ga0075433_10251770 3300006852 Bacteria 1567
128 Ga0075429_100010468 3300006880 Bacteria 8024
129 Ga0097620_100001195 3300006931 Bacteria 26504
130 Ga0105240_10041376 3300009093 Bacteria 5882
131 Ga0111539_10007264 3300009094 Bacteria 14185
132 Ga0111539_10204994 3300009094 Bacteria 2299
133 Ga0111539_10474630 3300009094 Bacteria 1457
134 Ga0105245_10003176 3300009098 Bacteria 14685
135 Ga0105245_10023939 3300009098 Bacteria 5359
136 Ga0105245_10077358 3300009098 Bacteria 3033
137 Ga0105243_10170278 3300009148 Bacteria 1885
138 Ga0105248_10175569 3300009177 Bacteria 2415
139 Ga0099796_10004294 3300010159 Bacteria 3429
140 Ga0099796_10015687 3300010159 Bacteria 2219
141 Ga0105239_10343956 3300010375 Bacteria 1683
142 Ga0105246_10101442 3300011119 Bacteria 2096
143 Ga0157373_10028685 3300013100 Bacteria 4014
144 Ga0157370_10015498 3300013104 Bacteria 7750
145 Ga0157370_10038560 3300013104 Bacteria 4621
146 Ga0157369_10020580 3300013105 Bacteria 7376
147 Ga0157374_10003153 3300013296 Bacteria 13861
148 Ga0157378_10015124 3300013297 Bacteria 6756
149 Ga0157372_10007797 3300013307 Bacteria 11373
150 Ga0157375_10004445 3300013308 Bacteria 12179
151 Ga0157375_10066030 3300013308 Bacteria 3610
152 Ga0157375_10094933 3300013308 Bacteria 3052
153 Ga0163163_10001519 3300014325 Bacteria 19610
154 Ga0163163_10031646 3300014325 Bacteria 5107
155 Ga0163163_10146329 3300014325 Bacteria 2407
156 Ga0157380_10039998 3300014326 Bacteria 3649
157 Ga0157380_10045903 3300014326 Bacteria 3431
158 Ga0157379_10000156 3300014968 Bacteria 50624
159 Ga0157379_10127190 3300014968 Bacteria 2293
160 Ga0157376_10156979 3300014969 Bacteria 2058
161 Ga0157376_10229396 3300014969 Bacteria 1724
162 Ga0213872_10002684 3300021361 Bacteria 10293
163 Ga0213872_10008273 3300021361 Bacteria 5038
164 Ga0213876_10024016 3300021384 Archaea 3219
165 Ga0213876_10027648 3300021384 Bacteria 2992
166 Ga0213876_10063016 3300021384 Bacteria 1957
167 Ga0213875_10000011 3300021388 Bacteria 332447
168 Ga0213875_10000677 3300021388 Bacteria 26752
169 Ga0213875_10004931 3300021388 Bacteria 7246
170 Ga0209565_1000821 3300025263 Bacteria 17655
171 Ga0209673_1008548 3300025273 Bacteria 4546
172 Ga0209130_1013923 3300025284 Bacteria 2040
173 Ga0209675_1000087 3300025291 Bacteria 147632
174 Ga0209675_1005735 3300025291 Bacteria 5126
175 Ga0209676_1000176 3300025292 Bacteria 152347
176 Ga0209676_1013522 3300025292 Bacteria 3134
177 Ga0209025_1000046 3300025294 Bacteria 348962
178 Ga0209564_1000166 3300025295 Bacteria 160208
179 Ga0209564_1001192 3300025295 Bacteria 29807
180 Ga0209564_1001289 3300025295 Bacteria 27413
181 Ga0209050_1001219 3300025298 Bacteria 30024
182 Ga0209256_1004743 3300025299 Bacteria 8304
183 Ga0207656_10072958 3300025321 Bacteria 1529
184 Ga0207682_10020887 3300025893 Bacteria 2573
185 Ga0207680_10053062 3300025903 Bacteria 2432
186 Ga0207680_10067983 3300025903 Bacteria 2197
187 Ga0207685_10010174 3300025905 Bacteria 2764
188 Ga0207685_10084058 3300025905 Bacteria 1324
189 Ga0207699_10015851 3300025906 Bacteria 3926
190 Ga0207699_10053788 3300025906 Bacteria 2389
191 Ga0207645_10026027 3300025907 Bacteria 3783
192 Ga0207643_10008929 3300025908 Bacteria 5383
193 Ga0207684_10000506 3300025910 Bacteria 48735
194 Ga0207684_10067786 3300025910 Bacteria 3033
195 Ga0207684_10110633 3300025910 Bacteria 2351
196 Ga0207707_10034293 3300025912 Bacteria 4440
197 Ga0207693_10009806 3300025915 Bacteria 7796
198 Ga0207693_10081715 3300025915 Bacteria 2530
199 Ga0207693_10092049 3300025915 Bacteria 2377
200 Ga0207693_10135896 3300025915 Bacteria 1933
201 Ga0207663_10039412 3300025916 Unclassified 2863
202 Ga0207663_10049495 3300025916 Bacteria 2607
203 Ga0207663_10051880 3300025916 Bacteria 2556
204 Ga0207663_10077589 3300025916 Bacteria 2163
205 Ga0207657_10002457 3300025919 Bacteria 20027
206 Ga0207649_10086374 3300025920 Bacteria 2044
207 Ga0207646_10045906 3300025922 Bacteria 3920
208 Ga0207681_10009205 3300025923 Bacteria 6035
209 Ga0207650_10000871 3300025925 Bacteria 22892
210 Ga0207650_10078380 3300025925 Bacteria 2500
211 Ga0207659_10005664 3300025926 Bacteria 7600
212 Ga0207687_10001854 3300025927 Bacteria 14548
213 Ga0207687_10002728 3300025927 Bacteria 11957
214 Ga0207700_10000120 3300025928 Bacteria 46325
215 Ga0207700_10003220 3300025928 Bacteria 9426
216 Ga0207700_10027995 3300025928 Bacteria 3954
217 Ga0207700_10030893 3300025928 Bacteria 3799
218 Ga0207700_10048370 3300025928 Bacteria 3157
219 Ga0207700_10055746 3300025928 Bacteria 2971
220 Ga0207700_10094868 3300025928 Bacteria 2365
221 Ga0207664_10002996 3300025929 Bacteria 11219
222 Ga0207644_10008406 3300025931 Bacteria 6756
223 Ga0207644_10204193 3300025931 Bacteria 1560
224 Ga0207706_10058157 3300025933 Bacteria 3406
225 Ga0207670_10014556 3300025936 Bacteria 4674
226 Ga0207669_10041984 3300025937 Bacteria 2666
227 Ga0207669_10049948 3300025937 Bacteria 2497
228 Ga0207669_10235091 3300025937 Bacteria 1355
229 Ga0207704_10030354 3300025938 Bacteria 3030
230 Ga0207665_10006265 3300025939 Bacteria 7897
231 Ga0207665_10036446 3300025939 Bacteria 3271
232 Ga0207665_10053311 3300025939 Bacteria 2726
233 Ga0207691_10097767 3300025940 Bacteria 2623
234 Ga0207691_10146841 3300025940 Bacteria 2076
235 Ga0207711_10000116 3300025941 Bacteria 83390
236 Ga0207689_10000905 3300025942 Bacteria 28455
237 Ga0207661_10038636 3300025944 Bacteria 3742
238 Ga0207679_10082685 3300025945 Bacteria 2459
239 Ga0207667_10015937 3300025949 Bacteria 8512
240 Ga0207667_10094825 3300025949 Bacteria 3081
241 Ga0207651_10002800 3300025960 Bacteria 8384
242 Ga0207651_10064408 3300025960 Bacteria 2565
243 Ga0207651_10077126 3300025960 Bacteria 2385
244 Ga0207712_10035959 3300025961 Bacteria 3370
245 Ga0207668_10003032 3300025972 Bacteria 9844
246 Ga0207668_10006192 3300025972 Bacteria 7062
247 Ga0207668_10082181 3300025972 Bacteria 2339
248 Ga0207658_10007272 3300025986 Bacteria 7550
249 Ga0207658_10019281 3300025986 Bacteria 4716
250 Ga0207658_10091623 3300025986 Bacteria 2359
251 Ga0207658_10255881 3300025986 Bacteria 1490
252 Ga0207677_10000188 3300026023 Bacteria 49751
253 Ga0207677_10081527 3300026023 Bacteria 2322
254 Ga0207703_10000595 3300026035 Bacteria 36837
255 Ga0207703_10000806 3300026035 Bacteria 30873
256 Ga0207703_10136793 3300026035 Bacteria 2122
257 Ga0207678_10079420 3300026067 Bacteria 2809
