F456652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 507 | 310 | 498 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100150694|Ga0068860_1001506942 |
| Length | 438 |
| Sequence | MPLAWHRSISLHYVLYTKSGAAAAHVGSILGARMFKLDSHPSGRHFLQIPGPTNVPDRVLRAMDQPTIDHRGPEFAQLTKEILDGLRPVFQTTSPVVIYAASGTGAWEAALVNTLSPGDRVLMFETGHFATLWRAMAEKLGLVVDFVPGDWRSGVDPAVLEAKLAEDRAHAIKAVMAVHNETSTGVTSRIPALRQAIDRTAHPALFMVDTISSLASIDYRHDEWGVDVTVAGSQKGLMLPPGISFNAVSDKAIAASKQAKLPRSYWRWDETMAMNRQGYFPSTPATNLLYGLHEALAMLHEEGLPNVFARHQRHAEATRRAVRGWGLEILCRNPAEYSGSLTAVMMPDGHDADAFRRDVLDRFDMSLGTGLGKLGGRVFRIGHLGFFNDLMLCGTLCGVEMGLALRNVPHQSNGVAAALAYLAAAGATADKAAHRRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 2 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 3 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 4 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 5 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 6 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 7 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 275 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 276 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 277 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 278 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 299 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 301 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 302 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 303 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 304 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 305 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 309 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 310 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.22 |
| Metatranscriptomes | 0 |
| Isolates | 1.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.52 |
| Nodule | 0.2 |
| Rhizoplane | 4.34 |
| Rhizosphere | 83.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10002421 | 3300003187 | Bacteria | 11250 |
| 2 | rootH1_10118372 | 3300003316 | Bacteria | 3303 |
| 3 | Ga0055526_1007501 | 3300003771 | Bacteria | 5652 |
| 4 | Ga0055526_1010796 | 3300003771 | Bacteria | 4202 |
| 5 | Ga0055537_1002687 | 3300003773 | Bacteria | 5802 |
| 6 | Ga0055536_1000078 | 3300003781 | Bacteria | 83510 |
| 7 | Ga0055534_1000733 | 3300003784 | Bacteria | 15839 |
| 8 | Ga0055534_1001294 | 3300003784 | Bacteria | 10127 |
| 9 | Ga0065714_10006356 | 3300005288 | Bacteria | 3901 |
| 10 | Ga0065712_10085128 | 3300005290 | Bacteria | 2717 |
| 11 | Ga0070683_100040826 | 3300005329 | Bacteria | 4266 |
| 12 | Ga0070690_100017811 | 3300005330 | Bacteria | 4281 |
| 13 | Ga0070670_100000953 | 3300005331 | Bacteria | 22667 |
| 14 | Ga0070670_100014777 | 3300005331 | Bacteria | 6700 |
| 15 | Ga0070670_100038332 | 3300005331 | Bacteria | 4122 |
| 16 | Ga0070670_100321629 | 3300005331 | Bacteria | 1356 |
| 17 | Ga0070677_10037504 | 3300005333 | Bacteria | 1891 |
| 18 | Ga0068869_100000255 | 3300005334 | Bacteria | 28046 |
| 19 | Ga0070666_10016572 | 3300005335 | Bacteria | 4715 |
| 20 | Ga0070666_10026969 | 3300005335 | Bacteria | 3758 |
| 21 | Ga0070682_100044265 | 3300005337 | Bacteria | 2755 |
| 22 | Ga0070660_100032108 | 3300005339 | Bacteria | 3949 |
| 23 | Ga0070689_100014168 | 3300005340 | Bacteria | 5787 |
| 24 | Ga0070661_100042473 | 3300005344 | Bacteria | 3318 |
| 25 | Ga0070668_100019831 | 3300005347 | Bacteria | 5066 |
| 26 | Ga0070668_100031659 | 3300005347 | Bacteria | 4024 |
| 27 | Ga0070668_100034883 | 3300005347 | Bacteria | 3834 |
| 28 | Ga0070668_100217232 | 3300005347 | Bacteria | 1575 |
| 29 | Ga0070669_100044963 | 3300005353 | Bacteria | 3217 |
| 30 | Ga0070669_100276755 | 3300005353 | Bacteria | 1344 |
| 31 | Ga0070675_100009451 | 3300005354 | Bacteria | 7589 |
| 32 | Ga0070675_100107154 | 3300005354 | Bacteria | 2360 |
| 33 | Ga0070671_100065325 | 3300005355 | Bacteria | 3030 |
| 34 | Ga0070674_100125911 | 3300005356 | Bacteria | 1903 |
| 35 | Ga0070674_100158589 | 3300005356 | Bacteria | 1715 |
| 36 | Ga0070673_100005875 | 3300005364 | Bacteria | 7915 |
| 37 | Ga0070673_100040913 | 3300005364 | Bacteria | 3559 |
| 38 | Ga0070688_100000814 | 3300005365 | Bacteria | 15398 |
| 39 | Ga0070688_100180442 | 3300005365 | Bacteria | 1464 |
| 40 | Ga0070667_100003769 | 3300005367 | Bacteria | 12877 |
| 41 | Ga0070667_100113627 | 3300005367 | Bacteria | 2350 |
| 42 | Ga0070667_100142414 | 3300005367 | Bacteria | 2101 |
| 43 | Ga0070667_100230627 | 3300005367 | Bacteria | 1651 |
| 44 | Ga0070709_10039869 | 3300005434 | Bacteria | 2884 |
| 45 | Ga0070709_10059538 | 3300005434 | Bacteria | 2425 |
| 46 | Ga0070714_100006675 | 3300005435 | Bacteria | 8932 |
| 47 | Ga0070714_100010042 | 3300005435 | Bacteria | 7469 |
| 48 | Ga0070714_100091600 | 3300005435 | Bacteria | 2664 |
| 49 | Ga0070713_100000039 | 3300005436 | Bacteria | 83384 |
| 50 | Ga0070713_100003780 | 3300005436 | Bacteria | 10021 |
| 51 | Ga0070713_100041327 | 3300005436 | Bacteria | 3756 |
| 52 | Ga0070713_100061970 | 3300005436 | Bacteria | 3131 |
| 53 | Ga0070713_100089626 | 3300005436 | Unclassified | 2642 |
| 54 | Ga0070713_100214895 | 3300005436 | Bacteria | 1742 |
| 55 | Ga0070710_10021544 | 3300005437 | Bacteria | 3360 |
| 56 | Ga0070711_100008555 | 3300005439 | Bacteria | 6273 |
| 57 | Ga0070711_100019511 | 3300005439 | Bacteria | 4350 |
| 58 | Ga0070711_100113255 | 3300005439 | Bacteria | 1994 |
| 59 | Ga0070705_100031777 | 3300005440 | Bacteria | 2927 |
| 60 | Ga0070708_100000818 | 3300005445 | Bacteria | 23467 |
| 61 | Ga0070708_100004729 | 3300005445 | Bacteria | 10731 |
| 62 | Ga0070708_100072430 | 3300005445 | Bacteria | 3105 |
| 63 | Ga0070708_100192912 | 3300005445 | Bacteria | 1906 |
| 64 | Ga0070678_100000991 | 3300005456 | Bacteria | 14681 |
| 65 | Ga0070681_10040583 | 3300005458 | Bacteria | 4662 |
| 66 | Ga0068867_100002215 | 3300005459 | Bacteria | 13640 |
| 67 | Ga0070685_10009162 | 3300005466 | Bacteria | 5109 |
| 68 | Ga0070706_100000907 | 3300005467 | Bacteria | 32408 |
| 69 | Ga0070706_100199858 | 3300005467 | Bacteria | 1867 |
| 70 | Ga0070707_100012317 | 3300005468 | Bacteria | 7985 |
| 71 | Ga0070707_100089746 | 3300005468 | Bacteria | 2974 |
| 72 | Ga0070698_100075628 | 3300005471 | Bacteria | 3371 |
| 73 | Ga0070698_100148025 | 3300005471 | Bacteria | 2297 |
| 74 | Ga0070699_100008847 | 3300005518 | Bacteria | 8719 |
| 75 | Ga0070699_100062841 | 3300005518 | Bacteria | 3219 |
| 76 | Ga0070679_100012385 | 3300005530 | Bacteria | 8149 |
| 77 | Ga0070679_100028486 | 3300005530 | Bacteria | 5507 |
| 78 | Ga0070684_100098560 | 3300005535 | Bacteria | 2607 |
| 79 | Ga0070697_100013087 | 3300005536 | Bacteria | 6503 |
| 80 | Ga0068853_100029855 | 3300005539 | Bacteria | 4599 |
| 81 | Ga0070672_100007989 | 3300005543 | Bacteria | 7225 |
| 82 | Ga0070672_100073509 | 3300005543 | Bacteria | 2725 |
| 83 | Ga0070672_100245810 | 3300005543 | Bacteria | 1506 |
| 84 | Ga0070696_100032711 | 3300005546 | Bacteria | 3569 |
| 85 | Ga0070693_100002942 | 3300005547 | Bacteria | 7872 |
| 86 | Ga0070665_100018445 | 3300005548 | Bacteria | 6994 |
| 87 | Ga0070665_100041396 | 3300005548 | Bacteria | 4631 |
| 88 | Ga0070704_100000364 | 3300005549 | Bacteria | 20603 |
| 89 | Ga0070704_100001644 | 3300005549 | Bacteria | 12120 |
| 90 | Ga0068855_100069451 | 3300005563 | Bacteria | 4100 |
| 91 | Ga0070664_100012190 | 3300005564 | Bacteria | 6987 |
| 92 | Ga0068857_100037354 | 3300005577 | Bacteria | 4302 |
| 93 | Ga0068856_100337531 | 3300005614 | Bacteria | 1525 |
| 94 | Ga0070702_100008195 | 3300005615 | Bacteria | 5047 |
| 95 | Ga0068859_100001195 | 3300005617 | Bacteria | 26504 |
| 96 | Ga0068864_100000836 | 3300005618 | Bacteria | 25975 |
| 97 | Ga0068864_100007875 | 3300005618 | Bacteria | 8780 |
| 98 | Ga0068866_10003875 | 3300005718 | Bacteria | 6135 |
| 99 | Ga0068861_100007348 | 3300005719 | Bacteria | 7546 |
| 100 | Ga0068861_100037494 | 3300005719 | Bacteria | 3604 |
| 101 | Ga0068851_10047297 | 3300005834 | Bacteria | 2178 |
| 102 | Ga0068870_10003820 | 3300005840 | Bacteria | 6417 |
| 103 | Ga0068863_100018582 | 3300005841 | Bacteria | 6652 |
| 104 | Ga0068863_100060640 | 3300005841 | Bacteria | 3577 |
| 105 | Ga0068863_100229622 | 3300005841 | Bacteria | 1790 |
| 106 | Ga0068858_100002336 | 3300005842 | Bacteria | 19181 |
| 107 | Ga0068858_100002758 | 3300005842 | Bacteria | 17655 |
| 108 | Ga0068860_100001162 | 3300005843 | Bacteria | 28802 |
| 109 | Ga0068860_100018897 | 3300005843 | Bacteria | 6696 |
| 110 | Ga0068860_100023120 | 3300005843 | Bacteria | 6010 |
| 111 | Ga0068860_100057122 | 3300005843 | Bacteria | 3709 |
| 112 | Ga0068860_100124245 | 3300005843 | Bacteria | 2473 |
| 113 | Ga0068860_100150694 | 3300005843 | Bacteria | 2239 |
| 114 | Ga0068862_100004121 | 3300005844 | Bacteria | 12314 |
| 115 | Ga0068862_100025598 | 3300005844 | Bacteria | 4954 |