258 Ga0207702_10035425 3300026078 Bacteria 4173
259 Ga0207702_10036658 3300026078 Bacteria 4102
260 Ga0207702_10067543 3300026078 Bacteria 3069
261 Ga0207702_10076393 3300026078 Bacteria 2895
262 Ga0207641_10022333 3300026088 Bacteria 5208
263 Ga0207641_10037558 3300026088 Bacteria 4045
264 Ga0207648_10000762 3300026089 Bacteria 36143
265 Ga0207648_10049622 3300026089 Bacteria 3672
266 Ga0207648_10054451 3300026089 Bacteria 3494
267 Ga0207676_10000230 3300026095 Bacteria 48620
268 Ga0207676_10000867 3300026095 Bacteria 23441
269 Ga0207674_10053654 3300026116 Bacteria 4108
270 Ga0207674_10058812 3300026116 Bacteria 3892
271 Ga0207675_100013813 3300026118 Bacteria 7530
272 Ga0207675_100072207 3300026118 Bacteria 3228
273 Ga0207675_100100959 3300026118 Bacteria 2718
274 Ga0207683_10001221 3300026121 Bacteria 23317
275 Ga0207683_10001896 3300026121 Bacteria 18497
276 Ga0207428_10016833 3300027907 Bacteria 6283
277 Ga0268266_10176494 3300028379 Bacteria 1942
278 Ga0268265_10001575 3300028380 Bacteria 18908
279 Ga0268265_10060750 3300028380 Bacteria 2897
280 Ga0268264_10001114 3300028381 Bacteria 26569
281 Ga0268264_10007843 3300028381 Bacteria 8887
282 Ga0265330_10007182 3300031235 Bacteria 5455
283 Ga0265332_10000776 3300031238 Bacteria 19556
284 Ga0265328_10035441 3300031239 Bacteria 1845
285 Ga0265325_10039806 3300031241 Bacteria 2472
286 Ga0265329_10005639 3300031242 Bacteria 5039
287 Ga0265331_10000464 3300031250 Bacteria 38987
288 Ga0265316_10030543 3300031344 Bacteria 4415
289 Ga0265314_10022532 3300031711 Bacteria 4825
290 Ga0307413_10024823 3300031824 Bacteria 3275
291 Ga0307410_10008737 3300031852 Bacteria 5637
292 Ga0307406_10010410 3300031901 Bacteria 5243
293 Ga0307407_10006384 3300031903 Bacteria 5230
294 Ga0307409_100019701 3300031995 Bacteria 4576
295 Ga0307416_100020365 3300032002 Bacteria 4731
296 Ga0307414_10026145 3300032004 Bacteria 3752
297 Ga0307411_10063344 3300032005 Bacteria 2471
298 Ga0307415_100002155 3300032126 Bacteria 9756
299 Ga0373926_0035183 3300035083 Bacteria 1776
300 Ga0373926_0068654 3300035083 Bacteria 1300
301 Ga0373934_0010580 3300035086 Bacteria 3464
302 Ga0373952_0031754 3300035092 Bacteria 1176
303 Ga0373941_0069170 3300035115 Bacteria 1168
304 Ga0373945_0034959 3300035116 Bacteria 1794
305 Ga0373953_0006271 3300035117 Bacteria 3908
306 Ga0373954_0005467 3300035118 Bacteria 5497
307 Ga0373943_0005048 3300035170 Bacteria 5953
308 Ga0373946_0035881 3300035171 Bacteria 2007
309 Ga0373924_0000079 3300035410 Bacteria 25860
310 Ga0373924_0037702 3300035410 Bacteria 1969
311 Ga0373935_0004235 3300035692 Bacteria 8414
312 Ga0373935_0019629 3300035692 Bacteria 4122
313 Ga0373935_0086040 3300035692 Bacteria 2051
314 Ga0373927_0002451 3300035695 Bacteria 13532
315 Ga0373927_0076688 3300035695 Unclassified 2164
316 Ga0373927_0144889 3300035695 Bacteria 1554
317 Ga0373933_0005465 3300035724 Bacteria 6919
318 Ga0373933_0104310 3300035724 Bacteria 1762
319 Ga0373947_0002505 3300035725 Bacteria 11033
320 Ga0373947_0006103 3300035725 Bacteria 7019
321 Ga0373947_0006655 3300035725 Bacteria 6708
322 Ga0373947_0013720 3300035725 Bacteria 4643
323 Ga0373947_0023666 3300035725 Bacteria 3575
324 Ga0373937_0010044 3300036401 Bacteria 8253
325 Ga0373937_0011991 3300036401 Bacteria 7609
326 Ga0373937_0023672 3300036401 Bacteria 5535
327 Ga0373937_0030267 3300036401 Bacteria 4902
328 Ga0373937_0042555 3300036401 Bacteria 4144
329 Ga0373937_0145282 3300036401 Unclassified 2220
330 Ga0373937_0155186 3300036401 Unclassified 2145
331 Ga0373937_0167934 3300036401 Bacteria 2058
332 Ga0373925_0019062 3300037068 Bacteria 4988
333 Ga0373925_0074644 3300037068 Bacteria 2568
334 Ga0373925_0141020 3300037068 Bacteria 1886
335 Ga0395898_0154686 3300037466 Bacteria 2194
336 Ga0436364_0145306 3300037853 Bacteria 1614
337 Ga0436364_0754076 3300037853 Bacteria 16272
338 Ga0436364_1423953 3300037853 Bacteria 39549
339 Ga0436365_0213763 3300039437 Bacteria 3701
340 Ga0436365_0370328 3300039437 Bacteria 9603
341 Ga0436365_0920134 3300039437 Bacteria 8458
342 Ga0436365_1372505 3300039437 Bacteria 22469
343 Ga0436365_1737672 3300039437 Bacteria 1700
344 Ga0436360_0467851 3300039438 Bacteria 3635
345 Ga0436361_0072659 3300039447 Bacteria 1488
346 Ga0436361_0122017 3300039447 Bacteria 2006
347 Ga0436361_0229550 3300039447 Bacteria 13250
348 Ga0436361_0272085 3300039447 Bacteria 9407
349 Ga0436362_0573837 3300039453 Bacteria 2310
350 Ga0436362_0644872 3300039453 Bacteria 2699
351 Ga0436362_0692466 3300039453 Bacteria 1738
352 Ga0436362_1183443 3300039453 Bacteria 1729
353 Ga0451577_0187677 3300042876 Bacteria 1864
354 Ga0453684_0053303 3300044712 Bacteria 5280
355 Ga0453684_0113930 3300044712 Bacteria 3279
356 Ga0495627_006947 3300046453 Bacteria 4393
357 Ga0495592_0053851 3300046454 Bacteria 2983
358 Ga0495592_0201963 3300046454 Bacteria 1341
359 Ga0495590_0000380 3300046457 Bacteria 22628
360 Ga0495638_0004189 3300046460 Bacteria 10991
361 Ga0495580_0012422 3300046472 Bacteria 6529
362 Ga0495580_0146033 3300046472 Bacteria 1639
363 Ga0495582_0015426 3300046473 Bacteria 4196
364 Ga0495639_0085792 3300046475 Bacteria 1472
365 Ga0495584_0044575 3300046491 Bacteria 2238
366 Ga0495585_0000070 3300046492 Bacteria 106156
367 Ga0495585_0002310 3300046492 Bacteria 13734
368 Ga0495594_0017420 3300046499 Bacteria 3796
369 Ga0495594_0032145 3300046499 Bacteria 2847
370 Ga0495583_0009624 3300046506 Bacteria 5751
371 Ga0495583_0065791 3300046506 Bacteria 1605
372 Ga0495583_0070457 3300046506 Bacteria 1537
373 Ga0495606_0036075 3300046507 Bacteria 3373
374 Ga0495608_0070933 3300046511 Bacteria 2274
375 Ga0495608_0167861 3300046511 Bacteria 1393
376 Ga0495618_0036926 3300046514 Bacteria 3067
377 Ga0495631_0021919 3300046518 Bacteria 2972
378 Ga0495631_0044505 3300046518 Bacteria 1955
379 Ga0495632_0052887 3300046519 Bacteria 1995
380 Ga0495663_0007510 3300046525 Bacteria 3015
381 Ga0495666_0001609 3300046526 Bacteria 11121
382 Ga0495666_0009587 3300046526 Bacteria 4840
383 Ga0495642_0001905 3300046528 Bacteria 8880
384 Ga0495642_0008031 3300046528 Bacteria 4037
385 Ga0495665_0003474 3300046531 Bacteria 8550
386 Ga0495586_0045916 3300046535 Bacteria 2355
387 Ga0495586_0051765 3300046535 Bacteria 2222
388 Ga0495609_0095538 3300046538 Bacteria 1290
389 Ga0495621_0020048 3300046539 Bacteria 2190
390 Ga0495597_0009226 3300046542 Bacteria 4888
391 Ga0495597_0010825 3300046542 Bacteria 4443
392 Ga0495597_0038596 3300046542 Bacteria 2140
393 Ga0495645_0089425 3300046543 Bacteria 2202
394 Ga0495622_0001954 3300046557 Bacteria 10113
395 Ga0495633_0082544 3300046558 Bacteria 1495
396 Ga0495667_0141037 3300046559 Unclassified 1553
397 Ga0495668_0003146 3300046616 Bacteria 12732
398 Ga0495634_0068844 3300046642 Bacteria 2337
399 Ga0495634_0111868 3300046642 Bacteria 1755
400 Ga0495611_0002422 3300046648 Bacteria 8546
401 Ga0495625_0010540 3300046660 Bacteria 7635
402 Ga0495625_0023691 3300046660 Bacteria 4685
403 Ga0495625_0024315 3300046660 Bacteria 4612
404 Ga0495635_0013697 3300046663 Bacteria 5674
405 Ga0495661_0115020 3300046665 Bacteria 1494
406 Ga0495588_0007786 3300046674 Bacteria 4891
407 Ga0495623_0010407 3300046679 Bacteria 6020
408 Ga0495623_0067653 3300046679 Bacteria 2229
409 Ga0495623_0073555 3300046679 Bacteria 2124
410 Ga0495646_0114673 3300046680 Bacteria 1531
411 Ga0495658_0003752 3300046683 Bacteria 7517
412 Ga0495658_0087285 3300046683 Bacteria 1842
413 Ga0495613_0068879 3300046689 Bacteria 2580
414 Ga0495624_0011383 3300046690 Bacteria 6114
415 Ga0495670_0095902 3300046691 Bacteria 1522
416 Ga0495581_0004852 3300047315 Bacteria 7781
417 Ga0495581_0006624 3300047315 Bacteria 6709
418 Ga0495604_0007005 3300047317 Bacteria 8935
419 Ga0495604_0018363 3300047317 Bacteria 5601
420 Ga0495676_0014845 3300047321 Bacteria 6955
421 Ga0495680_0010916 3300047322 Bacteria 8070
422 Ga0495680_0039635 3300047322 Bacteria 3756
423 Ga0495680_0164122 3300047322 Bacteria 1611
424 Ga0495683_0011188 3300047323 Bacteria 4729
425 Ga0495675_0036457 3300047444 Bacteria 3137
426 Ga0495677_0002049 3300047445 Bacteria 8038
427 Ga0495677_0011499 3300047445 Bacteria 3237
428 Ga0495681_0031312 3300047470 Bacteria 2694
429 Ga0495602_0069453 3300048088 Bacteria 3020
430 Ga0495614_0005446 3300048089 Bacteria 5737
431 Ga0495626_0000792 3300048091 Bacteria 28683
432 Ga0496102_0005885 3300048905 Bacteria 10437
433 Ga0496102_0202279 3300048905 Bacteria 1872
434 Ga0496102_0228258 3300048905 Bacteria 1755
435 Ga0496103_0028099 3300048906 Bacteria 3412
436 Ga0496104_0009253 3300048907 Bacteria 8761
437 Ga0496104_0069780 3300048907 Unclassified 3340
438 Ga0496105_0002291 3300048908 Bacteria 13884
439 Ga0496105_0391912 3300048908 Bacteria 1104
440 Ga0496106_0046382 3300048909 Bacteria 3267
441 Ga0496106_0101393 3300048909 Bacteria 2233
442 Ga0496107_0028147 3300048910 Bacteria 3993
443 Ga0496107_0101400 3300048910 Bacteria 2111
444 Ga0496108_0052651 3300048911 Bacteria 3412
445 Ga0496109_0229306 3300048912 Bacteria 1747
446 Ga0496110_0001834 3300048913 Bacteria 15666
447 Ga0496110_0108984 3300048913 Bacteria 2487
448 Ga0496111_0070286 3300048914 Bacteria 2546
449 Ga0496112_0043423 3300048915 Bacteria 4401
450 Ga0496112_0156157 3300048915 Bacteria 2248
451 Ga0496112_0241226 3300048915 Bacteria 1760
452 Ga0496114_0215340 3300048917 Bacteria 1685
453 Ga0496115_0132967 3300048918 Bacteria 2051
454 Ga0496116_0002041 3300048919 Bacteria 21637
455 Ga0496118_0040468 3300048921 Bacteria 3706
456 Ga0496119_0024012 3300048922 Bacteria 4303
457 Ga0496121_0004254 3300048924 Bacteria 19459
458 Ga0496121_0028453 3300048924 Bacteria 5201
459 Ga0496121_0032207 3300048924 Bacteria 4770
460 Ga0496122_0000021 3300048925 Bacteria 391363
461 Ga0496123_0000174 3300048926 Bacteria 130310
462 Ga0496124_0000104 3300048927 Bacteria 177382
463 Ga0496125_0071035 3300048928 Bacteria 2722
464 Ga0495682_0009527 3300049460 Bacteria 3789
465 Ga0501034_0078878 3300049571 Bacteria 3296
466 Ga0501039_0053640 3300049575 Bacteria 3120
467 Ga0501040_0086159 3300049576 Bacteria 2181
468 Ga0501047_0348147 3300049581 Bacteria 1319
469 Ga0501070_0007769 3300049586 Bacteria 9092
470 Ga0501072_0043090 3300049588 Bacteria 3547
471 Ga0501073_0009222 3300049589 Bacteria 7275
472 Ga0501075_0119952 3300049591 Bacteria 2001
473 Ga0501076_0025111 3300049592 Bacteria 4609
474 Ga0501077_0021111 3300049593 Bacteria 4120
475 Ga0501081_0086875 3300049743 Bacteria 2196
476 Ga0501083_0003894 3300049744 Bacteria 10486
477 nmdc:mga05p37_5770_c1 3300050507 Bacteria 14562
478 nmdc:mga09592_10065_c1 3300050508 Bacteria 5209
479 nmdc:mga09592_118102_c1 3300050508 Bacteria 2276
480 nmdc:mga09592_6021_c1 3300050508 Bacteria 9894
481 nmdc:mga0qj67_75212_c1 3300050509 Bacteria 2699
482 nmdc:mga06r32_33305_c1 3300050510 Bacteria 4853
483 nmdc:mga0n895_401328_c1 3300050512 Bacteria 1386
484 Ga0495595_0033107 3300053084 Bacteria 2331
485 Ga0495619_0010344 3300053085 Bacteria 5872
486 Ga0495619_0072718 3300053085 Bacteria 2303
487 Ga0500647_0059347 3300053091 Bacteria 1840
488 Ga0500640_000638 3300053095 Bacteria 9162
489 Ga0500554_000391 3300053102 Bacteria 9383
490 Ga0500572_003737 3300053111 Bacteria 3454
491 Ga0500595_000128 3300053119 Bacteria 49404
492 Ga0500597_028637 3300053120 Bacteria 2275
493 Ga0500614_000222 3300053123 Bacteria 14972
494 Ga0500601_001571 3300053737 Bacteria 2478
495 Ga0501084_0202018 3300054114 Bacteria 1677
496 Ga0501082_0023778 3300060353 Bacteria 5284
497 Ga0501082_0226392 3300060353 Bacteria 1627
498 Ga0530510_0056126 3300061734 Bacteria 2845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0573837 Ga0436362_0573837_1190_2245 348
2 3300048908 Ga0496105_0391912 Ga0496105_0391912_19_1083 349
3 3300035115 Ga0373941_0069170 Ga0373941_0069170_69_1154 354
4 3300044712 Ga0453684_0113930 Ga0453684_0113930_2142_3233 363
5 3300009098 Ga0105245_10077358 Ga0105245_100773582 369
6 3300013297 Ga0157378_10015124 Ga0157378_100151246 369
7 3300039447 Ga0436361_0229550 Ga0436361_0229550_302_1417 369
8 3300048905 Ga0496102_0228258 Ga0496102_0228258_490_1629 369
9 3300048915 Ga0496112_0241226 Ga0496112_0241226_506_1645 369
10 3300048918 Ga0496115_0132967 Ga0496115_0132967_89_1228 369
11 3300014969 Ga0157376_10156979 Ga0157376_101569791 371
12 3300035083 Ga0373926_0068654 Ga0373926_0068654_158_1285 372
13 3300035725 Ga0373947_0006655 Ga0373947_0006655_842_1969 372
14 3300035092 Ga0373952_0031754 Ga0373952_0031754_23_1156 373
15 3300039447 Ga0436361_0272085 Ga0436361_0272085_8240_9367 373
16 3300046506 Ga0495583_0009624 Ga0495583_0009624_395_1642 373
17 3300046679 Ga0495623_0073555 Ga0495623_0073555_39_1187 373
18 3300048913 Ga0496110_0001834 Ga0496110_0001834_6817_7965 373