| 116 | Ga0081540_1046274 | 3300005983 | Bacteria | 2198 |
| 117 | Ga0081539_10007928 | 3300005985 | Bacteria | 9459 |
| 118 | Ga0070717_10026552 | 3300006028 | Bacteria | 4619 |
| 119 | Ga0070717_10088818 | 3300006028 | Bacteria | 2606 |
| 120 | Ga0070715_10021997 | 3300006163 | Bacteria | 2481 |
| 121 | Ga0070712_100007146 | 3300006175 | Bacteria | 6962 |
| 122 | Ga0070712_100012740 | 3300006175 | Bacteria | 5354 |
| 123 | Ga0070712_100018230 | 3300006175 | Bacteria | 4556 |
| 124 | Ga0075428_100007802 | 3300006844 | Bacteria | 11861 |
| 125 | Ga0075428_100011914 | 3300006844 | Bacteria | 9674 |
| 126 | Ga0075431_100001292 | 3300006847 | Bacteria | 22857 |
| 127 | Ga0075433_10251770 | 3300006852 | Bacteria | 1567 |
| 128 | Ga0075429_100010468 | 3300006880 | Bacteria | 8024 |
| 129 | Ga0097620_100001195 | 3300006931 | Bacteria | 26504 |
| 130 | Ga0105240_10041376 | 3300009093 | Bacteria | 5882 |
| 131 | Ga0111539_10007264 | 3300009094 | Bacteria | 14185 |
| 132 | Ga0111539_10204994 | 3300009094 | Bacteria | 2299 |
| 133 | Ga0111539_10474630 | 3300009094 | Bacteria | 1457 |
| 134 | Ga0105245_10003176 | 3300009098 | Bacteria | 14685 |
| 135 | Ga0105245_10023939 | 3300009098 | Bacteria | 5359 |
| 136 | Ga0105245_10077358 | 3300009098 | Bacteria | 3033 |
| 137 | Ga0105243_10170278 | 3300009148 | Bacteria | 1885 |
| 138 | Ga0105248_10175569 | 3300009177 | Bacteria | 2415 |
| 139 | Ga0099796_10004294 | 3300010159 | Bacteria | 3429 |
| 140 | Ga0099796_10015687 | 3300010159 | Bacteria | 2219 |
| 141 | Ga0105239_10343956 | 3300010375 | Bacteria | 1683 |
| 142 | Ga0105246_10101442 | 3300011119 | Bacteria | 2096 |
| 143 | Ga0157373_10028685 | 3300013100 | Bacteria | 4014 |
| 144 | Ga0157370_10015498 | 3300013104 | Bacteria | 7750 |
| 145 | Ga0157370_10038560 | 3300013104 | Bacteria | 4621 |
| 146 | Ga0157369_10020580 | 3300013105 | Bacteria | 7376 |
| 147 | Ga0157374_10003153 | 3300013296 | Bacteria | 13861 |
| 148 | Ga0157378_10015124 | 3300013297 | Bacteria | 6756 |
| 149 | Ga0157372_10007797 | 3300013307 | Bacteria | 11373 |
| 150 | Ga0157375_10004445 | 3300013308 | Bacteria | 12179 |
| 151 | Ga0157375_10066030 | 3300013308 | Bacteria | 3610 |
| 152 | Ga0157375_10094933 | 3300013308 | Bacteria | 3052 |
| 153 | Ga0163163_10001519 | 3300014325 | Bacteria | 19610 |
| 154 | Ga0163163_10031646 | 3300014325 | Bacteria | 5107 |
| 155 | Ga0163163_10146329 | 3300014325 | Bacteria | 2407 |
| 156 | Ga0157380_10039998 | 3300014326 | Bacteria | 3649 |
| 157 | Ga0157380_10045903 | 3300014326 | Bacteria | 3431 |
| 158 | Ga0157379_10000156 | 3300014968 | Bacteria | 50624 |
| 159 | Ga0157379_10127190 | 3300014968 | Bacteria | 2293 |
| 160 | Ga0157376_10156979 | 3300014969 | Bacteria | 2058 |
| 161 | Ga0157376_10229396 | 3300014969 | Bacteria | 1724 |
| 162 | Ga0213872_10002684 | 3300021361 | Bacteria | 10293 |
| 163 | Ga0213872_10008273 | 3300021361 | Bacteria | 5038 |
| 164 | Ga0213876_10024016 | 3300021384 | Archaea | 3219 |
| 165 | Ga0213876_10027648 | 3300021384 | Bacteria | 2992 |
| 166 | Ga0213876_10063016 | 3300021384 | Bacteria | 1957 |
| 167 | Ga0213875_10000011 | 3300021388 | Bacteria | 332447 |
| 168 | Ga0213875_10000677 | 3300021388 | Bacteria | 26752 |
| 169 | Ga0213875_10004931 | 3300021388 | Bacteria | 7246 |
| 170 | Ga0209565_1000821 | 3300025263 | Bacteria | 17655 |
| 171 | Ga0209673_1008548 | 3300025273 | Bacteria | 4546 |
| 172 | Ga0209130_1013923 | 3300025284 | Bacteria | 2040 |
| 173 | Ga0209675_1000087 | 3300025291 | Bacteria | 147632 |
| 174 | Ga0209675_1005735 | 3300025291 | Bacteria | 5126 |
| 175 | Ga0209676_1000176 | 3300025292 | Bacteria | 152347 |
| 176 | Ga0209676_1013522 | 3300025292 | Bacteria | 3134 |
| 177 | Ga0209025_1000046 | 3300025294 | Bacteria | 348962 |
| 178 | Ga0209564_1000166 | 3300025295 | Bacteria | 160208 |
| 179 | Ga0209564_1001192 | 3300025295 | Bacteria | 29807 |
| 180 | Ga0209564_1001289 | 3300025295 | Bacteria | 27413 |
| 181 | Ga0209050_1001219 | 3300025298 | Bacteria | 30024 |
| 182 | Ga0209256_1004743 | 3300025299 | Bacteria | 8304 |
| 183 | Ga0207656_10072958 | 3300025321 | Bacteria | 1529 |
| 184 | Ga0207682_10020887 | 3300025893 | Bacteria | 2573 |
| 185 | Ga0207680_10053062 | 3300025903 | Bacteria | 2432 |
| 186 | Ga0207680_10067983 | 3300025903 | Bacteria | 2197 |
| 187 | Ga0207685_10010174 | 3300025905 | Bacteria | 2764 |
| 188 | Ga0207685_10084058 | 3300025905 | Bacteria | 1324 |
| 189 | Ga0207699_10015851 | 3300025906 | Bacteria | 3926 |
| 190 | Ga0207699_10053788 | 3300025906 | Bacteria | 2389 |
| 191 | Ga0207645_10026027 | 3300025907 | Bacteria | 3783 |
| 192 | Ga0207643_10008929 | 3300025908 | Bacteria | 5383 |
| 193 | Ga0207684_10000506 | 3300025910 | Bacteria | 48735 |
| 194 | Ga0207684_10067786 | 3300025910 | Bacteria | 3033 |
| 195 | Ga0207684_10110633 | 3300025910 | Bacteria | 2351 |
| 196 | Ga0207707_10034293 | 3300025912 | Bacteria | 4440 |
| 197 | Ga0207693_10009806 | 3300025915 | Bacteria | 7796 |
| 198 | Ga0207693_10081715 | 3300025915 | Bacteria | 2530 |
| 199 | Ga0207693_10092049 | 3300025915 | Bacteria | 2377 |
| 200 | Ga0207693_10135896 | 3300025915 | Bacteria | 1933 |
| 201 | Ga0207663_10039412 | 3300025916 | Unclassified | 2863 |
| 202 | Ga0207663_10049495 | 3300025916 | Bacteria | 2607 |
| 203 | Ga0207663_10051880 | 3300025916 | Bacteria | 2556 |
| 204 | Ga0207663_10077589 | 3300025916 | Bacteria | 2163 |
| 205 | Ga0207657_10002457 | 3300025919 | Bacteria | 20027 |
| 206 | Ga0207649_10086374 | 3300025920 | Bacteria | 2044 |
| 207 | Ga0207646_10045906 | 3300025922 | Bacteria | 3920 |
| 208 | Ga0207681_10009205 | 3300025923 | Bacteria | 6035 |
| 209 | Ga0207650_10000871 | 3300025925 | Bacteria | 22892 |
| 210 | Ga0207650_10078380 | 3300025925 | Bacteria | 2500 |
| 211 | Ga0207659_10005664 | 3300025926 | Bacteria | 7600 |
| 212 | Ga0207687_10001854 | 3300025927 | Bacteria | 14548 |
| 213 | Ga0207687_10002728 | 3300025927 | Bacteria | 11957 |
| 214 | Ga0207700_10000120 | 3300025928 | Bacteria | 46325 |
| 215 | Ga0207700_10003220 | 3300025928 | Bacteria | 9426 |
| 216 | Ga0207700_10027995 | 3300025928 | Bacteria | 3954 |
| 217 | Ga0207700_10030893 | 3300025928 | Bacteria | 3799 |
| 218 | Ga0207700_10048370 | 3300025928 | Bacteria | 3157 |
| 219 | Ga0207700_10055746 | 3300025928 | Bacteria | 2971 |
| 220 | Ga0207700_10094868 | 3300025928 | Bacteria | 2365 |
| 221 | Ga0207664_10002996 | 3300025929 | Bacteria | 11219 |
| 222 | Ga0207644_10008406 | 3300025931 | Bacteria | 6756 |
| 223 | Ga0207644_10204193 | 3300025931 | Bacteria | 1560 |
| 224 | Ga0207706_10058157 | 3300025933 | Bacteria | 3406 |
| 225 | Ga0207670_10014556 | 3300025936 | Bacteria | 4674 |
| 226 | Ga0207669_10041984 | 3300025937 | Bacteria | 2666 |
| 227 | Ga0207669_10049948 | 3300025937 | Bacteria | 2497 |
| 228 | Ga0207669_10235091 | 3300025937 | Bacteria | 1355 |
| 229 | Ga0207704_10030354 | 3300025938 | Bacteria | 3030 |
| 230 | Ga0207665_10006265 | 3300025939 | Bacteria | 7897 |
| 231 | Ga0207665_10036446 | 3300025939 | Bacteria | 3271 |
| 232 | Ga0207665_10053311 | 3300025939 | Bacteria | 2726 |
| 233 | Ga0207691_10097767 | 3300025940 | Bacteria | 2623 |
| 234 | Ga0207691_10146841 | 3300025940 | Bacteria | 2076 |
| 235 | Ga0207711_10000116 | 3300025941 | Bacteria | 83390 |
| 236 | Ga0207689_10000905 | 3300025942 | Bacteria | 28455 |
| 237 | Ga0207661_10038636 | 3300025944 | Bacteria | 3742 |
| 238 | Ga0207679_10082685 | 3300025945 | Bacteria | 2459 |
| 239 | Ga0207667_10015937 | 3300025949 | Bacteria | 8512 |
| 240 | Ga0207667_10094825 | 3300025949 | Bacteria | 3081 |
| 241 | Ga0207651_10002800 | 3300025960 | Bacteria | 8384 |
| 242 | Ga0207651_10064408 | 3300025960 | Bacteria | 2565 |
| 243 | Ga0207651_10077126 | 3300025960 | Bacteria | 2385 |
| 244 | Ga0207712_10035959 | 3300025961 | Bacteria | 3370 |
| 245 | Ga0207668_10003032 | 3300025972 | Bacteria | 9844 |
| 246 | Ga0207668_10006192 | 3300025972 | Bacteria | 7062 |
| 247 | Ga0207668_10082181 | 3300025972 | Bacteria | 2339 |
| 248 | Ga0207658_10007272 | 3300025986 | Bacteria | 7550 |
| 249 | Ga0207658_10019281 | 3300025986 | Bacteria | 4716 |
| 250 | Ga0207658_10091623 | 3300025986 | Bacteria | 2359 |
| 251 | Ga0207658_10255881 | 3300025986 | Bacteria | 1490 |
| 252 | Ga0207677_10000188 | 3300026023 | Bacteria | 49751 |
| 253 | Ga0207677_10081527 | 3300026023 | Bacteria | 2322 |
| 254 | Ga0207703_10000595 | 3300026035 | Bacteria | 36837 |
| 255 | Ga0207703_10000806 | 3300026035 | Bacteria | 30873 |
| 256 | Ga0207703_10136793 | 3300026035 | Bacteria | 2122 |
| 257 | Ga0207678_10079420 | 3300026067 | Bacteria | 2809 |
| 258 | Ga0207702_10035425 | 3300026078 | Bacteria | 4173 |
| 259 | Ga0207702_10036658 | 3300026078 | Bacteria | 4102 |
| 260 | Ga0207702_10067543 | 3300026078 | Bacteria | 3069 |
| 261 | Ga0207702_10076393 | 3300026078 | Bacteria | 2895 |