19 3300048914 Ga0496111_0070286 Ga0496111_0070286_482_1630 373
20 3300035724 Ga0373933_0104310 Ga0373933_0104310_11_1159 375
21 3300044712 Ga0453684_0053303 Ga0453684_0053303_4039_5178 376
22 3300047323 Ga0495683_0011188 Ga0495683_0011188_45_1187 376
23 iso_pu_bacteria 2895427314 2895430136 376
24 3300005467 Ga0070706_100000907 Ga0070706_1000009073 377
25 3300006028 Ga0070717_10088818 Ga0070717_100888182 377
26 3300025910 Ga0207684_10000506 Ga0207684_100005067 377
27 3300021361 Ga0213872_10002684 Ga0213872_100026842 379
28 3300005435 Ga0070714_100010042 Ga0070714_1000100422 382
29 3300039438 Ga0436360_0467851 Ga0436360_0467851_1897_3060 382
30 3300039453 Ga0436362_1183443 Ga0436362_1183443_241_1404 382
31 3300005445 Ga0070708_100072430 Ga0070708_1000724302 385
32 3300005841 Ga0068863_100229622 Ga0068863_1002296222 385
33 3300039447 Ga0436361_0072659 Ga0436361_0072659_46_1221 385
34 iso_pu_bacteria 2857542790 2857546505 387
35 3300005549 Ga0070704_100001644 Ga0070704_1000016444 388
36 3300006852 Ga0075433_10251770 Ga0075433_102517701 388
37 3300048921 Ga0496118_0040468 Ga0496118_0040468_682_1863 388
38 3300048922 Ga0496119_0024012 Ga0496119_0024012_705_1886 388
39 3300048928 Ga0496125_0071035 Ga0496125_0071035_988_2169 388
40 3300053091 Ga0500647_0059347 Ga0500647_0059347_413_1609 388
41 3300053095 Ga0500640_000638 Ga0500640_000638_2333_3529 388
42 3300053102 Ga0500554_000391 Ga0500554_000391_2568_3764 388
43 3300053111 Ga0500572_003737 Ga0500572_003737_1919_3115 388
44 3300053119 Ga0500595_000128 Ga0500595_000128_28778_29974 388
45 3300053120 Ga0500597_028637 Ga0500597_028637_572_1768 388
46 3300053123 Ga0500614_000222 Ga0500614_000222_13636_14832 388
47 3300053737 Ga0500601_001571 Ga0500601_001571_155_1351 388
48 3300005355 Ga0070671_100065325 Ga0070671_1000653251 389
49 3300005445 Ga0070708_100004729 Ga0070708_1000047292 389
50 3300005468 Ga0070707_100012317 Ga0070707_1000123176 389
51 3300005518 Ga0070699_100008847 Ga0070699_1000088475 389
52 3300025910 Ga0207684_10067786 Ga0207684_100677863 389
53 3300031824 Ga0307413_10024823 Ga0307413_100248232 389
54 3300032005 Ga0307411_10063344 Ga0307411_100633441 389
55 iso_pu_bacteria 643348564 643602551 389
56 3300005436 Ga0070713_100003780 Ga0070713_1000037804 390
57 3300010375 Ga0105239_10343956 Ga0105239_103439561 390
58 3300021361 Ga0213872_10008273 Ga0213872_100082731 390
59 3300021384 Ga0213876_10027648 Ga0213876_100276482 390
60 3300021388 Ga0213875_10004931 Ga0213875_100049311 390
61 3300025928 Ga0207700_10003220 Ga0207700_100032203 390
62 3300025944 Ga0207661_10038636 Ga0207661_100386361 390
63 3300035118 Ga0373954_0005467 Ga0373954_0005467_2234_3415 390
64 3300035724 Ga0373933_0005465 Ga0373933_0005465_4188_5369 390
65 3300036401 Ga0373937_0010044 Ga0373937_0010044_1273_2454 390
66 3300036401 Ga0373937_0030267 Ga0373937_0030267_2632_3813 390
67 3300037853 Ga0436364_1423953 Ga0436364_1423953_38104_39285 390
68 3300039437 Ga0436365_0213763 Ga0436365_0213763_399_1589 390
69 3300039437 Ga0436365_1737672 Ga0436365_1737672_422_1609 390
70 3300039447 Ga0436361_0122017 Ga0436361_0122017_713_1897 390
71 3300046511 Ga0495608_0167861 Ga0495608_0167861_56_1315 390
72 3300046539 Ga0495621_0020048 Ga0495621_0020048_957_2138 390
73 3300047322 Ga0495680_0164122 Ga0495680_0164122_135_1316 390
74 3300049581 Ga0501047_0348147 Ga0501047_0348147_70_1251 390
75 3300050508 nmdc:mga09592_118102_c1 nmdc:mga09592_118102_c1_1002_2183 390
76 3300050509 nmdc:mga0qj67_75212_c1 nmdc:mga0qj67_75212_c1_1309_2490 390
77 3300053084 Ga0495595_0033107 Ga0495595_0033107_41_1222 390
78 3300053085 Ga0495619_0072718 Ga0495619_0072718_33_1214 390
79 3300005436 Ga0070713_100089626 Ga0070713_1000896262 391
80 3300005445 Ga0070708_100192912 Ga0070708_1001929122 391
81 3300005467 Ga0070706_100199858 Ga0070706_1001998582 391
82 3300005468 Ga0070707_100089746 Ga0070707_1000897464 391
83 3300005614 Ga0068856_100337531 Ga0068856_1003375312 391
84 3300005718 Ga0068866_10003875 Ga0068866_100038752 391
85 3300005843 Ga0068860_100124245 Ga0068860_1001242452 391
86 3300010159 Ga0099796_10015687 Ga0099796_100156872 391
87 3300014969 Ga0157376_10229396 Ga0157376_102293961 391
88 3300021384 Ga0213876_10024016 Ga0213876_100240162 391
89 3300021384 Ga0213876_10063016 Ga0213876_100630162 391
90 3300025915 Ga0207693_10135896 Ga0207693_101358962 391
91 3300025916 Ga0207663_10077589 Ga0207663_100775892 391
92 3300025922 Ga0207646_10045906 Ga0207646_100459064 391
93 3300025927 Ga0207687_10002728 Ga0207687_100027288 391
94 3300025928 Ga0207700_10030893 Ga0207700_100308934 391
95 3300025928 Ga0207700_10055746 Ga0207700_100557463 391
96 3300025928 Ga0207700_10094868 Ga0207700_100948682 391
97 3300025937 Ga0207669_10041984 Ga0207669_100419842 391
98 3300026078 Ga0207702_10035425 Ga0207702_100354252 391
99 3300026078 Ga0207702_10076393 Ga0207702_100763934 391
100 3300026089 Ga0207648_10054451 Ga0207648_100544512 391
101 3300026121 Ga0207683_10001896 Ga0207683_100018967 391
102 3300035695 Ga0373927_0144889 Ga0373927_0144889_159_1349 391
103 3300035725 Ga0373947_0013720 Ga0373947_0013720_2675_3865 391
104 3300037068 Ga0373925_0141020 Ga0373925_0141020_83_1273 391
105 3300037853 Ga0436364_0145306 Ga0436364_0145306_49_1266 391
106 3300039437 Ga0436365_0370328 Ga0436365_0370328_287_1477 391
107 3300039437 Ga0436365_1372505 Ga0436365_1372505_8223_9416 391
108 3300039453 Ga0436362_0692466 Ga0436362_0692466_76_1266 391
109 3300046454 Ga0495592_0053851 Ga0495592_0053851_839_2029 391
110 3300046475 Ga0495639_0085792 Ga0495639_0085792_32_1222 391
111 3300046535 Ga0495586_0045916 Ga0495586_0045916_424_1614 391
112 3300046642 Ga0495634_0068844 Ga0495634_0068844_663_1853 391
113 3300048924 Ga0496121_0028453 Ga0496121_0028453_3026_4201 391
114 3300048927 Ga0496124_0000104 Ga0496124_0000104_95_1270 391
115 3300053085 Ga0495619_0010344 Ga0495619_0010344_4169_5359 391
116 iso_pu_bacteria 2643221594 2643978787 391
117 iso_pu_bacteria 2643221621 2644120224 391
118 iso_pu_bacteria 2808606395 2809036456 391
119 iso_pu_bacteria 2857537821 2857538831 391
120 iso_pu_bacteria 2858950400 2858953712 391
121 iso_pu_bacteria 8045864390 8045864706 391
122 3300005435 Ga0070714_100006675 Ga0070714_1000066756 392
123 3300005458 Ga0070681_10040583 Ga0070681_100405833 392
124 3300005471 Ga0070698_100075628 Ga0070698_1000756282 392