| 262 | Ga0207641_10022333 | 3300026088 | Bacteria | 5208 |
| 263 | Ga0207641_10037558 | 3300026088 | Bacteria | 4045 |
| 264 | Ga0207648_10000762 | 3300026089 | Bacteria | 36143 |
| 265 | Ga0207648_10049622 | 3300026089 | Bacteria | 3672 |
| 266 | Ga0207648_10054451 | 3300026089 | Bacteria | 3494 |
| 267 | Ga0207676_10000230 | 3300026095 | Bacteria | 48620 |
| 268 | Ga0207676_10000867 | 3300026095 | Bacteria | 23441 |
| 269 | Ga0207674_10053654 | 3300026116 | Bacteria | 4108 |
| 270 | Ga0207674_10058812 | 3300026116 | Bacteria | 3892 |
| 271 | Ga0207675_100013813 | 3300026118 | Bacteria | 7530 |
| 272 | Ga0207675_100072207 | 3300026118 | Bacteria | 3228 |
| 273 | Ga0207675_100100959 | 3300026118 | Bacteria | 2718 |
| 274 | Ga0207683_10001221 | 3300026121 | Bacteria | 23317 |
| 275 | Ga0207683_10001896 | 3300026121 | Bacteria | 18497 |
| 276 | Ga0207428_10016833 | 3300027907 | Bacteria | 6283 |
| 277 | Ga0268266_10176494 | 3300028379 | Bacteria | 1942 |
| 278 | Ga0268265_10001575 | 3300028380 | Bacteria | 18908 |
| 279 | Ga0268265_10060750 | 3300028380 | Bacteria | 2897 |
| 280 | Ga0268264_10001114 | 3300028381 | Bacteria | 26569 |
| 281 | Ga0268264_10007843 | 3300028381 | Bacteria | 8887 |
| 282 | Ga0265330_10007182 | 3300031235 | Bacteria | 5455 |
| 283 | Ga0265332_10000776 | 3300031238 | Bacteria | 19556 |
| 284 | Ga0265328_10035441 | 3300031239 | Bacteria | 1845 |
| 285 | Ga0265325_10039806 | 3300031241 | Bacteria | 2472 |
| 286 | Ga0265329_10005639 | 3300031242 | Bacteria | 5039 |
| 287 | Ga0265331_10000464 | 3300031250 | Bacteria | 38987 |
| 288 | Ga0265316_10030543 | 3300031344 | Bacteria | 4415 |
| 289 | Ga0265314_10022532 | 3300031711 | Bacteria | 4825 |
| 290 | Ga0307413_10024823 | 3300031824 | Bacteria | 3275 |
| 291 | Ga0307410_10008737 | 3300031852 | Bacteria | 5637 |
| 292 | Ga0307406_10010410 | 3300031901 | Bacteria | 5243 |
| 293 | Ga0307407_10006384 | 3300031903 | Bacteria | 5230 |
| 294 | Ga0307409_100019701 | 3300031995 | Bacteria | 4576 |
| 295 | Ga0307416_100020365 | 3300032002 | Bacteria | 4731 |
| 296 | Ga0307414_10026145 | 3300032004 | Bacteria | 3752 |
| 297 | Ga0307411_10063344 | 3300032005 | Bacteria | 2471 |
| 298 | Ga0307415_100002155 | 3300032126 | Bacteria | 9756 |
| 299 | Ga0373926_0035183 | 3300035083 | Bacteria | 1776 |
| 300 | Ga0373926_0068654 | 3300035083 | Bacteria | 1300 |
| 301 | Ga0373934_0010580 | 3300035086 | Bacteria | 3464 |
| 302 | Ga0373952_0031754 | 3300035092 | Bacteria | 1176 |
| 303 | Ga0373941_0069170 | 3300035115 | Bacteria | 1168 |
| 304 | Ga0373945_0034959 | 3300035116 | Bacteria | 1794 |
| 305 | Ga0373953_0006271 | 3300035117 | Bacteria | 3908 |
| 306 | Ga0373954_0005467 | 3300035118 | Bacteria | 5497 |
| 307 | Ga0373943_0005048 | 3300035170 | Bacteria | 5953 |
| 308 | Ga0373946_0035881 | 3300035171 | Bacteria | 2007 |
| 309 | Ga0373924_0000079 | 3300035410 | Bacteria | 25860 |
| 310 | Ga0373924_0037702 | 3300035410 | Bacteria | 1969 |
| 311 | Ga0373935_0004235 | 3300035692 | Bacteria | 8414 |
| 312 | Ga0373935_0019629 | 3300035692 | Bacteria | 4122 |
| 313 | Ga0373935_0086040 | 3300035692 | Bacteria | 2051 |
| 314 | Ga0373927_0002451 | 3300035695 | Bacteria | 13532 |
| 315 | Ga0373927_0076688 | 3300035695 | Unclassified | 2164 |
| 316 | Ga0373927_0144889 | 3300035695 | Bacteria | 1554 |
| 317 | Ga0373933_0005465 | 3300035724 | Bacteria | 6919 |
| 318 | Ga0373933_0104310 | 3300035724 | Bacteria | 1762 |
| 319 | Ga0373947_0002505 | 3300035725 | Bacteria | 11033 |
| 320 | Ga0373947_0006103 | 3300035725 | Bacteria | 7019 |
| 321 | Ga0373947_0006655 | 3300035725 | Bacteria | 6708 |
| 322 | Ga0373947_0013720 | 3300035725 | Bacteria | 4643 |
| 323 | Ga0373947_0023666 | 3300035725 | Bacteria | 3575 |
| 324 | Ga0373937_0010044 | 3300036401 | Bacteria | 8253 |
| 325 | Ga0373937_0011991 | 3300036401 | Bacteria | 7609 |
| 326 | Ga0373937_0023672 | 3300036401 | Bacteria | 5535 |
| 327 | Ga0373937_0030267 | 3300036401 | Bacteria | 4902 |
| 328 | Ga0373937_0042555 | 3300036401 | Bacteria | 4144 |
| 329 | Ga0373937_0145282 | 3300036401 | Unclassified | 2220 |
| 330 | Ga0373937_0155186 | 3300036401 | Unclassified | 2145 |
| 331 | Ga0373937_0167934 | 3300036401 | Bacteria | 2058 |
| 332 | Ga0373925_0019062 | 3300037068 | Bacteria | 4988 |
| 333 | Ga0373925_0074644 | 3300037068 | Bacteria | 2568 |
| 334 | Ga0373925_0141020 | 3300037068 | Bacteria | 1886 |
| 335 | Ga0395898_0154686 | 3300037466 | Bacteria | 2194 |
| 336 | Ga0436364_0145306 | 3300037853 | Bacteria | 1614 |
| 337 | Ga0436364_0754076 | 3300037853 | Bacteria | 16272 |
| 338 | Ga0436364_1423953 | 3300037853 | Bacteria | 39549 |
| 339 | Ga0436365_0213763 | 3300039437 | Bacteria | 3701 |
| 340 | Ga0436365_0370328 | 3300039437 | Bacteria | 9603 |
| 341 | Ga0436365_0920134 | 3300039437 | Bacteria | 8458 |
| 342 | Ga0436365_1372505 | 3300039437 | Bacteria | 22469 |
| 343 | Ga0436365_1737672 | 3300039437 | Bacteria | 1700 |
| 344 | Ga0436360_0467851 | 3300039438 | Bacteria | 3635 |
| 345 | Ga0436361_0072659 | 3300039447 | Bacteria | 1488 |
| 346 | Ga0436361_0122017 | 3300039447 | Bacteria | 2006 |
| 347 | Ga0436361_0229550 | 3300039447 | Bacteria | 13250 |
| 348 | Ga0436361_0272085 | 3300039447 | Bacteria | 9407 |
| 349 | Ga0436362_0573837 | 3300039453 | Bacteria | 2310 |
| 350 | Ga0436362_0644872 | 3300039453 | Bacteria | 2699 |
| 351 | Ga0436362_0692466 | 3300039453 | Bacteria | 1738 |
| 352 | Ga0436362_1183443 | 3300039453 | Bacteria | 1729 |
| 353 | Ga0451577_0187677 | 3300042876 | Bacteria | 1864 |
| 354 | Ga0453684_0053303 | 3300044712 | Bacteria | 5280 |
| 355 | Ga0453684_0113930 | 3300044712 | Bacteria | 3279 |
| 356 | Ga0495627_006947 | 3300046453 | Bacteria | 4393 |
| 357 | Ga0495592_0053851 | 3300046454 | Bacteria | 2983 |
| 358 | Ga0495592_0201963 | 3300046454 | Bacteria | 1341 |
| 359 | Ga0495590_0000380 | 3300046457 | Bacteria | 22628 |
| 360 | Ga0495638_0004189 | 3300046460 | Bacteria | 10991 |
| 361 | Ga0495580_0012422 | 3300046472 | Bacteria | 6529 |
| 362 | Ga0495580_0146033 | 3300046472 | Bacteria | 1639 |
| 363 | Ga0495582_0015426 | 3300046473 | Bacteria | 4196 |
| 364 | Ga0495639_0085792 | 3300046475 | Bacteria | 1472 |
| 365 | Ga0495584_0044575 | 3300046491 | Bacteria | 2238 |
| 366 | Ga0495585_0000070 | 3300046492 | Bacteria | 106156 |
| 367 | Ga0495585_0002310 | 3300046492 | Bacteria | 13734 |
| 368 | Ga0495594_0017420 | 3300046499 | Bacteria | 3796 |
| 369 | Ga0495594_0032145 | 3300046499 | Bacteria | 2847 |
| 370 | Ga0495583_0009624 | 3300046506 | Bacteria | 5751 |
| 371 | Ga0495583_0065791 | 3300046506 | Bacteria | 1605 |
| 372 | Ga0495583_0070457 | 3300046506 | Bacteria | 1537 |
| 373 | Ga0495606_0036075 | 3300046507 | Bacteria | 3373 |
| 374 | Ga0495608_0070933 | 3300046511 | Bacteria | 2274 |
| 375 | Ga0495608_0167861 | 3300046511 | Bacteria | 1393 |
| 376 | Ga0495618_0036926 | 3300046514 | Bacteria | 3067 |
| 377 | Ga0495631_0021919 | 3300046518 | Bacteria | 2972 |
| 378 | Ga0495631_0044505 | 3300046518 | Bacteria | 1955 |
| 379 | Ga0495632_0052887 | 3300046519 | Bacteria | 1995 |
| 380 | Ga0495663_0007510 | 3300046525 | Bacteria | 3015 |
| 381 | Ga0495666_0001609 | 3300046526 | Bacteria | 11121 |
| 382 | Ga0495666_0009587 | 3300046526 | Bacteria | 4840 |
| 383 | Ga0495642_0001905 | 3300046528 | Bacteria | 8880 |
| 384 | Ga0495642_0008031 | 3300046528 | Bacteria | 4037 |
| 385 | Ga0495665_0003474 | 3300046531 | Bacteria | 8550 |
| 386 | Ga0495586_0045916 | 3300046535 | Bacteria | 2355 |
| 387 | Ga0495586_0051765 | 3300046535 | Bacteria | 2222 |
| 388 | Ga0495609_0095538 | 3300046538 | Bacteria | 1290 |
| 389 | Ga0495621_0020048 | 3300046539 | Bacteria | 2190 |
| 390 | Ga0495597_0009226 | 3300046542 | Bacteria | 4888 |
| 391 | Ga0495597_0010825 | 3300046542 | Bacteria | 4443 |
| 392 | Ga0495597_0038596 | 3300046542 | Bacteria | 2140 |
| 393 | Ga0495645_0089425 | 3300046543 | Bacteria | 2202 |
| 394 | Ga0495622_0001954 | 3300046557 | Bacteria | 10113 |
| 395 | Ga0495633_0082544 | 3300046558 | Bacteria | 1495 |
| 396 | Ga0495667_0141037 | 3300046559 | Unclassified | 1553 |
| 397 | Ga0495668_0003146 | 3300046616 | Bacteria | 12732 |
| 398 | Ga0495634_0068844 | 3300046642 | Bacteria | 2337 |
| 399 | Ga0495634_0111868 | 3300046642 | Bacteria | 1755 |
| 400 | Ga0495611_0002422 | 3300046648 | Bacteria | 8546 |
| 401 | Ga0495625_0010540 | 3300046660 | Bacteria | 7635 |
| 402 | Ga0495625_0023691 | 3300046660 | Bacteria | 4685 |
| 403 | Ga0495625_0024315 | 3300046660 | Bacteria | 4612 |
| 404 | Ga0495635_0013697 | 3300046663 | Bacteria | 5674 |
| 405 | Ga0495661_0115020 | 3300046665 | Bacteria | 1494 |
| 406 | Ga0495588_0007786 | 3300046674 | Bacteria | 4891 |
| 407 | Ga0495623_0010407 | 3300046679 | Bacteria | 6020 |
| 408 | Ga0495623_0067653 | 3300046679 | Bacteria | 2229 |
| 409 | Ga0495623_0073555 | 3300046679 | Bacteria | 2124 |