125 3300005471 Ga0070698_100148025 Ga0070698_1001480252 392
126 3300005549 Ga0070704_100000364 Ga0070704_10000036413 392
127 3300006844 Ga0075428_100007802 Ga0075428_1000078024 392
128 3300006847 Ga0075431_100001292 Ga0075431_10000129213 392
129 3300006880 Ga0075429_100010468 Ga0075429_1000104683 392
130 3300021388 Ga0213875_10000677 Ga0213875_1000067722 392
131 3300025292 Ga0209676_1013522 Ga0209676_10135222 392
132 3300025916 Ga0207663_10039412 Ga0207663_100394123 392
133 3300025931 Ga0207644_10204193 Ga0207644_102041931 392
134 3300036401 Ga0373937_0155186 Ga0373937_0155186_633_1826 392
135 3300046514 Ga0495618_0036926 Ga0495618_0036926_448_1719 392
136 3300047322 Ga0495680_0039635 Ga0495680_0039635_1911_3182 392
137 3300049571 Ga0501034_0078878 Ga0501034_0078878_523_1722 392
138 3300050507 nmdc:mga05p37_5770_c1 nmdc:mga05p37_5770_c1_7526_8719 392
139 3300050508 nmdc:mga09592_6021_c1 nmdc:mga09592_6021_c1_5886_7079 392
140 3300050510 nmdc:mga06r32_33305_c1 nmdc:mga06r32_33305_c1_973_2166 392
141 3300005983 Ga0081540_1046274 Ga0081540_10462741 393
142 3300006163 Ga0070715_10021997 Ga0070715_100219972 393
143 3300006844 Ga0075428_100011914 Ga0075428_1000119143 393
144 3300009094 Ga0111539_10007264 Ga0111539_100072645 393
145 3300009098 Ga0105245_10003176 Ga0105245_1000317612 393
146 3300010159 Ga0099796_10004294 Ga0099796_100042944 393
147 3300013105 Ga0157369_10020580 Ga0157369_100205801 393
148 3300025927 Ga0207687_10001854 Ga0207687_100018542 393
149 3300025939 Ga0207665_10006265 Ga0207665_100062653 393
150 3300025949 Ga0207667_10015937 Ga0207667_100159375 393
151 3300026078 Ga0207702_10067543 Ga0207702_100675432 393
152 3300026118 Ga0207675_100100959 Ga0207675_1001009593 393
153 3300027907 Ga0207428_10016833 Ga0207428_100168333 393
154 3300031852 Ga0307410_10008737 Ga0307410_100087373 393
155 3300031901 Ga0307406_10010410 Ga0307406_100104103 393
156 3300031903 Ga0307407_10006384 Ga0307407_100063843 393
157 3300031995 Ga0307409_100019701 Ga0307409_1000197014 393
158 3300032002 Ga0307416_100020365 Ga0307416_1000203651 393
159 3300032004 Ga0307414_10026145 Ga0307414_100261452 393
160 3300032126 Ga0307415_100002155 Ga0307415_1000021553 393
161 3300035170 Ga0373943_0005048 Ga0373943_0005048_618_1829 393
162 3300035171 Ga0373946_0035881 Ga0373946_0035881_712_1923 393
163 3300035410 Ga0373924_0000079 Ga0373924_0000079_3294_4505 393
164 3300035410 Ga0373924_0037702 Ga0373924_0037702_340_1545 393
165 3300035692 Ga0373935_0004235 Ga0373935_0004235_6222_7433 393
166 3300035695 Ga0373927_0002451 Ga0373927_0002451_7204_8415 393
167 3300035695 Ga0373927_0076688 Ga0373927_0076688_686_1894 393
168 3300035725 Ga0373947_0002505 Ga0373947_0002505_1953_3164 393
169 3300035725 Ga0373947_0006103 Ga0373947_0006103_3893_5104 393
170 3300036401 Ga0373937_0145282 Ga0373937_0145282_832_2043 393
171 3300037068 Ga0373925_0019062 Ga0373925_0019062_1499_2710 393
172 3300046472 Ga0495580_0012422 Ga0495580_0012422_3821_5032 393
173 3300046559 Ga0495667_0141037 Ga0495667_0141037_44_1255 393
174 3300046683 Ga0495658_0087285 Ga0495658_0087285_619_1812 393
175 3300048907 Ga0496104_0069780 Ga0496104_0069780_951_2159 393
176 3300048908 Ga0496105_0002291 Ga0496105_0002291_704_1915 393
177 3300048913 Ga0496110_0108984 Ga0496110_0108984_544_1752 393
178 3300048915 Ga0496112_0156157 Ga0496112_0156157_662_1870 393
179 3300050508 nmdc:mga09592_10065_c1 nmdc:mga09592_10065_c1_1213_2415 393
180 3300050512 nmdc:mga0n895_401328_c1 nmdc:mga0n895_401328_c1_25_1227 393
181 3300005290 Ga0065712_10085128 Ga0065712_100851282 394
182 3300005331 Ga0070670_100000953 Ga0070670_1000009539 394
183 3300005334 Ga0068869_100000255 Ga0068869_1000002558 394
184 3300005364 Ga0070673_100040913 Ga0070673_1000409132 394
185 3300005367 Ga0070667_100003769 Ga0070667_1000037697 394
186 3300005434 Ga0070709_10059538 Ga0070709_100595382 394
187 3300005436 Ga0070713_100061970 Ga0070713_1000619702 394
188 3300005437 Ga0070710_10021544 Ga0070710_100215442 394
189 3300005439 Ga0070711_100008555 Ga0070711_1000085557 394
190 3300005459 Ga0068867_100002215 Ga0068867_1000022153 394
191 3300005536 Ga0070697_100013087 Ga0070697_1000130875 394
192 3300005577 Ga0068857_100037354 Ga0068857_1000373544 394
193 3300005617 Ga0068859_100001195 Ga0068859_1000011959 394
194 3300005618 Ga0068864_100007875 Ga0068864_1000078752 394
195 3300005719 Ga0068861_100007348 Ga0068861_1000073486 394
196 3300005840 Ga0068870_10003820 Ga0068870_100038204 394
197 3300005841 Ga0068863_100018582 Ga0068863_1000185824 394
198 3300005842 Ga0068858_100002336 Ga0068858_1000023366 394
199 3300005843 Ga0068860_100001162 Ga0068860_10000116214 394
200 3300005844 Ga0068862_100004121 Ga0068862_1000041214 394
201 3300006028 Ga0070717_10026552 Ga0070717_100265524 394
202 3300006175 Ga0070712_100012740 Ga0070712_1000127407 394
203 3300006175 Ga0070712_100018230 Ga0070712_1000182303 394
204 3300006931 Ga0097620_100001195 Ga0097620_10000119510 394
205 3300009094 Ga0111539_10474630 Ga0111539_104746302 394
206 3300013308 Ga0157375_10066030 Ga0157375_100660303 394
207 3300014325 Ga0163163_10001519 Ga0163163_100015192 394
208 3300014326 Ga0157380_10045903 Ga0157380_100459033 394
209 3300014968 Ga0157379_10000156 Ga0157379_1000015614 394
210 3300025905 Ga0207685_10084058 Ga0207685_100840581 394
211 3300025906 Ga0207699_10015851 Ga0207699_100158513 394
212 3300025910 Ga0207684_10110633 Ga0207684_101106332 394
213 3300025915 Ga0207693_10009806 Ga0207693_100098063 394
214 3300025915 Ga0207693_10092049 Ga0207693_100920493 394
215 3300025916 Ga0207663_10051880 Ga0207663_100518802 394
216 3300039437 Ga0436365_0920134 Ga0436365_0920134_2138_3352 394
217 3300048912 Ga0496109_0229306 Ga0496109_0229306_300_1517 394
218 3300003316 rootH1_10118372 rootH1_101183722 395
219 3300005546 Ga0070696_100032711 Ga0070696_1000327111 395
220 3300009148 Ga0105243_10170278 Ga0105243_101702782 395
221 3300025298 Ga0209050_1001219 Ga0209050_100121931 395
222 3300025908 Ga0207643_10008929 Ga0207643_100089292 395
223 3300025912 Ga0207707_10034293 Ga0207707_100342933 395
224 3300025925 Ga0207650_10000871 Ga0207650_100008717 395
225 3300025942 Ga0207689_10000905 Ga0207689_1000090512 395
226 3300025960 Ga0207651_10002800 Ga0207651_100028007 395
227 3300025961 Ga0207712_10035959 Ga0207712_100359591 395
228 3300025972 Ga0207668_10006192 Ga0207668_100061926 395