| 410 | Ga0495646_0114673 | 3300046680 | Bacteria | 1531 |
| 411 | Ga0495658_0003752 | 3300046683 | Bacteria | 7517 |
| 412 | Ga0495658_0087285 | 3300046683 | Bacteria | 1842 |
| 413 | Ga0495613_0068879 | 3300046689 | Bacteria | 2580 |
| 414 | Ga0495624_0011383 | 3300046690 | Bacteria | 6114 |
| 415 | Ga0495670_0095902 | 3300046691 | Bacteria | 1522 |
| 416 | Ga0495581_0004852 | 3300047315 | Bacteria | 7781 |
| 417 | Ga0495581_0006624 | 3300047315 | Bacteria | 6709 |
| 418 | Ga0495604_0007005 | 3300047317 | Bacteria | 8935 |
| 419 | Ga0495604_0018363 | 3300047317 | Bacteria | 5601 |
| 420 | Ga0495676_0014845 | 3300047321 | Bacteria | 6955 |
| 421 | Ga0495680_0010916 | 3300047322 | Bacteria | 8070 |
| 422 | Ga0495680_0039635 | 3300047322 | Bacteria | 3756 |
| 423 | Ga0495680_0164122 | 3300047322 | Bacteria | 1611 |
| 424 | Ga0495683_0011188 | 3300047323 | Bacteria | 4729 |
| 425 | Ga0495675_0036457 | 3300047444 | Bacteria | 3137 |
| 426 | Ga0495677_0002049 | 3300047445 | Bacteria | 8038 |
| 427 | Ga0495677_0011499 | 3300047445 | Bacteria | 3237 |
| 428 | Ga0495681_0031312 | 3300047470 | Bacteria | 2694 |
| 429 | Ga0495602_0069453 | 3300048088 | Bacteria | 3020 |
| 430 | Ga0495614_0005446 | 3300048089 | Bacteria | 5737 |
| 431 | Ga0495626_0000792 | 3300048091 | Bacteria | 28683 |
| 432 | Ga0496102_0005885 | 3300048905 | Bacteria | 10437 |
| 433 | Ga0496102_0202279 | 3300048905 | Bacteria | 1872 |
| 434 | Ga0496102_0228258 | 3300048905 | Bacteria | 1755 |
| 435 | Ga0496103_0028099 | 3300048906 | Bacteria | 3412 |
| 436 | Ga0496104_0009253 | 3300048907 | Bacteria | 8761 |
| 437 | Ga0496104_0069780 | 3300048907 | Unclassified | 3340 |
| 438 | Ga0496105_0002291 | 3300048908 | Bacteria | 13884 |
| 439 | Ga0496105_0391912 | 3300048908 | Bacteria | 1104 |
| 440 | Ga0496106_0046382 | 3300048909 | Bacteria | 3267 |
| 441 | Ga0496106_0101393 | 3300048909 | Bacteria | 2233 |
| 442 | Ga0496107_0028147 | 3300048910 | Bacteria | 3993 |
| 443 | Ga0496107_0101400 | 3300048910 | Bacteria | 2111 |
| 444 | Ga0496108_0052651 | 3300048911 | Bacteria | 3412 |
| 445 | Ga0496109_0229306 | 3300048912 | Bacteria | 1747 |
| 446 | Ga0496110_0001834 | 3300048913 | Bacteria | 15666 |
| 447 | Ga0496110_0108984 | 3300048913 | Bacteria | 2487 |
| 448 | Ga0496111_0070286 | 3300048914 | Bacteria | 2546 |
| 449 | Ga0496112_0043423 | 3300048915 | Bacteria | 4401 |
| 450 | Ga0496112_0156157 | 3300048915 | Bacteria | 2248 |
| 451 | Ga0496112_0241226 | 3300048915 | Bacteria | 1760 |
| 452 | Ga0496114_0215340 | 3300048917 | Bacteria | 1685 |
| 453 | Ga0496115_0132967 | 3300048918 | Bacteria | 2051 |
| 454 | Ga0496116_0002041 | 3300048919 | Bacteria | 21637 |
| 455 | Ga0496118_0040468 | 3300048921 | Bacteria | 3706 |
| 456 | Ga0496119_0024012 | 3300048922 | Bacteria | 4303 |
| 457 | Ga0496121_0004254 | 3300048924 | Bacteria | 19459 |
| 458 | Ga0496121_0028453 | 3300048924 | Bacteria | 5201 |
| 459 | Ga0496121_0032207 | 3300048924 | Bacteria | 4770 |
| 460 | Ga0496122_0000021 | 3300048925 | Bacteria | 391363 |
| 461 | Ga0496123_0000174 | 3300048926 | Bacteria | 130310 |
| 462 | Ga0496124_0000104 | 3300048927 | Bacteria | 177382 |
| 463 | Ga0496125_0071035 | 3300048928 | Bacteria | 2722 |
| 464 | Ga0495682_0009527 | 3300049460 | Bacteria | 3789 |
| 465 | Ga0501034_0078878 | 3300049571 | Bacteria | 3296 |
| 466 | Ga0501039_0053640 | 3300049575 | Bacteria | 3120 |
| 467 | Ga0501040_0086159 | 3300049576 | Bacteria | 2181 |
| 468 | Ga0501047_0348147 | 3300049581 | Bacteria | 1319 |
| 469 | Ga0501070_0007769 | 3300049586 | Bacteria | 9092 |
| 470 | Ga0501072_0043090 | 3300049588 | Bacteria | 3547 |
| 471 | Ga0501073_0009222 | 3300049589 | Bacteria | 7275 |
| 472 | Ga0501075_0119952 | 3300049591 | Bacteria | 2001 |
| 473 | Ga0501076_0025111 | 3300049592 | Bacteria | 4609 |
| 474 | Ga0501077_0021111 | 3300049593 | Bacteria | 4120 |
| 475 | Ga0501081_0086875 | 3300049743 | Bacteria | 2196 |
| 476 | Ga0501083_0003894 | 3300049744 | Bacteria | 10486 |
| 477 | nmdc:mga05p37_5770_c1 | 3300050507 | Bacteria | 14562 |
| 478 | nmdc:mga09592_10065_c1 | 3300050508 | Bacteria | 5209 |
| 479 | nmdc:mga09592_118102_c1 | 3300050508 | Bacteria | 2276 |
| 480 | nmdc:mga09592_6021_c1 | 3300050508 | Bacteria | 9894 |
| 481 | nmdc:mga0qj67_75212_c1 | 3300050509 | Bacteria | 2699 |
| 482 | nmdc:mga06r32_33305_c1 | 3300050510 | Bacteria | 4853 |
| 483 | nmdc:mga0n895_401328_c1 | 3300050512 | Bacteria | 1386 |
| 484 | Ga0495595_0033107 | 3300053084 | Bacteria | 2331 |
| 485 | Ga0495619_0010344 | 3300053085 | Bacteria | 5872 |
| 486 | Ga0495619_0072718 | 3300053085 | Bacteria | 2303 |
| 487 | Ga0500647_0059347 | 3300053091 | Bacteria | 1840 |
| 488 | Ga0500640_000638 | 3300053095 | Bacteria | 9162 |
| 489 | Ga0500554_000391 | 3300053102 | Bacteria | 9383 |
| 490 | Ga0500572_003737 | 3300053111 | Bacteria | 3454 |
| 491 | Ga0500595_000128 | 3300053119 | Bacteria | 49404 |
| 492 | Ga0500597_028637 | 3300053120 | Bacteria | 2275 |
| 493 | Ga0500614_000222 | 3300053123 | Bacteria | 14972 |
| 494 | Ga0500601_001571 | 3300053737 | Bacteria | 2478 |
| 495 | Ga0501084_0202018 | 3300054114 | Bacteria | 1677 |
| 496 | Ga0501082_0023778 | 3300060353 | Bacteria | 5284 |
| 497 | Ga0501082_0226392 | 3300060353 | Bacteria | 1627 |
| 498 | Ga0530510_0056126 | 3300061734 | Bacteria | 2845 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_0573837 | Ga0436362_0573837_1190_2245 | 348 |
| 2 | 3300048908 | Ga0496105_0391912 | Ga0496105_0391912_19_1083 | 349 |
| 3 | 3300035115 | Ga0373941_0069170 | Ga0373941_0069170_69_1154 | 354 |
| 4 | 3300044712 | Ga0453684_0113930 | Ga0453684_0113930_2142_3233 | 363 |
| 5 | 3300009098 | Ga0105245_10077358 | Ga0105245_100773582 | 369 |
| 6 | 3300013297 | Ga0157378_10015124 | Ga0157378_100151246 | 369 |
| 7 | 3300039447 | Ga0436361_0229550 | Ga0436361_0229550_302_1417 | 369 |
| 8 | 3300048905 | Ga0496102_0228258 | Ga0496102_0228258_490_1629 | 369 |
| 9 | 3300048915 | Ga0496112_0241226 | Ga0496112_0241226_506_1645 | 369 |
| 10 | 3300048918 | Ga0496115_0132967 | Ga0496115_0132967_89_1228 | 369 |
| 11 | 3300014969 | Ga0157376_10156979 | Ga0157376_101569791 | 371 |
| 12 | 3300035083 | Ga0373926_0068654 | Ga0373926_0068654_158_1285 | 372 |
| 13 | 3300035725 | Ga0373947_0006655 | Ga0373947_0006655_842_1969 | 372 |
| 14 | 3300035092 | Ga0373952_0031754 | Ga0373952_0031754_23_1156 | 373 |
| 15 | 3300039447 | Ga0436361_0272085 | Ga0436361_0272085_8240_9367 | 373 |
| 16 | 3300046506 | Ga0495583_0009624 | Ga0495583_0009624_395_1642 | 373 |
| 17 | 3300046679 | Ga0495623_0073555 | Ga0495623_0073555_39_1187 | 373 |
| 18 | 3300048913 | Ga0496110_0001834 | Ga0496110_0001834_6817_7965 | 373 |
| 19 | 3300048914 | Ga0496111_0070286 | Ga0496111_0070286_482_1630 | 373 |
| 20 | 3300035724 | Ga0373933_0104310 | Ga0373933_0104310_11_1159 | 375 |
| 21 | 3300044712 | Ga0453684_0053303 | Ga0453684_0053303_4039_5178 | 376 |
| 22 | 3300047323 | Ga0495683_0011188 | Ga0495683_0011188_45_1187 | 376 |
| 23 | iso_pu_bacteria | 2895427314 | 2895430136 | 376 |
| 24 | 3300005467 | Ga0070706_100000907 | Ga0070706_1000009073 | 377 |
| 25 | 3300006028 | Ga0070717_10088818 | Ga0070717_100888182 | 377 |
| 26 | 3300025910 | Ga0207684_10000506 | Ga0207684_100005067 | 377 |
| 27 | 3300021361 | Ga0213872_10002684 | Ga0213872_100026842 | 379 |
| 28 | 3300005435 | Ga0070714_100010042 | Ga0070714_1000100422 | 382 |
| 29 | 3300039438 | Ga0436360_0467851 | Ga0436360_0467851_1897_3060 | 382 |
| 30 | 3300039453 | Ga0436362_1183443 | Ga0436362_1183443_241_1404 | 382 |
| 31 | 3300005445 | Ga0070708_100072430 | Ga0070708_1000724302 | 385 |
| 32 | 3300005841 | Ga0068863_100229622 | Ga0068863_1002296222 | 385 |
| 33 | 3300039447 | Ga0436361_0072659 | Ga0436361_0072659_46_1221 | 385 |
| 34 | iso_pu_bacteria | 2857542790 | 2857546505 | 387 |
| 35 | 3300005549 | Ga0070704_100001644 | Ga0070704_1000016444 | 388 |
| 36 | 3300006852 | Ga0075433_10251770 | Ga0075433_102517701 | 388 |
| 37 | 3300048921 | Ga0496118_0040468 | Ga0496118_0040468_682_1863 | 388 |
| 38 | 3300048922 | Ga0496119_0024012 | Ga0496119_0024012_705_1886 | 388 |
| 39 | 3300048928 | Ga0496125_0071035 | Ga0496125_0071035_988_2169 | 388 |
| 40 | 3300053091 | Ga0500647_0059347 | Ga0500647_0059347_413_1609 | 388 |
| 41 | 3300053095 | Ga0500640_000638 | Ga0500640_000638_2333_3529 | 388 |
| 42 | 3300053102 | Ga0500554_000391 | Ga0500554_000391_2568_3764 | 388 |
| 43 | 3300053111 | Ga0500572_003737 | Ga0500572_003737_1919_3115 | 388 |
| 44 | 3300053119 | Ga0500595_000128 | Ga0500595_000128_28778_29974 | 388 |
| 45 | 3300053120 | Ga0500597_028637 | Ga0500597_028637_572_1768 | 388 |
| 46 | 3300053123 | Ga0500614_000222 | Ga0500614_000222_13636_14832 | 388 |
| 47 | 3300053737 | Ga0500601_001571 | Ga0500601_001571_155_1351 | 388 |
| 48 | 3300005355 | Ga0070671_100065325 | Ga0070671_1000653251 | 389 |
| 49 | 3300005445 | Ga0070708_100004729 | Ga0070708_1000047292 | 389 |
| 50 | 3300005468 | Ga0070707_100012317 | Ga0070707_1000123176 | 389 |
| 51 | 3300005518 | Ga0070699_100008847 | Ga0070699_1000088475 | 389 |
| 52 | 3300025910 | Ga0207684_10067786 | Ga0207684_100677863 | 389 |
| 53 | 3300031824 | Ga0307413_10024823 | Ga0307413_100248232 | 389 |
| 54 | 3300032005 | Ga0307411_10063344 | Ga0307411_100633441 | 389 |
| 55 | iso_pu_bacteria | 643348564 | 643602551 | 389 |
| 56 | 3300005436 | Ga0070713_100003780 | Ga0070713_1000037804 | 390 |
| 57 | 3300010375 | Ga0105239_10343956 | Ga0105239_103439561 | 390 |
| 58 | 3300021361 | Ga0213872_10008273 | Ga0213872_100082731 | 390 |
| 59 | 3300021384 | Ga0213876_10027648 | Ga0213876_100276482 | 390 |
| 60 | 3300021388 | Ga0213875_10004931 | Ga0213875_100049311 | 390 |
| 61 | 3300025928 | Ga0207700_10003220 | Ga0207700_100032203 | 390 |
| 62 | 3300025944 | Ga0207661_10038636 | Ga0207661_100386361 | 390 |
| 63 | 3300035118 | Ga0373954_0005467 | Ga0373954_0005467_2234_3415 | 390 |
| 64 | 3300035724 | Ga0373933_0005465 | Ga0373933_0005465_4188_5369 | 390 |
| 65 | 3300036401 | Ga0373937_0010044 | Ga0373937_0010044_1273_2454 | 390 |
| 66 | 3300036401 | Ga0373937_0030267 | Ga0373937_0030267_2632_3813 | 390 |
| 67 | 3300037853 | Ga0436364_1423953 | Ga0436364_1423953_38104_39285 | 390 |
| 68 | 3300039437 | Ga0436365_0213763 | Ga0436365_0213763_399_1589 | 390 |
| 69 | 3300039437 | Ga0436365_1737672 | Ga0436365_1737672_422_1609 | 390 |
| 70 | 3300039447 | Ga0436361_0122017 | Ga0436361_0122017_713_1897 | 390 |
| 71 | 3300046511 | Ga0495608_0167861 | Ga0495608_0167861_56_1315 | 390 |
| 72 | 3300046539 | Ga0495621_0020048 | Ga0495621_0020048_957_2138 | 390 |
| 73 | 3300047322 | Ga0495680_0164122 | Ga0495680_0164122_135_1316 | 390 |
| 74 | 3300049581 | Ga0501047_0348147 | Ga0501047_0348147_70_1251 | 390 |
| 75 | 3300050508 | nmdc:mga09592_118102_c1 | nmdc:mga09592_118102_c1_1002_2183 | 390 |
| 76 | 3300050509 | nmdc:mga0qj67_75212_c1 | nmdc:mga0qj67_75212_c1_1309_2490 | 390 |
| 77 | 3300053084 | Ga0495595_0033107 | Ga0495595_0033107_41_1222 | 390 |
| 78 | 3300053085 | Ga0495619_0072718 | Ga0495619_0072718_33_1214 | 390 |
| 79 | 3300005436 | Ga0070713_100089626 | Ga0070713_1000896262 | 391 |
| 80 | 3300005445 | Ga0070708_100192912 | Ga0070708_1001929122 | 391 |
| 81 | 3300005467 | Ga0070706_100199858 | Ga0070706_1001998582 | 391 |
| 82 | 3300005468 | Ga0070707_100089746 | Ga0070707_1000897464 | 391 |
| 83 | 3300005614 | Ga0068856_100337531 | Ga0068856_1003375312 | 391 |
| 84 | 3300005718 | Ga0068866_10003875 | Ga0068866_100038752 | 391 |
| 85 | 3300005843 | Ga0068860_100124245 | Ga0068860_1001242452 | 391 |
| 86 | 3300010159 | Ga0099796_10015687 | Ga0099796_100156872 | 391 |
| 87 | 3300014969 | Ga0157376_10229396 | Ga0157376_102293961 | 391 |
| 88 | 3300021384 | Ga0213876_10024016 | Ga0213876_100240162 | 391 |
| 89 | 3300021384 | Ga0213876_10063016 | Ga0213876_100630162 | 391 |
| 90 | 3300025915 | Ga0207693_10135896 | Ga0207693_101358962 | 391 |
| 91 | 3300025916 | Ga0207663_10077589 | Ga0207663_100775892 | 391 |
| 92 | 3300025922 | Ga0207646_10045906 | Ga0207646_100459064 | 391 |
| 93 | 3300025927 | Ga0207687_10002728 | Ga0207687_100027288 | 391 |
| 94 | 3300025928 | Ga0207700_10030893 | Ga0207700_100308934 | 391 |
| 95 | 3300025928 | Ga0207700_10055746 | Ga0207700_100557463 | 391 |
| 96 | 3300025928 | Ga0207700_10094868 | Ga0207700_100948682 | 391 |
| 97 | 3300025937 | Ga0207669_10041984 | Ga0207669_100419842 | 391 |
| 98 | 3300026078 | Ga0207702_10035425 | Ga0207702_100354252 | 391 |
| 99 | 3300026078 | Ga0207702_10076393 | Ga0207702_100763934 | 391 |
| 100 | 3300026089 | Ga0207648_10054451 | Ga0207648_100544512 | 391 |
| 101 | 3300026121 | Ga0207683_10001896 | Ga0207683_100018967 | 391 |
| 102 | 3300035695 | Ga0373927_0144889 | Ga0373927_0144889_159_1349 | 391 |
| 103 | 3300035725 | Ga0373947_0013720 | Ga0373947_0013720_2675_3865 | 391 |
| 104 | 3300037068 | Ga0373925_0141020 | Ga0373925_0141020_83_1273 | 391 |
| 105 | 3300037853 | Ga0436364_0145306 | Ga0436364_0145306_49_1266 | 391 |
| 106 | 3300039437 | Ga0436365_0370328 | Ga0436365_0370328_287_1477 | 391 |
| 107 | 3300039437 | Ga0436365_1372505 | Ga0436365_1372505_8223_9416 | 391 |
| 108 | 3300039453 | Ga0436362_0692466 | Ga0436362_0692466_76_1266 | 391 |
| 109 | 3300046454 | Ga0495592_0053851 | Ga0495592_0053851_839_2029 | 391 |
| 110 | 3300046475 | Ga0495639_0085792 | Ga0495639_0085792_32_1222 | 391 |
| 111 | 3300046535 | Ga0495586_0045916 | Ga0495586_0045916_424_1614 | 391 |
| 112 | 3300046642 | Ga0495634_0068844 | Ga0495634_0068844_663_1853 | 391 |
| 113 | 3300048924 | Ga0496121_0028453 | Ga0496121_0028453_3026_4201 | 391 |
| 114 | 3300048927 | Ga0496124_0000104 | Ga0496124_0000104_95_1270 | 391 |
| 115 | 3300053085 | Ga0495619_0010344 | Ga0495619_0010344_4169_5359 | 391 |
| 116 | iso_pu_bacteria | 2643221594 | 2643978787 | 391 |
| 117 | iso_pu_bacteria | 2643221621 | 2644120224 | 391 |
| 118 | iso_pu_bacteria | 2808606395 | 2809036456 | 391 |
| 119 | iso_pu_bacteria | 2857537821 | 2857538831 | 391 |
| 120 | iso_pu_bacteria | 2858950400 | 2858953712 | 391 |
| 121 | iso_pu_bacteria | 8045864390 | 8045864706 | 391 |
| 122 | 3300005435 | Ga0070714_100006675 | Ga0070714_1000066756 | 392 |
| 123 | 3300005458 | Ga0070681_10040583 | Ga0070681_100405833 | 392 |
| 124 | 3300005471 | Ga0070698_100075628 | Ga0070698_1000756282 | 392 |
| 125 | 3300005471 | Ga0070698_100148025 | Ga0070698_1001480252 | 392 |
| 126 | 3300005549 | Ga0070704_100000364 | Ga0070704_10000036413 | 392 |
| 127 | 3300006844 | Ga0075428_100007802 | Ga0075428_1000078024 | 392 |
| 128 | 3300006847 | Ga0075431_100001292 | Ga0075431_10000129213 | 392 |
| 129 | 3300006880 | Ga0075429_100010468 | Ga0075429_1000104683 | 392 |
| 130 | 3300021388 | Ga0213875_10000677 | Ga0213875_1000067722 | 392 |
| 131 | 3300025292 | Ga0209676_1013522 | Ga0209676_10135222 | 392 |
| 132 | 3300025916 | Ga0207663_10039412 | Ga0207663_100394123 | 392 |
| 133 | 3300025931 | Ga0207644_10204193 | Ga0207644_102041931 | 392 |
| 134 | 3300036401 | Ga0373937_0155186 | Ga0373937_0155186_633_1826 | 392 |
| 135 | 3300046514 | Ga0495618_0036926 | Ga0495618_0036926_448_1719 | 392 |
| 136 | 3300047322 | Ga0495680_0039635 | Ga0495680_0039635_1911_3182 | 392 |
| 137 | 3300049571 | Ga0501034_0078878 | Ga0501034_0078878_523_1722 | 392 |
| 138 | 3300050507 | nmdc:mga05p37_5770_c1 | nmdc:mga05p37_5770_c1_7526_8719 | 392 |
| 139 | 3300050508 | nmdc:mga09592_6021_c1 | nmdc:mga09592_6021_c1_5886_7079 | 392 |
| 140 | 3300050510 | nmdc:mga06r32_33305_c1 | nmdc:mga06r32_33305_c1_973_2166 | 392 |
| 141 | 3300005983 | Ga0081540_1046274 | Ga0081540_10462741 | 393 |
| 142 | 3300006163 | Ga0070715_10021997 | Ga0070715_100219972 | 393 |
| 143 | 3300006844 | Ga0075428_100011914 | Ga0075428_1000119143 | 393 |
| 144 | 3300009094 | Ga0111539_10007264 | Ga0111539_100072645 | 393 |
| 145 | 3300009098 | Ga0105245_10003176 | Ga0105245_1000317612 | 393 |
| 146 | 3300010159 | Ga0099796_10004294 | Ga0099796_100042944 | 393 |
| 147 | 3300013105 | Ga0157369_10020580 | Ga0157369_100205801 | 393 |
| 148 | 3300025927 | Ga0207687_10001854 | Ga0207687_100018542 | 393 |
| 149 | 3300025939 | Ga0207665_10006265 | Ga0207665_100062653 | 393 |
| 150 | 3300025949 | Ga0207667_10015937 | Ga0207667_100159375 | 393 |
| 151 | 3300026078 | Ga0207702_10067543 | Ga0207702_100675432 | 393 |
| 152 | 3300026118 | Ga0207675_100100959 | Ga0207675_1001009593 | 393 |
| 153 | 3300027907 | Ga0207428_10016833 | Ga0207428_100168333 | 393 |
| 154 | 3300031852 | Ga0307410_10008737 | Ga0307410_100087373 | 393 |
| 155 | 3300031901 | Ga0307406_10010410 | Ga0307406_100104103 | 393 |
| 156 | 3300031903 | Ga0307407_10006384 | Ga0307407_100063843 | 393 |
| 157 | 3300031995 | Ga0307409_100019701 | Ga0307409_1000197014 | 393 |
| 158 | 3300032002 | Ga0307416_100020365 | Ga0307416_1000203651 | 393 |
| 159 | 3300032004 | Ga0307414_10026145 | Ga0307414_100261452 | 393 |
| 160 | 3300032126 | Ga0307415_100002155 | Ga0307415_1000021553 | 393 |
| 161 | 3300035170 | Ga0373943_0005048 | Ga0373943_0005048_618_1829 | 393 |
| 162 | 3300035171 | Ga0373946_0035881 | Ga0373946_0035881_712_1923 | 393 |
| 163 | 3300035410 | Ga0373924_0000079 | Ga0373924_0000079_3294_4505 | 393 |
| 164 | 3300035410 | Ga0373924_0037702 | Ga0373924_0037702_340_1545 | 393 |
| 165 | 3300035692 | Ga0373935_0004235 | Ga0373935_0004235_6222_7433 | 393 |
| 166 | 3300035695 | Ga0373927_0002451 | Ga0373927_0002451_7204_8415 | 393 |
| 167 | 3300035695 | Ga0373927_0076688 | Ga0373927_0076688_686_1894 | 393 |
| 168 | 3300035725 | Ga0373947_0002505 | Ga0373947_0002505_1953_3164 | 393 |
| 169 | 3300035725 | Ga0373947_0006103 | Ga0373947_0006103_3893_5104 | 393 |
| 170 | 3300036401 | Ga0373937_0145282 | Ga0373937_0145282_832_2043 | 393 |