229 3300025986 Ga0207658_10019281 Ga0207658_100192813 395
230 3300026035 Ga0207703_10000595 Ga0207703_1000059525 395
231 3300026088 Ga0207641_10022333 Ga0207641_100223332 395
232 3300026089 Ga0207648_10000762 Ga0207648_100007627 395
233 3300026095 Ga0207676_10000867 Ga0207676_100008672 395
234 3300026116 Ga0207674_10053654 Ga0207674_100536543 395
235 3300026118 Ga0207675_100013813 Ga0207675_1000138133 395
236 3300028380 Ga0268265_10001575 Ga0268265_100015754 395
237 3300028381 Ga0268264_10001114 Ga0268264_100011147 395
238 3300039453 Ga0436362_0644872 Ga0436362_0644872_944_2146 395
239 3300042876 Ga0451577_0187677 Ga0451577_0187677_392_1633 395
240 3300046492 Ga0495585_0000070 Ga0495585_0000070_65058_66257 395
241 3300046691 Ga0495670_0095902 Ga0495670_0095902_155_1354 395
242 3300048905 Ga0496102_0005885 Ga0496102_0005885_2986_4206 395
243 3300048906 Ga0496103_0028099 Ga0496103_0028099_121_1341 395
244 3300048909 Ga0496106_0101393 Ga0496106_0101393_72_1292 395
245 3300048919 Ga0496116_0002041 Ga0496116_0002041_1412_2608 395
246 3300048924 Ga0496121_0004254 Ga0496121_0004254_1234_2508 395
247 3300048924 Ga0496121_0032207 Ga0496121_0032207_2199_3395 395
248 3300048925 Ga0496122_0000021 Ga0496122_0000021_323223_324419 395
249 3300048926 Ga0496123_0000174 Ga0496123_0000174_74927_76123 395
250 3300049575 Ga0501039_0053640 Ga0501039_0053640_1656_2849 395
251 3300049576 Ga0501040_0086159 Ga0501040_0086159_339_1532 395
252 3300049588 Ga0501072_0043090 Ga0501072_0043090_13_1206 395
253 3300049591 Ga0501075_0119952 Ga0501075_0119952_535_1728 395
254 3300049592 Ga0501076_0025111 Ga0501076_0025111_66_1259 395
255 3300049593 Ga0501077_0021111 Ga0501077_0021111_1732_2925 395
256 3300049743 Ga0501081_0086875 Ga0501081_0086875_406_1599 395
257 3300060353 Ga0501082_0023778 Ga0501082_0023778_1717_2910 395
258 3300061734 Ga0530510_0056126 Ga0530510_0056126_185_1378 395
259 3300009094 Ga0111539_10204994 Ga0111539_102049941 396
260 3300021388 Ga0213875_10000011 Ga0213875_10000011292 396
261 3300037853 Ga0436364_0754076 Ga0436364_0754076_11852_13057 396
262 3300048088 Ga0495602_0069453 Ga0495602_0069453_53_1264 396
263 3300048909 Ga0496106_0046382 Ga0496106_0046382_1108_2316 396
264 3300048917 Ga0496114_0215340 Ga0496114_0215340_316_1524 396
265 3300054114 Ga0501084_0202018 Ga0501084_0202018_271_1473 396
266 3300005288 Ga0065714_10006356 Ga0065714_100063563 397
267 3300005344 Ga0070661_100042473 Ga0070661_1000424732 397
268 3300005347 Ga0070668_100034883 Ga0070668_1000348832 397
269 3300005353 Ga0070669_100044963 Ga0070669_1000449632 397
270 3300005530 Ga0070679_100012385 Ga0070679_1000123853 397
271 3300005530 Ga0070679_100028486 Ga0070679_1000284863 397
272 3300005539 Ga0068853_100029855 Ga0068853_1000298554 397
273 3300005563 Ga0068855_100069451 Ga0068855_1000694513 397
274 3300005564 Ga0070664_100012190 Ga0070664_1000121905 397
275 3300005985 Ga0081539_10007928 Ga0081539_100079286 397
276 3300013100 Ga0157373_10028685 Ga0157373_100286852 397
277 3300013104 Ga0157370_10015498 Ga0157370_100154984 397
278 3300013307 Ga0157372_10007797 Ga0157372_100077975 397
279 3300014326 Ga0157380_10039998 Ga0157380_100399982 397
280 3300025920 Ga0207649_10086374 Ga0207649_100863742 397
281 3300025923 Ga0207681_10009205 Ga0207681_100092052 397
282 3300025940 Ga0207691_10097767 Ga0207691_100977671 397
283 3300025945 Ga0207679_10082685 Ga0207679_100826852 397
284 3300025949 Ga0207667_10094825 Ga0207667_100948252 397
285 3300025972 Ga0207668_10003032 Ga0207668_100030324 397
286 3300036401 Ga0373937_0042555 Ga0373937_0042555_1570_2778 397
287 3300046453 Ga0495627_006947 Ga0495627_006947_1304_2509 397
288 3300046460 Ga0495638_0004189 Ga0495638_0004189_5119_6324 397
289 3300046492 Ga0495585_0002310 Ga0495585_0002310_1881_3086 397
290 3300046499 Ga0495594_0017420 Ga0495594_0017420_2489_3694 397
291 3300046506 Ga0495583_0070457 Ga0495583_0070457_110_1315 397
292 3300046507 Ga0495606_0036075 Ga0495606_0036075_2137_3342 397
293 3300046518 Ga0495631_0021919 Ga0495631_0021919_929_2134 397
294 3300046518 Ga0495631_0044505 Ga0495631_0044505_415_1620 397
295 3300046519 Ga0495632_0052887 Ga0495632_0052887_504_1709 397
296 3300046525 Ga0495663_0007510 Ga0495663_0007510_123_1328 397
297 3300046528 Ga0495642_0008031 Ga0495642_0008031_1569_2774 397
298 3300046542 Ga0495597_0009226 Ga0495597_0009226_3221_4426 397
299 3300046543 Ga0495645_0089425 Ga0495645_0089425_304_1509 397
300 3300046558 Ga0495633_0082544 Ga0495633_0082544_138_1343 397
301 3300046616 Ga0495668_0003146 Ga0495668_0003146_8371_9576 397
302 3300046648 Ga0495611_0002422 Ga0495611_0002422_1603_2808 397
303 3300046660 Ga0495625_0023691 Ga0495625_0023691_1275_2480 397
304 3300046660 Ga0495625_0024315 Ga0495625_0024315_2341_3546 397
305 3300047321 Ga0495676_0014845 Ga0495676_0014845_2114_3319 397
306 3300047445 Ga0495677_0002049 Ga0495677_0002049_2619_3824 397
307 3300047445 Ga0495677_0011499 Ga0495677_0011499_1118_2323 397
308 3300047470 Ga0495681_0031312 Ga0495681_0031312_729_1934 397
309 3300049460 Ga0495682_0009527 Ga0495682_0009527_706_1911 397
310 3300049586 Ga0501070_0007769 Ga0501070_0007769_5982_7187 397
311 3300049589 Ga0501073_0009222 Ga0501073_0009222_4779_5984 397
312 3300049744 Ga0501083_0003894 Ga0501083_0003894_1164_2369 397
313 3300060353 Ga0501082_0226392 Ga0501082_0226392_303_1508 397
314 3300014325 Ga0163163_10146329 Ga0163163_101463292 398
315 3300025916 Ga0207663_10049495 Ga0207663_100494952 398
316 3300046528 Ga0495642_0001905 Ga0495642_0001905_398_1606 398
317 3300046538 Ga0495609_0095538 Ga0495609_0095538_62_1270 398
318 3300046542 Ga0495597_0010825 Ga0495597_0010825_2150_3358 398
319 3300046679 Ga0495623_0067653 Ga0495623_0067653_891_2099 398
320 3300047317 Ga0495604_0018363 Ga0495604_0018363_475_1683 398
321 3300048091 Ga0495626_0000792 Ga0495626_0000792_13190_14398 398
322 3300005347 Ga0070668_100019831 Ga0070668_1000198312 399
323 3300005353 Ga0070669_100276755 Ga0070669_1002767551 399
324 3300005843 Ga0068860_100018897 Ga0068860_1000188973 399
325 3300009177 Ga0105248_10175569 Ga0105248_101755692 399
326 3300025938 Ga0207704_10030354 Ga0207704_100303543 399
327 3300026035 Ga0207703_10136793 Ga0207703_101367932 399
328 3300026089 Ga0207648_10049622 Ga0207648_100496222 399
329 3300028381 Ga0268264_10007843 Ga0268264_100078433 399
330 3300005329 Ga0070683_100040826 Ga0070683_1000408264 400
331 3300005330 Ga0070690_100017811 Ga0070690_1000178112 400
332 3300005331 Ga0070670_100014777 Ga0070670_1000147776 400
333 3300005331 Ga0070670_100038332 Ga0070670_1000383324 400
334 3300005331 Ga0070670_100321629 Ga0070670_1003216291 400
335 3300005333 Ga0070677_10037504 Ga0070677_100375042 400
336 3300005335 Ga0070666_10016572 Ga0070666_100165722 400
337 3300005335 Ga0070666_10026969 Ga0070666_100269694 400
338 3300005337 Ga0070682_100044265 Ga0070682_1000442652 400
339 3300005339 Ga0070660_100032108 Ga0070660_1000321081 400
340 3300005340 Ga0070689_100014168 Ga0070689_1000141685 400
341 3300005347 Ga0070668_100031659 Ga0070668_1000316591 400
342 3300005347 Ga0070668_100217232 Ga0070668_1002172321 400
343 3300005354 Ga0070675_100009451 Ga0070675_1000094514 400
344 3300005354 Ga0070675_100107154 Ga0070675_1001071541 400
345 3300005356 Ga0070674_100125911 Ga0070674_1001259112 400
346 3300005356 Ga0070674_100158589 Ga0070674_1001585892 400
347 3300005364 Ga0070673_100005875 Ga0070673_1000058752 400
348 3300005365 Ga0070688_100000814 Ga0070688_10000081413 400
349 3300005365 Ga0070688_100180442 Ga0070688_1001804421 400
350 3300005367 Ga0070667_100113627 Ga0070667_1001136272 400
351 3300005367 Ga0070667_100142414 Ga0070667_1001424142 400
352 3300005367 Ga0070667_100230627 Ga0070667_1002306271 400
353 3300005434 Ga0070709_10039869 Ga0070709_100398692 400
354 3300005435 Ga0070714_100091600 Ga0070714_1000916002 400
355 3300005436 Ga0070713_100000039 Ga0070713_10000003971 400
356 3300005436 Ga0070713_100041327 Ga0070713_1000413272 400
357 3300005436 Ga0070713_100214895 Ga0070713_1002148952 400
358 3300005439 Ga0070711_100019511 Ga0070711_1000195112 400
359 3300005439 Ga0070711_100113255 Ga0070711_1001132552 400
360 3300005440 Ga0070705_100031777 Ga0070705_1000317772 400
361 3300005445 Ga0070708_100000818 Ga0070708_10000081814 400
362 3300005456 Ga0070678_100000991 Ga0070678_1000009913 400
363 3300005466 Ga0070685_10009162 Ga0070685_100091622 400
364 3300005518 Ga0070699_100062841 Ga0070699_1000628412 400
365 3300005535 Ga0070684_100098560 Ga0070684_1000985602 400
366 3300005543 Ga0070672_100007989 Ga0070672_1000079895 400
367 3300005543 Ga0070672_100073509 Ga0070672_1000735092 400
368 3300005543 Ga0070672_100245810 Ga0070672_1002458102 400
369 3300005547 Ga0070693_100002942 Ga0070693_1000029422 400
370 3300005548 Ga0070665_100018445 Ga0070665_1000184452 400
371 3300005548 Ga0070665_100041396 Ga0070665_1000413962 400
372 3300005615 Ga0070702_100008195 Ga0070702_1000081952 400
373 3300005618 Ga0068864_100000836 Ga0068864_1000008366 400
374 3300005719 Ga0068861_100037494 Ga0068861_1000374943 400
375 3300005834 Ga0068851_10047297 Ga0068851_100472971 400
376 3300005841 Ga0068863_100060640 Ga0068863_1000606402 400
377 3300005842 Ga0068858_100002758 Ga0068858_1000027584 400
378 3300005843 Ga0068860_100023120 Ga0068860_1000231205 400
379 3300005843 Ga0068860_100057122 Ga0068860_1000571224 400
380 3300005843 Ga0068860_100150694 Ga0068860_1001506942 400
381 3300005844 Ga0068862_100025598 Ga0068862_1000255985 400
382 3300006175 Ga0070712_100007146 Ga0070712_1000071464 400
383 3300009093 Ga0105240_10041376 Ga0105240_100413765 400
384 3300009098 Ga0105245_10023939 Ga0105245_100239395 400
385 3300011119 Ga0105246_10101442 Ga0105246_101014422 400
386 3300013104 Ga0157370_10038560 Ga0157370_100385602 400
387 3300013296 Ga0157374_10003153 Ga0157374_100031537 400
388 3300013308 Ga0157375_10004445 Ga0157375_100044458 400
389 3300013308 Ga0157375_10094933 Ga0157375_100949333 400
390 3300014325 Ga0163163_10031646 Ga0163163_100316463 400
391 3300014968 Ga0157379_10127190 Ga0157379_101271902 400
392 3300025321 Ga0207656_10072958 Ga0207656_100729581 400
393 3300025893 Ga0207682_10020887 Ga0207682_100208872 400
394 3300025903 Ga0207680_10053062 Ga0207680_100530622 400
395 3300025903 Ga0207680_10067983 Ga0207680_100679832 400
396 3300025905 Ga0207685_10010174 Ga0207685_100101742 400
397 3300025906 Ga0207699_10053788 Ga0207699_100537882 400
398 3300025907 Ga0207645_10026027 Ga0207645_100260272 400
399 3300025915 Ga0207693_10081715 Ga0207693_100817152 400
400 3300025919 Ga0207657_10002457 Ga0207657_1000245712 400
401 3300025925 Ga0207650_10078380 Ga0207650_100783802 400
402 3300025926 Ga0207659_10005664 Ga0207659_100056644 400
403 3300025928 Ga0207700_10000120 Ga0207700_1000012035 400
404 3300025928 Ga0207700_10027995 Ga0207700_100279952 400
405 3300025928 Ga0207700_10048370 Ga0207700_100483703 400
406 3300025929 Ga0207664_10002996 Ga0207664_100029962 400
407 3300025931 Ga0207644_10008406 Ga0207644_100084063 400
408 3300025933 Ga0207706_10058157 Ga0207706_100581572 400
409 3300025936 Ga0207670_10014556 Ga0207670_100145562 400
410 3300025937 Ga0207669_10049948 Ga0207669_100499483 400
411 3300025937 Ga0207669_10235091 Ga0207669_102350911 400
412 3300025939 Ga0207665_10036446 Ga0207665_100364462 400
413 3300025939 Ga0207665_10053311 Ga0207665_100533111 400
414 3300025940 Ga0207691_10146841 Ga0207691_101468412 400
415 3300025941 Ga0207711_10000116 Ga0207711_100001167 400
416 3300025960 Ga0207651_10064408 Ga0207651_100644082 400
417 3300025960 Ga0207651_10077126 Ga0207651_100771262 400
418 3300025972 Ga0207668_10082181 Ga0207668_100821812 400
419 3300025986 Ga0207658_10007272 Ga0207658_100072726 400
420 3300025986 Ga0207658_10091623 Ga0207658_100916233 400
421 3300025986 Ga0207658_10255881 Ga0207658_102558812 400
422 3300026023 Ga0207677_10000188 Ga0207677_1000018825 400
423 3300026023 Ga0207677_10081527 Ga0207677_100815272 400
424 3300026035 Ga0207703_10000806 Ga0207703_1000080625 400
425 3300026067 Ga0207678_10079420 Ga0207678_100794202 400
426 3300026078 Ga0207702_10036658 Ga0207702_100366582 400
427 3300026088 Ga0207641_10037558 Ga0207641_100375582 400
428 3300026095 Ga0207676_10000230 Ga0207676_1000023019 400
429 3300026116 Ga0207674_10058812 Ga0207674_100588122 400
430 3300026118 Ga0207675_100072207 Ga0207675_1000722073 400
431 3300026121 Ga0207683_10001221 Ga0207683_1000122112 400
432 3300028379 Ga0268266_10176494 Ga0268266_101764942 400
433 3300028380 Ga0268265_10060750 Ga0268265_100607502 400
434 3300031235 Ga0265330_10007182 Ga0265330_100071824 400
435 3300031238 Ga0265332_10000776 Ga0265332_100007769 400
436 3300031239 Ga0265328_10035441 Ga0265328_100354411 400
437 3300031241 Ga0265325_10039806 Ga0265325_100398061 400
438 3300031242 Ga0265329_10005639 Ga0265329_100056392 400
439 3300031250 Ga0265331_10000464 Ga0265331_1000046416 400
440 3300031344 Ga0265316_10030543 Ga0265316_100305431 400
441 3300031711 Ga0265314_10022532 Ga0265314_100225322 400
442 3300035083 Ga0373926_0035183 Ga0373926_0035183_447_1670 400
443 3300035086 Ga0373934_0010580 Ga0373934_0010580_2013_3287 400
444 3300035116 Ga0373945_0034959 Ga0373945_0034959_95_1366 400
445 3300035117 Ga0373953_0006271 Ga0373953_0006271_2475_3749 400
446 3300035692 Ga0373935_0019629 Ga0373935_0019629_1152_2423 400
447 3300035692 Ga0373935_0086040 Ga0373935_0086040_645_1886 400
448 3300035725 Ga0373947_0023666 Ga0373947_0023666_2073_3296 400
449 3300036401 Ga0373937_0011991 Ga0373937_0011991_5579_6802 400
450 3300036401 Ga0373937_0023672 Ga0373937_0023672_1561_2802 400
451 3300036401 Ga0373937_0167934 Ga0373937_0167934_211_1428 400
452 3300037068 Ga0373925_0074644 Ga0373925_0074644_779_2002 400
453 3300046454 Ga0495592_0201963 Ga0495592_0201963_34_1308 400
454 3300046472 Ga0495580_0146033 Ga0495580_0146033_243_1466 400
455 3300046511 Ga0495608_0070933 Ga0495608_0070933_457_1731 400
456 3300046680 Ga0495646_0114673 Ga0495646_0114673_213_1487 400
457 3300046683 Ga0495658_0003752 Ga0495658_0003752_4620_5843 400
458 3300046689 Ga0495613_0068879 Ga0495613_0068879_459_1682 400
459 3300047315 Ga0495581_0004852 Ga0495581_0004852_497_1720 400
460 3300048905 Ga0496102_0202279 Ga0496102_0202279_347_1621 400
461 3300048907 Ga0496104_0009253 Ga0496104_0009253_506_1729 400
462 3300048910 Ga0496107_0101400 Ga0496107_0101400_60_1334 400
463 3300048911 Ga0496108_0052651 Ga0496108_0052651_648_1871 400
464 3300048915 Ga0496112_0043423 Ga0496112_0043423_2048_3271 400
465 3300046542 Ga0495597_0038596 Ga0495597_0038596_69_1292 401
466 3300003187 JGI25151J46595_10002421 JGI25151J46595_100024216 402
467 3300003771 Ga0055526_1007501 Ga0055526_10075015 402
468 3300003771 Ga0055526_1010796 Ga0055526_10107962 402
469 3300003773 Ga0055537_1002687 Ga0055537_10026871 402
470 3300003781 Ga0055536_1000078 Ga0055536_100007816 402
471 3300003784 Ga0055534_1000733 Ga0055534_10007332 402
472 3300003784 Ga0055534_1001294 Ga0055534_10012944 402
473 3300025263 Ga0209565_1000821 Ga0209565_100082115 402
474 3300025273 Ga0209673_1008548 Ga0209673_10085484 402
475 3300025284 Ga0209130_1013923 Ga0209130_10139232 402
476 3300025291 Ga0209675_1000087 Ga0209675_100008717 402
477 3300025291 Ga0209675_1005735 Ga0209675_10057352 402
478 3300025292 Ga0209676_1000176 Ga0209676_100017667 402
479 3300025294 Ga0209025_1000046 Ga0209025_1000046104 402
480 3300025295 Ga0209564_1000166 Ga0209564_1000166138 402
481 3300025295 Ga0209564_1001192 Ga0209564_100119217 402
482 3300025295 Ga0209564_1001289 Ga0209564_100128921 402
483 3300025299 Ga0209256_1004743 Ga0209256_10047434 402
484 3300037466 Ga0395898_0154686 Ga0395898_0154686_794_2029 402
485 3300046457 Ga0495590_0000380 Ga0495590_0000380_14437_15672 402
486 3300046473 Ga0495582_0015426 Ga0495582_0015426_1788_3023 402
487 3300046491 Ga0495584_0044575 Ga0495584_0044575_814_2061 402
488 3300046499 Ga0495594_0032145 Ga0495594_0032145_603_1838 402
489 3300046506 Ga0495583_0065791 Ga0495583_0065791_97_1332 402
490 3300046526 Ga0495666_0001609 Ga0495666_0001609_3442_4677 402
491 3300046526 Ga0495666_0009587 Ga0495666_0009587_1969_3204 402
492 3300046531 Ga0495665_0003474 Ga0495665_0003474_6628_7863 402
493 3300046535 Ga0495586_0051765 Ga0495586_0051765_346_1581 402
494 3300046557 Ga0495622_0001954 Ga0495622_0001954_743_1978 402
495 3300046642 Ga0495634_0111868 Ga0495634_0111868_394_1629 402
496 3300046660 Ga0495625_0010540 Ga0495625_0010540_3154_4389 402
497 3300046663 Ga0495635_0013697 Ga0495635_0013697_4084_5331 402
498 3300046665 Ga0495661_0115020 Ga0495661_0115020_193_1428 402
499 3300046674 Ga0495588_0007786 Ga0495588_0007786_429_1664 402
500 3300046679 Ga0495623_0010407 Ga0495623_0010407_3331_4578 402
501 3300046690 Ga0495624_0011383 Ga0495624_0011383_3290_4525 402
502 3300047315 Ga0495581_0006624 Ga0495581_0006624_5327_6562 402
503 3300047317 Ga0495604_0007005 Ga0495604_0007005_6916_8151 402
504 3300047322 Ga0495680_0010916 Ga0495680_0010916_552_1799 402
505 3300047444 Ga0495675_0036457 Ga0495675_0036457_1507_2742 402
506 3300048089 Ga0495614_0005446 Ga0495614_0005446_3960_5207 402
507 3300048910 Ga0496107_0028147 Ga0496107_0028147_2715_3950 402

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

45

370

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pk3-assembly1.cif.gz_B alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana 0.9809 6 391
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.958 13 373
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.95 13 373
2dr1-assembly1.cif.gz_B crystal structure of the ph1308 protein from pyrococcus horikoshii ot3 0.9482 11 372
6pk3-assembly1.cif.gz_B alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana 0.9447 6 391
ID Description Score Start End Superfamily
af_A0A1D6KIG3_10_230_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9808 23 239 3.40.640.10
af_B6T171_24_270_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9743 26 266 3.40.640.10
af_A0A1D6KIH4_267_382_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9733 278 391 3.90.1150.10
af_A0A1D6KIG3_10_230_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.959 23 239 3.40.640.10
af_Q2FXK2_10_249_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9585 17 255 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A352SDU8-F1-model_v4 Serine--glyoxylate aminotransferase 0.9993 146 385 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A2E9NWN9-F1-model_v4 Serine--glyoxylate aminotransferase 0.9976 38 390 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A7W7VCS5-F1-model_v4 Alanine-glyoxylate transaminase/serine-glyoxylate transaminase/serine-pyruvate transaminase (EC 2.6.1.44, EC 2.6.1.45, EC 2.6.1.51) 0.9968 27 391 GO:0004760
GO:0005777
GO:0008453
GO:0019265
GO:0050281
AF-A0A7X5WJ28-F1-model_v4 deleted 0.9966 134 222
AF-A0A382KT89-F1-model_v4 Aminotransferase class V domain-containing protein 0.996 142 391 GO:0004760
GO:0005777
GO:0008453
GO:0019265

Feature Viewer

pLDDT pTM Quality
94.63 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map