| 171 | 3300037068 | Ga0373925_0019062 | Ga0373925_0019062_1499_2710 | 393 |
| 172 | 3300046472 | Ga0495580_0012422 | Ga0495580_0012422_3821_5032 | 393 |
| 173 | 3300046559 | Ga0495667_0141037 | Ga0495667_0141037_44_1255 | 393 |
| 174 | 3300046683 | Ga0495658_0087285 | Ga0495658_0087285_619_1812 | 393 |
| 175 | 3300048907 | Ga0496104_0069780 | Ga0496104_0069780_951_2159 | 393 |
| 176 | 3300048908 | Ga0496105_0002291 | Ga0496105_0002291_704_1915 | 393 |
| 177 | 3300048913 | Ga0496110_0108984 | Ga0496110_0108984_544_1752 | 393 |
| 178 | 3300048915 | Ga0496112_0156157 | Ga0496112_0156157_662_1870 | 393 |
| 179 | 3300050508 | nmdc:mga09592_10065_c1 | nmdc:mga09592_10065_c1_1213_2415 | 393 |
| 180 | 3300050512 | nmdc:mga0n895_401328_c1 | nmdc:mga0n895_401328_c1_25_1227 | 393 |
| 181 | 3300005290 | Ga0065712_10085128 | Ga0065712_100851282 | 394 |
| 182 | 3300005331 | Ga0070670_100000953 | Ga0070670_1000009539 | 394 |
| 183 | 3300005334 | Ga0068869_100000255 | Ga0068869_1000002558 | 394 |
| 184 | 3300005364 | Ga0070673_100040913 | Ga0070673_1000409132 | 394 |
| 185 | 3300005367 | Ga0070667_100003769 | Ga0070667_1000037697 | 394 |
| 186 | 3300005434 | Ga0070709_10059538 | Ga0070709_100595382 | 394 |
| 187 | 3300005436 | Ga0070713_100061970 | Ga0070713_1000619702 | 394 |
| 188 | 3300005437 | Ga0070710_10021544 | Ga0070710_100215442 | 394 |
| 189 | 3300005439 | Ga0070711_100008555 | Ga0070711_1000085557 | 394 |
| 190 | 3300005459 | Ga0068867_100002215 | Ga0068867_1000022153 | 394 |
| 191 | 3300005536 | Ga0070697_100013087 | Ga0070697_1000130875 | 394 |
| 192 | 3300005577 | Ga0068857_100037354 | Ga0068857_1000373544 | 394 |
| 193 | 3300005617 | Ga0068859_100001195 | Ga0068859_1000011959 | 394 |
| 194 | 3300005618 | Ga0068864_100007875 | Ga0068864_1000078752 | 394 |
| 195 | 3300005719 | Ga0068861_100007348 | Ga0068861_1000073486 | 394 |
| 196 | 3300005840 | Ga0068870_10003820 | Ga0068870_100038204 | 394 |
| 197 | 3300005841 | Ga0068863_100018582 | Ga0068863_1000185824 | 394 |
| 198 | 3300005842 | Ga0068858_100002336 | Ga0068858_1000023366 | 394 |
| 199 | 3300005843 | Ga0068860_100001162 | Ga0068860_10000116214 | 394 |
| 200 | 3300005844 | Ga0068862_100004121 | Ga0068862_1000041214 | 394 |
| 201 | 3300006028 | Ga0070717_10026552 | Ga0070717_100265524 | 394 |
| 202 | 3300006175 | Ga0070712_100012740 | Ga0070712_1000127407 | 394 |
| 203 | 3300006175 | Ga0070712_100018230 | Ga0070712_1000182303 | 394 |
| 204 | 3300006931 | Ga0097620_100001195 | Ga0097620_10000119510 | 394 |
| 205 | 3300009094 | Ga0111539_10474630 | Ga0111539_104746302 | 394 |
| 206 | 3300013308 | Ga0157375_10066030 | Ga0157375_100660303 | 394 |
| 207 | 3300014325 | Ga0163163_10001519 | Ga0163163_100015192 | 394 |
| 208 | 3300014326 | Ga0157380_10045903 | Ga0157380_100459033 | 394 |
| 209 | 3300014968 | Ga0157379_10000156 | Ga0157379_1000015614 | 394 |
| 210 | 3300025905 | Ga0207685_10084058 | Ga0207685_100840581 | 394 |
| 211 | 3300025906 | Ga0207699_10015851 | Ga0207699_100158513 | 394 |
| 212 | 3300025910 | Ga0207684_10110633 | Ga0207684_101106332 | 394 |
| 213 | 3300025915 | Ga0207693_10009806 | Ga0207693_100098063 | 394 |
| 214 | 3300025915 | Ga0207693_10092049 | Ga0207693_100920493 | 394 |
| 215 | 3300025916 | Ga0207663_10051880 | Ga0207663_100518802 | 394 |
| 216 | 3300039437 | Ga0436365_0920134 | Ga0436365_0920134_2138_3352 | 394 |
| 217 | 3300048912 | Ga0496109_0229306 | Ga0496109_0229306_300_1517 | 394 |
| 218 | 3300003316 | rootH1_10118372 | rootH1_101183722 | 395 |
| 219 | 3300005546 | Ga0070696_100032711 | Ga0070696_1000327111 | 395 |
| 220 | 3300009148 | Ga0105243_10170278 | Ga0105243_101702782 | 395 |
| 221 | 3300025298 | Ga0209050_1001219 | Ga0209050_100121931 | 395 |
| 222 | 3300025908 | Ga0207643_10008929 | Ga0207643_100089292 | 395 |
| 223 | 3300025912 | Ga0207707_10034293 | Ga0207707_100342933 | 395 |
| 224 | 3300025925 | Ga0207650_10000871 | Ga0207650_100008717 | 395 |
| 225 | 3300025942 | Ga0207689_10000905 | Ga0207689_1000090512 | 395 |
| 226 | 3300025960 | Ga0207651_10002800 | Ga0207651_100028007 | 395 |
| 227 | 3300025961 | Ga0207712_10035959 | Ga0207712_100359591 | 395 |
| 228 | 3300025972 | Ga0207668_10006192 | Ga0207668_100061926 | 395 |
| 229 | 3300025986 | Ga0207658_10019281 | Ga0207658_100192813 | 395 |
| 230 | 3300026035 | Ga0207703_10000595 | Ga0207703_1000059525 | 395 |
| 231 | 3300026088 | Ga0207641_10022333 | Ga0207641_100223332 | 395 |
| 232 | 3300026089 | Ga0207648_10000762 | Ga0207648_100007627 | 395 |
| 233 | 3300026095 | Ga0207676_10000867 | Ga0207676_100008672 | 395 |
| 234 | 3300026116 | Ga0207674_10053654 | Ga0207674_100536543 | 395 |
| 235 | 3300026118 | Ga0207675_100013813 | Ga0207675_1000138133 | 395 |
| 236 | 3300028380 | Ga0268265_10001575 | Ga0268265_100015754 | 395 |
| 237 | 3300028381 | Ga0268264_10001114 | Ga0268264_100011147 | 395 |
| 238 | 3300039453 | Ga0436362_0644872 | Ga0436362_0644872_944_2146 | 395 |
| 239 | 3300042876 | Ga0451577_0187677 | Ga0451577_0187677_392_1633 | 395 |
| 240 | 3300046492 | Ga0495585_0000070 | Ga0495585_0000070_65058_66257 | 395 |
| 241 | 3300046691 | Ga0495670_0095902 | Ga0495670_0095902_155_1354 | 395 |
| 242 | 3300048905 | Ga0496102_0005885 | Ga0496102_0005885_2986_4206 | 395 |
| 243 | 3300048906 | Ga0496103_0028099 | Ga0496103_0028099_121_1341 | 395 |
| 244 | 3300048909 | Ga0496106_0101393 | Ga0496106_0101393_72_1292 | 395 |
| 245 | 3300048919 | Ga0496116_0002041 | Ga0496116_0002041_1412_2608 | 395 |
| 246 | 3300048924 | Ga0496121_0004254 | Ga0496121_0004254_1234_2508 | 395 |
| 247 | 3300048924 | Ga0496121_0032207 | Ga0496121_0032207_2199_3395 | 395 |
| 248 | 3300048925 | Ga0496122_0000021 | Ga0496122_0000021_323223_324419 | 395 |
| 249 | 3300048926 | Ga0496123_0000174 | Ga0496123_0000174_74927_76123 | 395 |
| 250 | 3300049575 | Ga0501039_0053640 | Ga0501039_0053640_1656_2849 | 395 |
| 251 | 3300049576 | Ga0501040_0086159 | Ga0501040_0086159_339_1532 | 395 |
| 252 | 3300049588 | Ga0501072_0043090 | Ga0501072_0043090_13_1206 | 395 |
| 253 | 3300049591 | Ga0501075_0119952 | Ga0501075_0119952_535_1728 | 395 |
| 254 | 3300049592 | Ga0501076_0025111 | Ga0501076_0025111_66_1259 | 395 |
| 255 | 3300049593 | Ga0501077_0021111 | Ga0501077_0021111_1732_2925 | 395 |
| 256 | 3300049743 | Ga0501081_0086875 | Ga0501081_0086875_406_1599 | 395 |
| 257 | 3300060353 | Ga0501082_0023778 | Ga0501082_0023778_1717_2910 | 395 |
| 258 | 3300061734 | Ga0530510_0056126 | Ga0530510_0056126_185_1378 | 395 |
| 259 | 3300009094 | Ga0111539_10204994 | Ga0111539_102049941 | 396 |
| 260 | 3300021388 | Ga0213875_10000011 | Ga0213875_10000011292 | 396 |
| 261 | 3300037853 | Ga0436364_0754076 | Ga0436364_0754076_11852_13057 | 396 |
| 262 | 3300048088 | Ga0495602_0069453 | Ga0495602_0069453_53_1264 | 396 |
| 263 | 3300048909 | Ga0496106_0046382 | Ga0496106_0046382_1108_2316 | 396 |
| 264 | 3300048917 | Ga0496114_0215340 | Ga0496114_0215340_316_1524 | 396 |
| 265 | 3300054114 | Ga0501084_0202018 | Ga0501084_0202018_271_1473 | 396 |
| 266 | 3300005288 | Ga0065714_10006356 | Ga0065714_100063563 | 397 |
| 267 | 3300005344 | Ga0070661_100042473 | Ga0070661_1000424732 | 397 |
| 268 | 3300005347 | Ga0070668_100034883 | Ga0070668_1000348832 | 397 |
| 269 | 3300005353 | Ga0070669_100044963 | Ga0070669_1000449632 | 397 |
| 270 | 3300005530 | Ga0070679_100012385 | Ga0070679_1000123853 | 397 |
| 271 | 3300005530 | Ga0070679_100028486 | Ga0070679_1000284863 | 397 |
| 272 | 3300005539 | Ga0068853_100029855 | Ga0068853_1000298554 | 397 |
| 273 | 3300005563 | Ga0068855_100069451 | Ga0068855_1000694513 | 397 |
| 274 | 3300005564 | Ga0070664_100012190 | Ga0070664_1000121905 | 397 |
| 275 | 3300005985 | Ga0081539_10007928 | Ga0081539_100079286 | 397 |
| 276 | 3300013100 | Ga0157373_10028685 | Ga0157373_100286852 | 397 |
| 277 | 3300013104 | Ga0157370_10015498 | Ga0157370_100154984 | 397 |
| 278 | 3300013307 | Ga0157372_10007797 | Ga0157372_100077975 | 397 |
| 279 | 3300014326 | Ga0157380_10039998 | Ga0157380_100399982 | 397 |
| 280 | 3300025920 | Ga0207649_10086374 | Ga0207649_100863742 | 397 |
| 281 | 3300025923 | Ga0207681_10009205 | Ga0207681_100092052 | 397 |
| 282 | 3300025940 | Ga0207691_10097767 | Ga0207691_100977671 | 397 |
| 283 | 3300025945 | Ga0207679_10082685 | Ga0207679_100826852 | 397 |
| 284 | 3300025949 | Ga0207667_10094825 | Ga0207667_100948252 | 397 |
| 285 | 3300025972 | Ga0207668_10003032 | Ga0207668_100030324 | 397 |
| 286 | 3300036401 | Ga0373937_0042555 | Ga0373937_0042555_1570_2778 | 397 |
| 287 | 3300046453 | Ga0495627_006947 | Ga0495627_006947_1304_2509 | 397 |
| 288 | 3300046460 | Ga0495638_0004189 | Ga0495638_0004189_5119_6324 | 397 |
| 289 | 3300046492 | Ga0495585_0002310 | Ga0495585_0002310_1881_3086 | 397 |
| 290 | 3300046499 | Ga0495594_0017420 | Ga0495594_0017420_2489_3694 | 397 |
| 291 | 3300046506 | Ga0495583_0070457 | Ga0495583_0070457_110_1315 | 397 |
| 292 | 3300046507 | Ga0495606_0036075 | Ga0495606_0036075_2137_3342 | 397 |
| 293 | 3300046518 | Ga0495631_0021919 | Ga0495631_0021919_929_2134 | 397 |
| 294 | 3300046518 | Ga0495631_0044505 | Ga0495631_0044505_415_1620 | 397 |
| 295 | 3300046519 | Ga0495632_0052887 | Ga0495632_0052887_504_1709 | 397 |
| 296 | 3300046525 | Ga0495663_0007510 | Ga0495663_0007510_123_1328 | 397 |
| 297 | 3300046528 | Ga0495642_0008031 | Ga0495642_0008031_1569_2774 | 397 |
| 298 | 3300046542 | Ga0495597_0009226 | Ga0495597_0009226_3221_4426 | 397 |
| 299 | 3300046543 | Ga0495645_0089425 | Ga0495645_0089425_304_1509 | 397 |
| 300 | 3300046558 | Ga0495633_0082544 | Ga0495633_0082544_138_1343 | 397 |
| 301 | 3300046616 | Ga0495668_0003146 | Ga0495668_0003146_8371_9576 | 397 |
| 302 | 3300046648 | Ga0495611_0002422 | Ga0495611_0002422_1603_2808 | 397 |
| 303 | 3300046660 | Ga0495625_0023691 | Ga0495625_0023691_1275_2480 | 397 |
| 304 | 3300046660 | Ga0495625_0024315 | Ga0495625_0024315_2341_3546 | 397 |
| 305 | 3300047321 | Ga0495676_0014845 | Ga0495676_0014845_2114_3319 | 397 |
| 306 | 3300047445 | Ga0495677_0002049 | Ga0495677_0002049_2619_3824 | 397 |
| 307 | 3300047445 | Ga0495677_0011499 | Ga0495677_0011499_1118_2323 | 397 |
| 308 | 3300047470 | Ga0495681_0031312 | Ga0495681_0031312_729_1934 | 397 |
| 309 | 3300049460 | Ga0495682_0009527 | Ga0495682_0009527_706_1911 | 397 |
| 310 | 3300049586 | Ga0501070_0007769 | Ga0501070_0007769_5982_7187 | 397 |
| 311 | 3300049589 | Ga0501073_0009222 | Ga0501073_0009222_4779_5984 | 397 |
| 312 | 3300049744 | Ga0501083_0003894 | Ga0501083_0003894_1164_2369 | 397 |
| 313 | 3300060353 | Ga0501082_0226392 | Ga0501082_0226392_303_1508 | 397 |
| 314 | 3300014325 | Ga0163163_10146329 | Ga0163163_101463292 | 398 |
| 315 | 3300025916 | Ga0207663_10049495 | Ga0207663_100494952 | 398 |
| 316 | 3300046528 | Ga0495642_0001905 | Ga0495642_0001905_398_1606 | 398 |
| 317 | 3300046538 | Ga0495609_0095538 | Ga0495609_0095538_62_1270 | 398 |
| 318 | 3300046542 | Ga0495597_0010825 | Ga0495597_0010825_2150_3358 | 398 |
| 319 | 3300046679 | Ga0495623_0067653 | Ga0495623_0067653_891_2099 | 398 |
| 320 | 3300047317 | Ga0495604_0018363 | Ga0495604_0018363_475_1683 | 398 |
| 321 | 3300048091 | Ga0495626_0000792 | Ga0495626_0000792_13190_14398 | 398 |
| 322 | 3300005347 | Ga0070668_100019831 | Ga0070668_1000198312 | 399 |
| 323 | 3300005353 | Ga0070669_100276755 | Ga0070669_1002767551 | 399 |
| 324 | 3300005843 | Ga0068860_100018897 | Ga0068860_1000188973 | 399 |
| 325 | 3300009177 | Ga0105248_10175569 | Ga0105248_101755692 | 399 |
| 326 | 3300025938 | Ga0207704_10030354 | Ga0207704_100303543 | 399 |
| 327 | 3300026035 | Ga0207703_10136793 | Ga0207703_101367932 | 399 |
| 328 | 3300026089 | Ga0207648_10049622 | Ga0207648_100496222 | 399 |
| 329 | 3300028381 | Ga0268264_10007843 | Ga0268264_100078433 | 399 |
| 330 | 3300005329 | Ga0070683_100040826 | Ga0070683_1000408264 | 400 |
| 331 | 3300005330 | Ga0070690_100017811 | Ga0070690_1000178112 | 400 |
| 332 | 3300005331 | Ga0070670_100014777 | Ga0070670_1000147776 | 400 |
| 333 | 3300005331 | Ga0070670_100038332 | Ga0070670_1000383324 | 400 |
| 334 | 3300005331 | Ga0070670_100321629 | Ga0070670_1003216291 | 400 |
| 335 | 3300005333 | Ga0070677_10037504 | Ga0070677_100375042 | 400 |
| 336 | 3300005335 | Ga0070666_10016572 | Ga0070666_100165722 | 400 |
| 337 | 3300005335 | Ga0070666_10026969 | Ga0070666_100269694 | 400 |
| 338 | 3300005337 | Ga0070682_100044265 | Ga0070682_1000442652 | 400 |
| 339 | 3300005339 | Ga0070660_100032108 | Ga0070660_1000321081 | 400 |
| 340 | 3300005340 | Ga0070689_100014168 | Ga0070689_1000141685 | 400 |
| 341 | 3300005347 | Ga0070668_100031659 | Ga0070668_1000316591 | 400 |
| 342 | 3300005347 | Ga0070668_100217232 | Ga0070668_1002172321 | 400 |
| 343 | 3300005354 | Ga0070675_100009451 | Ga0070675_1000094514 | 400 |
| 344 | 3300005354 | Ga0070675_100107154 | Ga0070675_1001071541 | 400 |
| 345 | 3300005356 | Ga0070674_100125911 | Ga0070674_1001259112 | 400 |
| 346 | 3300005356 | Ga0070674_100158589 | Ga0070674_1001585892 | 400 |
| 347 | 3300005364 | Ga0070673_100005875 | Ga0070673_1000058752 | 400 |
| 348 | 3300005365 | Ga0070688_100000814 | Ga0070688_10000081413 | 400 |
| 349 | 3300005365 | Ga0070688_100180442 | Ga0070688_1001804421 | 400 |
| 350 | 3300005367 | Ga0070667_100113627 | Ga0070667_1001136272 | 400 |
| 351 | 3300005367 | Ga0070667_100142414 | Ga0070667_1001424142 | 400 |
| 352 | 3300005367 | Ga0070667_100230627 | Ga0070667_1002306271 | 400 |
| 353 | 3300005434 | Ga0070709_10039869 | Ga0070709_100398692 | 400 |
| 354 | 3300005435 | Ga0070714_100091600 | Ga0070714_1000916002 | 400 |
| 355 | 3300005436 | Ga0070713_100000039 | Ga0070713_10000003971 | 400 |
| 356 | 3300005436 | Ga0070713_100041327 | Ga0070713_1000413272 | 400 |
| 357 | 3300005436 | Ga0070713_100214895 | Ga0070713_1002148952 | 400 |
| 358 | 3300005439 | Ga0070711_100019511 | Ga0070711_1000195112 | 400 |
| 359 | 3300005439 | Ga0070711_100113255 | Ga0070711_1001132552 | 400 |
| 360 | 3300005440 | Ga0070705_100031777 | Ga0070705_1000317772 | 400 |
| 361 | 3300005445 | Ga0070708_100000818 | Ga0070708_10000081814 | 400 |
| 362 | 3300005456 | Ga0070678_100000991 | Ga0070678_1000009913 | 400 |
| 363 | 3300005466 | Ga0070685_10009162 | Ga0070685_100091622 | 400 |
| 364 | 3300005518 | Ga0070699_100062841 | Ga0070699_1000628412 | 400 |
| 365 | 3300005535 | Ga0070684_100098560 | Ga0070684_1000985602 | 400 |
| 366 | 3300005543 | Ga0070672_100007989 | Ga0070672_1000079895 | 400 |
| 367 | 3300005543 | Ga0070672_100073509 | Ga0070672_1000735092 | 400 |
| 368 | 3300005543 | Ga0070672_100245810 | Ga0070672_1002458102 | 400 |
| 369 | 3300005547 | Ga0070693_100002942 | Ga0070693_1000029422 | 400 |
| 370 | 3300005548 | Ga0070665_100018445 | Ga0070665_1000184452 | 400 |
| 371 | 3300005548 | Ga0070665_100041396 | Ga0070665_1000413962 | 400 |
| 372 | 3300005615 | Ga0070702_100008195 | Ga0070702_1000081952 | 400 |
| 373 | 3300005618 | Ga0068864_100000836 | Ga0068864_1000008366 | 400 |
| 374 | 3300005719 | Ga0068861_100037494 | Ga0068861_1000374943 | 400 |
| 375 | 3300005834 | Ga0068851_10047297 | Ga0068851_100472971 | 400 |
| 376 | 3300005841 | Ga0068863_100060640 | Ga0068863_1000606402 | 400 |
| 377 | 3300005842 | Ga0068858_100002758 | Ga0068858_1000027584 | 400 |
| 378 | 3300005843 | Ga0068860_100023120 | Ga0068860_1000231205 | 400 |
| 379 | 3300005843 | Ga0068860_100057122 | Ga0068860_1000571224 | 400 |
| 380 | 3300005843 | Ga0068860_100150694 | Ga0068860_1001506942 | 400 |
| 381 | 3300005844 | Ga0068862_100025598 | Ga0068862_1000255985 | 400 |
| 382 | 3300006175 | Ga0070712_100007146 | Ga0070712_1000071464 | 400 |
| 383 | 3300009093 | Ga0105240_10041376 | Ga0105240_100413765 | 400 |
| 384 | 3300009098 | Ga0105245_10023939 | Ga0105245_100239395 | 400 |
| 385 | 3300011119 | Ga0105246_10101442 | Ga0105246_101014422 | 400 |
| 386 | 3300013104 | Ga0157370_10038560 | Ga0157370_100385602 | 400 |
| 387 | 3300013296 | Ga0157374_10003153 | Ga0157374_100031537 | 400 |
| 388 | 3300013308 | Ga0157375_10004445 | Ga0157375_100044458 | 400 |
| 389 | 3300013308 | Ga0157375_10094933 | Ga0157375_100949333 | 400 |
| 390 | 3300014325 | Ga0163163_10031646 | Ga0163163_100316463 | 400 |
| 391 | 3300014968 | Ga0157379_10127190 | Ga0157379_101271902 | 400 |
| 392 | 3300025321 | Ga0207656_10072958 | Ga0207656_100729581 | 400 |
| 393 | 3300025893 | Ga0207682_10020887 | Ga0207682_100208872 | 400 |
| 394 | 3300025903 | Ga0207680_10053062 | Ga0207680_100530622 | 400 |
| 395 | 3300025903 | Ga0207680_10067983 | Ga0207680_100679832 | 400 |
| 396 | 3300025905 | Ga0207685_10010174 | Ga0207685_100101742 | 400 |
| 397 | 3300025906 | Ga0207699_10053788 | Ga0207699_100537882 | 400 |
| 398 | 3300025907 | Ga0207645_10026027 | Ga0207645_100260272 | 400 |
| 399 | 3300025915 | Ga0207693_10081715 | Ga0207693_100817152 | 400 |
| 400 | 3300025919 | Ga0207657_10002457 | Ga0207657_1000245712 | 400 |
| 401 | 3300025925 | Ga0207650_10078380 | Ga0207650_100783802 | 400 |
| 402 | 3300025926 | Ga0207659_10005664 | Ga0207659_100056644 | 400 |
| 403 | 3300025928 | Ga0207700_10000120 | Ga0207700_1000012035 | 400 |
| 404 | 3300025928 | Ga0207700_10027995 | Ga0207700_100279952 | 400 |
| 405 | 3300025928 | Ga0207700_10048370 | Ga0207700_100483703 | 400 |
| 406 | 3300025929 | Ga0207664_10002996 | Ga0207664_100029962 | 400 |
| 407 | 3300025931 | Ga0207644_10008406 | Ga0207644_100084063 | 400 |
| 408 | 3300025933 | Ga0207706_10058157 | Ga0207706_100581572 | 400 |
| 409 | 3300025936 | Ga0207670_10014556 | Ga0207670_100145562 | 400 |
| 410 | 3300025937 | Ga0207669_10049948 | Ga0207669_100499483 | 400 |
| 411 | 3300025937 | Ga0207669_10235091 | Ga0207669_102350911 | 400 |
| 412 | 3300025939 | Ga0207665_10036446 | Ga0207665_100364462 | 400 |
| 413 | 3300025939 | Ga0207665_10053311 | Ga0207665_100533111 | 400 |
| 414 | 3300025940 | Ga0207691_10146841 | Ga0207691_101468412 | 400 |
| 415 | 3300025941 | Ga0207711_10000116 | Ga0207711_100001167 | 400 |
| 416 | 3300025960 | Ga0207651_10064408 | Ga0207651_100644082 | 400 |
| 417 | 3300025960 | Ga0207651_10077126 | Ga0207651_100771262 | 400 |
| 418 | 3300025972 | Ga0207668_10082181 | Ga0207668_100821812 | 400 |
| 419 | 3300025986 | Ga0207658_10007272 | Ga0207658_100072726 | 400 |
| 420 | 3300025986 | Ga0207658_10091623 | Ga0207658_100916233 | 400 |
| 421 | 3300025986 | Ga0207658_10255881 | Ga0207658_102558812 | 400 |
| 422 | 3300026023 | Ga0207677_10000188 | Ga0207677_1000018825 | 400 |
| 423 | 3300026023 | Ga0207677_10081527 | Ga0207677_100815272 | 400 |
| 424 | 3300026035 | Ga0207703_10000806 | Ga0207703_1000080625 | 400 |
| 425 | 3300026067 | Ga0207678_10079420 | Ga0207678_100794202 | 400 |
| 426 | 3300026078 | Ga0207702_10036658 | Ga0207702_100366582 | 400 |
| 427 | 3300026088 | Ga0207641_10037558 | Ga0207641_100375582 | 400 |
| 428 | 3300026095 | Ga0207676_10000230 | Ga0207676_1000023019 | 400 |
| 429 | 3300026116 | Ga0207674_10058812 | Ga0207674_100588122 | 400 |
| 430 | 3300026118 | Ga0207675_100072207 | Ga0207675_1000722073 | 400 |
| 431 | 3300026121 | Ga0207683_10001221 | Ga0207683_1000122112 | 400 |
| 432 | 3300028379 | Ga0268266_10176494 | Ga0268266_101764942 | 400 |
| 433 | 3300028380 | Ga0268265_10060750 | Ga0268265_100607502 | 400 |
| 434 | 3300031235 | Ga0265330_10007182 | Ga0265330_100071824 | 400 |
| 435 | 3300031238 | Ga0265332_10000776 | Ga0265332_100007769 | 400 |
| 436 | 3300031239 | Ga0265328_10035441 | Ga0265328_100354411 | 400 |
| 437 | 3300031241 | Ga0265325_10039806 | Ga0265325_100398061 | 400 |
| 438 | 3300031242 | Ga0265329_10005639 | Ga0265329_100056392 | 400 |
| 439 | 3300031250 | Ga0265331_10000464 | Ga0265331_1000046416 | 400 |
| 440 | 3300031344 | Ga0265316_10030543 | Ga0265316_100305431 | 400 |
| 441 | 3300031711 | Ga0265314_10022532 | Ga0265314_100225322 | 400 |
| 442 | 3300035083 | Ga0373926_0035183 | Ga0373926_0035183_447_1670 | 400 |
| 443 | 3300035086 | Ga0373934_0010580 | Ga0373934_0010580_2013_3287 | 400 |
| 444 | 3300035116 | Ga0373945_0034959 | Ga0373945_0034959_95_1366 | 400 |
| 445 | 3300035117 | Ga0373953_0006271 | Ga0373953_0006271_2475_3749 | 400 |
| 446 | 3300035692 | Ga0373935_0019629 | Ga0373935_0019629_1152_2423 | 400 |
| 447 | 3300035692 | Ga0373935_0086040 | Ga0373935_0086040_645_1886 | 400 |
| 448 | 3300035725 | Ga0373947_0023666 | Ga0373947_0023666_2073_3296 | 400 |
| 449 | 3300036401 | Ga0373937_0011991 | Ga0373937_0011991_5579_6802 | 400 |
| 450 | 3300036401 | Ga0373937_0023672 | Ga0373937_0023672_1561_2802 | 400 |
| 451 | 3300036401 | Ga0373937_0167934 | Ga0373937_0167934_211_1428 | 400 |
| 452 | 3300037068 | Ga0373925_0074644 | Ga0373925_0074644_779_2002 | 400 |
| 453 | 3300046454 | Ga0495592_0201963 | Ga0495592_0201963_34_1308 | 400 |
| 454 | 3300046472 | Ga0495580_0146033 | Ga0495580_0146033_243_1466 | 400 |
| 455 | 3300046511 | Ga0495608_0070933 | Ga0495608_0070933_457_1731 | 400 |
| 456 | 3300046680 | Ga0495646_0114673 | Ga0495646_0114673_213_1487 | 400 |
| 457 | 3300046683 | Ga0495658_0003752 | Ga0495658_0003752_4620_5843 | 400 |
| 458 | 3300046689 | Ga0495613_0068879 | Ga0495613_0068879_459_1682 | 400 |
| 459 | 3300047315 | Ga0495581_0004852 | Ga0495581_0004852_497_1720 | 400 |
| 460 | 3300048905 | Ga0496102_0202279 | Ga0496102_0202279_347_1621 | 400 |
| 461 | 3300048907 | Ga0496104_0009253 | Ga0496104_0009253_506_1729 | 400 |
| 462 | 3300048910 | Ga0496107_0101400 | Ga0496107_0101400_60_1334 | 400 |
| 463 | 3300048911 | Ga0496108_0052651 | Ga0496108_0052651_648_1871 | 400 |
| 464 | 3300048915 | Ga0496112_0043423 | Ga0496112_0043423_2048_3271 | 400 |
| 465 | 3300046542 | Ga0495597_0038596 | Ga0495597_0038596_69_1292 | 401 |
| 466 | 3300003187 | JGI25151J46595_10002421 | JGI25151J46595_100024216 | 402 |
| 467 | 3300003771 | Ga0055526_1007501 | Ga0055526_10075015 | 402 |
| 468 | 3300003771 | Ga0055526_1010796 | Ga0055526_10107962 | 402 |
| 469 | 3300003773 | Ga0055537_1002687 | Ga0055537_10026871 | 402 |
| 470 | 3300003781 | Ga0055536_1000078 | Ga0055536_100007816 | 402 |
| 471 | 3300003784 | Ga0055534_1000733 | Ga0055534_10007332 | 402 |
| 472 | 3300003784 | Ga0055534_1001294 | Ga0055534_10012944 | 402 |
| 473 | 3300025263 | Ga0209565_1000821 | Ga0209565_100082115 | 402 |
| 474 | 3300025273 | Ga0209673_1008548 | Ga0209673_10085484 | 402 |
| 475 | 3300025284 | Ga0209130_1013923 | Ga0209130_10139232 | 402 |
| 476 | 3300025291 | Ga0209675_1000087 | Ga0209675_100008717 | 402 |
| 477 | 3300025291 | Ga0209675_1005735 | Ga0209675_10057352 | 402 |
| 478 | 3300025292 | Ga0209676_1000176 | Ga0209676_100017667 | 402 |
| 479 | 3300025294 | Ga0209025_1000046 | Ga0209025_1000046104 | 402 |
| 480 | 3300025295 | Ga0209564_1000166 | Ga0209564_1000166138 | 402 |
| 481 | 3300025295 | Ga0209564_1001192 | Ga0209564_100119217 | 402 |
| 482 | 3300025295 | Ga0209564_1001289 | Ga0209564_100128921 | 402 |
| 483 | 3300025299 | Ga0209256_1004743 | Ga0209256_10047434 | 402 |
| 484 | 3300037466 | Ga0395898_0154686 | Ga0395898_0154686_794_2029 | 402 |
| 485 | 3300046457 | Ga0495590_0000380 | Ga0495590_0000380_14437_15672 | 402 |
| 486 | 3300046473 | Ga0495582_0015426 | Ga0495582_0015426_1788_3023 | 402 |
| 487 | 3300046491 | Ga0495584_0044575 | Ga0495584_0044575_814_2061 | 402 |
| 488 | 3300046499 | Ga0495594_0032145 | Ga0495594_0032145_603_1838 | 402 |
| 489 | 3300046506 | Ga0495583_0065791 | Ga0495583_0065791_97_1332 | 402 |
| 490 | 3300046526 | Ga0495666_0001609 | Ga0495666_0001609_3442_4677 | 402 |
| 491 | 3300046526 | Ga0495666_0009587 | Ga0495666_0009587_1969_3204 | 402 |
| 492 | 3300046531 | Ga0495665_0003474 | Ga0495665_0003474_6628_7863 | 402 |
| 493 | 3300046535 | Ga0495586_0051765 | Ga0495586_0051765_346_1581 | 402 |
| 494 | 3300046557 | Ga0495622_0001954 | Ga0495622_0001954_743_1978 | 402 |
| 495 | 3300046642 | Ga0495634_0111868 | Ga0495634_0111868_394_1629 | 402 |
| 496 | 3300046660 | Ga0495625_0010540 | Ga0495625_0010540_3154_4389 | 402 |
| 497 | 3300046663 | Ga0495635_0013697 | Ga0495635_0013697_4084_5331 | 402 |
| 498 | 3300046665 | Ga0495661_0115020 | Ga0495661_0115020_193_1428 | 402 |
| 499 | 3300046674 | Ga0495588_0007786 | Ga0495588_0007786_429_1664 | 402 |
| 500 | 3300046679 | Ga0495623_0010407 | Ga0495623_0010407_3331_4578 | 402 |
| 501 | 3300046690 | Ga0495624_0011383 | Ga0495624_0011383_3290_4525 | 402 |
| 502 | 3300047315 | Ga0495581_0006624 | Ga0495581_0006624_5327_6562 | 402 |
| 503 | 3300047317 | Ga0495604_0007005 | Ga0495604_0007005_6916_8151 | 402 |
| 504 | 3300047322 | Ga0495680_0010916 | Ga0495680_0010916_552_1799 | 402 |
| 505 | 3300047444 | Ga0495675_0036457 | Ga0495675_0036457_1507_2742 | 402 |
| 506 | 3300048089 | Ga0495614_0005446 | Ga0495614_0005446_3960_5207 | 402 |
| 507 | 3300048910 | Ga0496107_0028147 | Ga0496107_0028147_2715_3950 | 402 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pk3-assembly1.cif.gz_B | alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana | 0.9809 | 6 | 391 |
| 1iug-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus | 0.958 | 13 | 373 |
| 1iug-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus | 0.95 | 13 | 373 |
| 2dr1-assembly1.cif.gz_B | crystal structure of the ph1308 protein from pyrococcus horikoshii ot3 | 0.9482 | 11 | 372 |
| 6pk3-assembly1.cif.gz_B | alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana | 0.9447 | 6 | 391 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6KIG3_10_230_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9808 | 23 | 239 | 3.40.640.10 |
| af_B6T171_24_270_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9743 | 26 | 266 | 3.40.640.10 |
| af_A0A1D6KIH4_267_382_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9733 | 278 | 391 | 3.90.1150.10 |
| af_A0A1D6KIG3_10_230_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.959 | 23 | 239 | 3.40.640.10 |
| af_Q2FXK2_10_249_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9585 | 17 | 255 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352SDU8-F1-model_v4 | Serine--glyoxylate aminotransferase | 0.9993 | 146 | 385 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A2E9NWN9-F1-model_v4 | Serine--glyoxylate aminotransferase | 0.9976 | 38 | 390 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A7W7VCS5-F1-model_v4 | Alanine-glyoxylate transaminase/serine-glyoxylate transaminase/serine-pyruvate transaminase (EC 2.6.1.44, EC 2.6.1.45, EC 2.6.1.51) | 0.9968 | 27 | 391 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 GO:0050281 |
| AF-A0A7X5WJ28-F1-model_v4 | deleted | 0.9966 | 134 | 222 |
|
| AF-A0A382KT89-F1-model_v4 | Aminotransferase class V domain-containing protein | 0.996 | 142 | 391 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar