F456691

General Info

Members Datasets Scaffolds Average Seq Length
507 205 1014 81

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_11178000|Ga0207646_111780002
Length 81
Sequence MKIKTLVFASALALISTSALAFHCPADMKAIDDALPKAKLDATKTAEVKKLRAEGETLHKAGKHQESVDTLAKAMKILDIK

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.39
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 1.38
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_11178000 3300025922 Bacteria 672
2 Ga0058859_11577090 3300004798 Bacteria 582
3 Ga0058860_11818238 3300004801 Bacteria 620
4 Ga0065707_10148719 3300005295 Bacteria 1677
5 Ga0065707_10369601 3300005295 Bacteria 892
6 Ga0070676_10287450 3300005328 Bacteria 1110
7 Ga0070676_10451699 3300005328 Bacteria 904
8 Ga0070676_11302143 3300005328 Bacteria 555
9 Ga0070690_100001319 3300005330 Bacteria 12904
10 Ga0070690_100013972 3300005330 Bacteria 4760
11 Ga0070690_100105547 3300005330 Bacteria 1873
12 Ga0070690_101671710 3300005330 Bacteria 517
13 Ga0070670_100000272 3300005331 Bacteria 45908
14 Ga0070670_100211296 3300005331 Bacteria 1687
15 Ga0070670_100304903 3300005331 Bacteria 1393
16 Ga0070670_100930627 3300005331 Bacteria 789
17 Ga0070670_101335165 3300005331 Bacteria 657
18 Ga0070677_10045241 3300005333 Bacteria 1755
19 Ga0070677_10420166 3300005333 Bacteria 709
20 Ga0070677_10730904 3300005333 Bacteria 560
21 Ga0068869_100007766 3300005334 Bacteria 6880
22 Ga0068869_101305472 3300005334 Bacteria 640
23 Ga0070666_10871395 3300005335 Bacteria 665
24 Ga0070680_101097516 3300005336 Bacteria 688
25 Ga0070682_100091494 3300005337 Bacteria 1991
26 Ga0070682_100386625 3300005337 Bacteria 1054
27 Ga0068868_100056807 3300005338 Bacteria 3091
28 Ga0068868_100266914 3300005338 Bacteria 1445
29 Ga0068868_100635511 3300005338 Bacteria 949
30 Ga0068868_101059209 3300005338 Bacteria 744
31 Ga0068868_101294074 3300005338 Bacteria 677
32 Ga0070689_100017280 3300005340 Bacteria 5294
33 Ga0070689_100169622 3300005340 Bacteria 1768
34 Ga0070689_100969677 3300005340 Bacteria 755
35 Ga0070687_100162082 3300005343 Bacteria 1323
36 Ga0070687_100186284 3300005343 Bacteria 1247
37 Ga0070687_100398064 3300005343 Bacteria 902
38 Ga0070687_101268707 3300005343 Bacteria 546
39 Ga0070661_100829609 3300005344 Bacteria 760
40 Ga0070661_101151684 3300005344 Unclassified 647
41 Ga0070692_10015130 3300005345 Bacteria 3642
42 Ga0070692_10689340 3300005345 Bacteria 686
43 Ga0070692_11096295 3300005345 Bacteria 562
44 Ga0070668_100000766 3300005347 Bacteria 22083
45 Ga0070668_100031818 3300005347 Bacteria 4015
46 Ga0070668_100070906 3300005347 Bacteria 2714
47 Ga0070668_100432208 3300005347 Bacteria 1129
48 Ga0070669_100042477 3300005353 Bacteria 3308
49 Ga0070669_100065051 3300005353 Bacteria 2686
50 Ga0070669_100116391 3300005353 Bacteria 2034
51 Ga0070669_100291641 3300005353 Bacteria 1310
52 Ga0070669_100776614 3300005353 Bacteria 813
53 Ga0070675_100007316 3300005354 Bacteria 8520
54 Ga0070675_100035721 3300005354 Bacteria 4040
55 Ga0070675_100510089 3300005354 Bacteria 1084
56 Ga0070675_101076748 3300005354 Bacteria 739
57 Ga0070671_100530968 3300005355 Bacteria 1014
58 Ga0070674_100018094 3300005356 Bacteria 4447
59 Ga0070674_100098692 3300005356 Bacteria 2123
60 Ga0070674_100698405 3300005356 Bacteria 867
61 Ga0070674_101587074 3300005356 Bacteria 590
62 Ga0070674_102229173 3300005356 Unclassified 500
63 Ga0070673_100061162 3300005364 Bacteria 2987
64 Ga0070673_100126863 3300005364 Bacteria 2136
65 Ga0070673_100212204 3300005364 Bacteria 1672
66 Ga0070673_101009949 3300005364 Bacteria 775
67 Ga0070688_100108168 3300005365 Bacteria 1844
68 Ga0070667_100012875 3300005367 Bacteria 6910
69 Ga0070667_100061329 3300005367 Bacteria 3184
70 Ga0070667_100692630 3300005367 Bacteria 942
71 Ga0070667_100820016 3300005367 Bacteria 864
72 Ga0070667_101062731 3300005367 Bacteria 756
73 Ga0070709_10461904 3300005434 Bacteria 958
74 Ga0070713_100356619 3300005436 Bacteria 1358
75 Ga0070701_10001159 3300005438 Bacteria 9634
76 Ga0070701_10241412 3300005438 Bacteria 1087
77 Ga0070701_10386882 3300005438 Bacteria 883
78 Ga0070705_100010452 3300005440 Bacteria 4647
79 Ga0070705_100039388 3300005440 Bacteria 2681
80 Ga0070705_100041780 3300005440 Bacteria 2617
81 Ga0070705_100345003 3300005440 Bacteria 1084
82 Ga0070705_100373693 3300005440 Bacteria 1047
83 Ga0070705_100747408 3300005440 Bacteria 773
84 Ga0070705_100788815 3300005440 Bacteria 755
85 Ga0070700_100001212 3300005441 Bacteria 12781
86 Ga0070700_100064067 3300005441 Bacteria 2327
87 Ga0070700_100339551 3300005441 Bacteria 1110
88 Ga0070700_100628026 3300005441 Bacteria 845
89 Ga0070694_100015191 3300005444 Bacteria 4829
90 Ga0070694_100128513 3300005444 Bacteria 1827
91 Ga0070694_100145307 3300005444 Bacteria 1727
92 Ga0070694_100360949 3300005444 Bacteria 1128
93 Ga0070694_100477833 3300005444 Bacteria 988
94 Ga0070694_100598107 3300005444 Bacteria 888
95 Ga0070694_101052794 3300005444 Unclassified 677
96 Ga0070708_102082517 3300005445 Bacteria 525
97 Ga0070663_100241147 3300005455 Bacteria 1427
98 Ga0070678_100064794 3300005456 Bacteria 2710
99 Ga0070678_100170263 3300005456 Bacteria 1773
100 Ga0070678_100273367 3300005456 Bacteria 1426
101 Ga0070678_100945719 3300005456 Bacteria 790
102 Ga0070678_101206053 3300005456 Bacteria 702
103 Ga0070678_101513321 3300005456 Bacteria 629
104 Ga0070662_100081780 3300005457 Bacteria 2407
105 Ga0070662_100204856 3300005457 Bacteria 1567
106 Ga0070681_10042789 3300005458 Bacteria 4538
107 Ga0068867_100010078 3300005459 Bacteria 6659
108 Ga0068867_100168576 3300005459 Bacteria 1732
109 Ga0068867_101024033 3300005459 Bacteria 750
110 Ga0068867_101940111 3300005459 Bacteria 556
111 Ga0070685_10095647 3300005466 Bacteria 1806
112 Ga0070685_10120506 3300005466 Bacteria 1629
113 Ga0070706_100288342 3300005467 Bacteria 1532
114 Ga0070706_100971124 3300005467 Unclassified 784
115 Ga0070707_100051776 3300005468 Bacteria 3936
116 Ga0070707_100298949 3300005468 Bacteria 1564
117 Ga0070707_100665283 3300005468 Bacteria 1004
118 Ga0070707_100911410 3300005468 Bacteria 844
119 Ga0070698_100012646 3300005471 Bacteria 8937
120 Ga0070698_100299561 3300005471 Bacteria 1538
121 Ga0070699_100103007 3300005518 Bacteria 2503
122 Ga0070699_101878766 3300005518 Bacteria 548
123 Ga0070699_102154283 3300005518 Bacteria 509
124 Ga0070679_100171893 3300005530 Bacteria 2139
125 Ga0070684_100275419 3300005535 Bacteria 1541
126 Ga0070684_100944000 3300005535 Bacteria 809
127 Ga0070697_100054080 3300005536 Bacteria 3263
128 Ga0070697_100127783 3300005536 Bacteria 2130
129 Ga0070697_101091857 3300005536 Bacteria 710
130 Ga0070672_100005594 3300005543 Bacteria 8356
131 Ga0070672_100109500 3300005543 Bacteria 2250
132 Ga0070672_100908422 3300005543 Bacteria 778
133 Ga0070686_100000828 3300005544 Bacteria 17886
134 Ga0070686_100004165 3300005544 Bacteria 7960
135 Ga0070686_100974144 3300005544 Bacteria 694
136 Ga0070695_100038330 3300005545 Bacteria 3024
137 Ga0070695_100058933 3300005545 Bacteria 2484
138 Ga0070695_100125599 3300005545 Bacteria 1761
139 Ga0070695_101282529 3300005545 Bacteria 605
140 Ga0070696_100069113 3300005546 Bacteria 2481
141 Ga0070696_100189107 3300005546 Bacteria 1532
142 Ga0070696_100375202 3300005546 Bacteria 1107
143 Ga0070696_100738485 3300005546 Bacteria 805
144 Ga0070696_101585431 3300005546 Bacteria 562
145 Ga0070693_100262232 3300005547 Bacteria 1150
146 Ga0070693_100290247 3300005547 Bacteria 1099
147 Ga0070693_100625621 3300005547 Bacteria 780
148 Ga0070704_100001933 3300005549 Bacteria 11457
149 Ga0070704_100023485 3300005549 Bacteria 4029
150 Ga0070704_100062858 3300005549 Bacteria 2663
151 Ga0070704_100070470 3300005549 Bacteria 2537
152 Ga0070704_101150004 3300005549 Bacteria 706
153 Ga0068855_102309846 3300005563 Bacteria 538
154 Ga0070664_102248138 3300005564 Bacteria 517
155 Ga0068857_100056137 3300005577 Bacteria 3495
156 Ga0068856_100049208 3300005614 Bacteria 4155
157 Ga0070702_100017999 3300005615 Bacteria 3656
158 Ga0070702_100575398 3300005615 Bacteria 840
159 Ga0070702_100715285 3300005615 Bacteria 765
160 Ga0070702_101133027 3300005615 Bacteria 627
161 Ga0068859_100014737 3300005617 Bacteria 7856
162 Ga0068859_100016670 3300005617 Bacteria 7376
163 Ga0068859_100110809 3300005617 Bacteria 2807
164 Ga0068859_100321994 3300005617 Bacteria 1640
165 Ga0068859_101031863 3300005617 Bacteria 904
166 Ga0068864_100010368 3300005618 Bacteria 7695
167 Ga0068864_100039584 3300005618 Bacteria 4029
168 Ga0068864_100248407 3300005618 Bacteria 1651
169 Ga0068864_100441756 3300005618 Bacteria 1243
170 Ga0068864_100878840 3300005618 Bacteria 884
171 Ga0068866_10529102 3300005718 Bacteria 785
172 Ga0068866_10848469 3300005718 Bacteria 638
173 Ga0068861_100307965 3300005719 Bacteria 1374
174 Ga0068861_100321132 3300005719 Bacteria 1348
175 Ga0068861_100369217 3300005719 Bacteria 1264
176 Ga0068861_100409797 3300005719 Bacteria 1205
177 Ga0068861_100589092 3300005719 Bacteria 1019
178 Ga0068870_10060333 3300005840 Bacteria 2036
179 Ga0068870_10198713 3300005840 Bacteria 1214
180 Ga0068863_100003169 3300005841 Bacteria 16259
181 Ga0068863_100359522 3300005841 Bacteria 1419
182 Ga0068863_100899225 3300005841 Bacteria 886
183 Ga0068863_101784171 3300005841 Bacteria 625
184 Ga0068858_100057527 3300005842 Bacteria 3594
185 Ga0068858_100357253 3300005842 Bacteria 1400
186 Ga0068858_102299512 3300005842 Bacteria 533
187 Ga0068860_100102971 3300005843 Bacteria 2725
188 Ga0068862_100015035 3300005844 Bacteria 6428
189 Ga0068862_100015774 3300005844 Bacteria 6278
190 Ga0068862_100035482 3300005844 Bacteria 4224
191 Ga0068862_100167388 3300005844 Bacteria 1966
192 Ga0068862_100212860 3300005844 Bacteria 1747
193 Ga0068862_101175472 3300005844 Bacteria 765
194 Ga0068862_102216807 3300005844 Bacteria 561
195 Ga0070715_11045123 3300006163 Bacteria 511
196 Ga0070716_100002410 3300006173 Bacteria 8604
197 Ga0070716_100434212 3300006173 Bacteria 953
198 Ga0075366_10026036 3300006195 Bacteria 3423
199 Ga0097621_100000358 3300006237 Bacteria 31596
200 Ga0097621_100031370 3300006237 Bacteria 4217
201 Ga0097621_100558032 3300006237 Bacteria 1043
202 Ga0097621_100649488 3300006237 Bacteria 968
203 Ga0097621_101886488 3300006237 Bacteria 570
204 Ga0068871_100006646 3300006358 Bacteria 8204
205 Ga0068871_100064449 3300006358 Bacteria 3000
206 Ga0068871_100341706 3300006358 Bacteria 1322
207 Ga0068871_100841881 3300006358 Bacteria 847
208 Ga0075428_100366690 3300006844 Bacteria 1545
209 Ga0075428_100582966 3300006844 Bacteria 1195
210 Ga0075430_101612294 3300006846 Bacteria 533
211 Ga0075433_10014945 3300006852 Bacteria 6353
212 Ga0075434_100157040 3300006871 Bacteria 2294
213 Ga0075434_100161383 3300006871 Bacteria 2261
214 Ga0075434_101124035 3300006871 Bacteria 799
215 Ga0068865_100001028 3300006881 Bacteria 16066
216 Ga0068865_100097031 3300006881 Bacteria 2150
217 Ga0068865_100808380 3300006881 Bacteria 809
218 Ga0075436_100008614 3300006914 Bacteria 6972
219 Ga0075436_100061335 3300006914 Bacteria 2598
220 Ga0075436_100364084 3300006914 Bacteria 1044
221 Ga0075436_100816351 3300006914 Bacteria 695
222 Ga0097620_100014737 3300006931 Bacteria 7856
223 Ga0097620_100016670 3300006931 Bacteria 7376
224 Ga0097620_100110819 3300006931 Bacteria 2807
225 Ga0097620_100321967 3300006931 Bacteria 1640
226 Ga0097620_101031872 3300006931 Bacteria 904
227 Ga0075435_100077874 3300007076 Bacteria 2719
228 Ga0075435_100118692 3300007076 Bacteria 2205
229 Ga0075435_100523425 3300007076 Bacteria 1026
230 Ga0099794_10006405 3300007265 Bacteria 4764
231 Ga0099794_10044607 3300007265 Bacteria 2119
232 Ga0099794_10081301 3300007265 Bacteria 1598
233 Ga0099794_10216010 3300007265 Bacteria 984
234 Ga0099795_10008354 3300007788 Bacteria 2947
235 Ga0111539_10117580 3300009094 Bacteria 3116
236 Ga0111539_10153306 3300009094 Bacteria 2697
237 Ga0105245_10004069 3300009098 Bacteria 12986
238 Ga0105245_10775440 3300009098 Bacteria 996
239 Ga0105245_10988560 3300009098 Bacteria 885
240 Ga0105245_13111571 3300009098 Bacteria 514
241 Ga0114129_10689841 3300009147 Bacteria 1313
242 Ga0114129_11383238 3300009147 Bacteria 869
243 Ga0105243_10001855 3300009148 Bacteria 18036
244 Ga0105243_10030684 3300009148 Bacteria 4141
245 Ga0105243_10629791 3300009148 Bacteria 1037
246 Ga0105243_11014778 3300009148 Bacteria 833
247 Ga0105243_11630416 3300009148 Bacteria 672
248 Ga0105242_10067888 3300009176 Bacteria 2949
249 Ga0105242_10363336 3300009176 Bacteria 1340
250 Ga0105248_10328026 3300009177 Bacteria 1724
251 Ga0105248_10364259 3300009177 Bacteria 1627
252 Ga0105248_11231138 3300009177 Bacteria 846
253 Ga0105238_10487571 3300009551 Bacteria 1232
254 Ga0105249_10090770 3300009553 Bacteria 2857
255 Ga0105249_12715061 3300009553 Bacteria 567
256 Ga0105249_13472432 3300009553 Bacteria 507
257 Ga0157374_10374510 3300013296 Bacteria 1418
258 Ga0157378_10002331 3300013297 Bacteria 16874
259 Ga0157378_10172345 3300013297 Bacteria 2030
260 Ga0163162_10092350 3300013306 Bacteria 3110
261 Ga0163162_10140581 3300013306 Bacteria 2527
262 Ga0163162_10739504 3300013306 Bacteria 1103
263 Ga0163162_10752280 3300013306 Bacteria 1094
264 Ga0163162_11246063 3300013306 Bacteria 844
265 Ga0163162_11578500 3300013306 Bacteria 748
266 Ga0163162_11652126 3300013306 Bacteria 731
267 Ga0163162_12447529 3300013306 Bacteria 600
268 Ga0157375_10027244 3300013308 Bacteria 5340
269 Ga0157375_10128382 3300013308 Bacteria 2653
270 Ga0157375_10330023 3300013308 Bacteria 1690
271 Ga0157375_11017507 3300013308 Bacteria 968
272 Ga0157375_11388342 3300013308 Unclassified 827
273 Ga0157375_13252355 3300013308 Bacteria 542
274 Ga0157375_13807826 3300013308 Bacteria 501
275 Ga0163163_10002859 3300014325 Bacteria 14599
276 Ga0163163_11438881 3300014325 Bacteria 751
277 Ga0157380_10002730 3300014326 Bacteria 11980
278 Ga0157380_10014276 3300014326 Bacteria 5810
279 Ga0157380_10111859 3300014326 Bacteria 2296
280 Ga0157380_11483607 3300014326 Bacteria 731
281 Ga0157380_12879785 3300014326 Bacteria 547
282 Ga0157377_10437046 3300014745 Bacteria 900
283 Ga0157379_10065814 3300014968 Bacteria 3240
284 Ga0157379_10177974 3300014968 Bacteria 1921
285 Ga0157376_10164898 3300014969 Bacteria 2012
286 Ga0157376_10484940 3300014969 Bacteria 1212
287 Ga0157376_11951085 3300014969 Bacteria 624
288 Ga0163161_10074329 3300017792 Bacteria 2492
289 Ga0163161_10119045 3300017792 Bacteria 1982
290 Ga0209129_1015816 3300025258 Bacteria 1536
291 Ga0209758_1000078 3300025297 Bacteria 266153
292 Ga0207697_10273495 3300025315 Bacteria 748
293 Ga0207653_10102585 3300025885 Bacteria 1013
294 Ga0207682_10235360 3300025893 Bacteria 850
295 Ga0207682_10512009 3300025893 Bacteria 568
296 Ga0207692_10808352 3300025898 Bacteria 613
297 Ga0207642_10499423 3300025899 Bacteria 744
298 Ga0207680_11180477 3300025903 Bacteria 546
299 Ga0207685_10273177 3300025905 Bacteria 826
300 Ga0207645_10419975 3300025907 Bacteria 901
301 Ga0207645_10907847 3300025907 Bacteria 598
302 Ga0207643_10009467 3300025908 Bacteria 5233
303 Ga0207643_10111616 3300025908 Bacteria 1611
304 Ga0207707_10273009 3300025912 Bacteria 1465
305 Ga0207660_11659710 3300025917 Bacteria 514
306 Ga0207662_10306678 3300025918 Bacteria 1057
307 Ga0207662_10371226 3300025918 Bacteria 965
308 Ga0207662_10422008 3300025918 Bacteria 908
309 Ga0207646_10435654 3300025922 Bacteria 1183
310 Ga0207646_11475954 3300025922 Bacteria 589
311 Ga0207681_10065449 3300025923 Bacteria 2513
312 Ga0207681_10238207 3300025923 Bacteria 1415
313 Ga0207681_10411226 3300025923 Bacteria 1094
314 Ga0207681_10623922 3300025923 Bacteria 892
315 Ga0207681_10842336 3300025923 Bacteria 767
316 Ga0207681_10988449 3300025923 Bacteria 706
317 Ga0207694_11235771 3300025924 Bacteria 632
318 Ga0207650_10002956 3300025925 Bacteria 11725
319 Ga0207650_10025833 3300025925 Bacteria 4186
320 Ga0207650_10092583 3300025925 Bacteria 2312
321 Ga0207650_10283900 3300025925 Bacteria 1349
322 Ga0207650_11310287 3300025925 Bacteria 616
323 Ga0207659_10027298 3300025926 Bacteria 3864
324 Ga0207659_10380182 3300025926 Bacteria 1177
325 Ga0207659_10762795 3300025926 Bacteria 830
326 Ga0207687_10060801 3300025927 Bacteria 2666
327 Ga0207687_10568226 3300025927 Bacteria 953
328 Ga0207644_10090157 3300025931 Bacteria 2284
329 Ga0207706_10011408 3300025933 Bacteria 8094
330 Ga0207706_11054651 3300025933 Bacteria 681
331 Ga0207686_10002060 3300025934 Bacteria 11078
332 Ga0207686_11054584 3300025934 Bacteria 661
333 Ga0207709_10002015 3300025935 Bacteria 13179
334 Ga0207709_10471581 3300025935 Bacteria 974
335 Ga0207709_11191601 3300025935 Bacteria 627
336 Ga0207709_11527098 3300025935 Bacteria 554
337 Ga0207670_10016949 3300025936 Bacteria 4392
338 Ga0207670_10314496 3300025936 Bacteria 1230
339 Ga0207670_10432231 3300025936 Bacteria 1058
340 Ga0207669_10018009 3300025937 Bacteria 3639
341 Ga0207669_10363890 3300025937 Bacteria 1122
342 Ga0207669_10444647 3300025937 Bacteria 1026
343 Ga0207669_10453019 3300025937 Bacteria 1017
344 Ga0207704_10002134 3300025938 Bacteria 8868
345 Ga0207704_10095440 3300025938 Bacteria 1966
346 Ga0207665_10003164 3300025939 Bacteria 11030
347 Ga0207665_10445873 3300025939 Bacteria 992
348 Ga0207691_10001920 3300025940 Bacteria 20290
349 Ga0207691_10013771 3300025940 Bacteria 7727
350 Ga0207691_11237968 3300025940 Bacteria 618
351 Ga0207711_10058505 3300025941 Bacteria 3317
352 Ga0207711_10133683 3300025941 Bacteria 2226
353 Ga0207711_10729284 3300025941 Bacteria 924
354 Ga0207711_11499282 3300025941 Bacteria 617
355 Ga0207689_10000392 3300025942 Bacteria 41178
356 Ga0207689_10038275 3300025942 Bacteria 3973
357 Ga0207689_10899768 3300025942 Bacteria 747
358 Ga0207661_10064724 3300025944 Bacteria 2965
359 Ga0207651_10041905 3300025960 Bacteria 3043
360 Ga0207651_10161493 3300025960 Bacteria 1757
361 Ga0207651_10233342 3300025960 Bacteria 1495
362 Ga0207712_10191638 3300025961 Bacteria 1614
363 Ga0207712_10748895 3300025961 Bacteria 856
364 Ga0207712_11122860 3300025961 Bacteria 700
365 Ga0207668_10002689 3300025972 Bacteria 10401
366 Ga0207668_10005462 3300025972 Bacteria 7485
367 Ga0207668_10012427 3300025972 Bacteria 5213
368 Ga0207668_10016405 3300025972 Bacteria 4622
369 Ga0207668_10833582 3300025972 Bacteria 818
370 Ga0207658_10224112 3300025986 Bacteria 1583
371 Ga0207658_10255050 3300025986 Bacteria 1492
372 Ga0207658_10278126 3300025986 Bacteria 1434
373 Ga0207658_10498111 3300025986 Bacteria 1085
374 Ga0207658_11011948 3300025986 Bacteria 758
375 Ga0207677_10064801 3300026023 Bacteria 2547
376 Ga0207677_10573063 3300026023 Bacteria 987
377 Ga0207677_10661095 3300026023 Bacteria 923
378 Ga0207677_10696921 3300026023 Bacteria 901
379 Ga0207677_11197814 3300026023 Bacteria 695
380 Ga0207703_10128258 3300026035 Bacteria 2187
381 Ga0207703_11159736 3300026035 Bacteria 743
382 Ga0207703_11293548 3300026035 Bacteria 701
383 Ga0207639_11298455 3300026041 Bacteria 683
384 Ga0207639_11484144 3300026041 Bacteria 636
385 Ga0207678_10092790 3300026067 Bacteria 2580
386 Ga0207678_10476565 3300026067 Bacteria 1086
387 Ga0207708_10001533 3300026075 Bacteria 17206
388 Ga0207708_10013944 3300026075 Bacteria 6005
389 Ga0207708_11362065 3300026075 Bacteria 622
390 Ga0207702_10086669 3300026078 Bacteria 2731
391 Ga0207641_10029346 3300026088 Bacteria 4548
392 Ga0207641_10106791 3300026088 Bacteria 2475
393 Ga0207641_10544049 3300026088 Bacteria 1132
394 Ga0207648_10004347 3300026089 Bacteria 14573
395 Ga0207648_10037431 3300026089 Bacteria 4273
396 Ga0207648_11508406 3300026089 Bacteria 632
397 Ga0207676_10193808 3300026095 Bacteria 1790
398 Ga0207676_10359457 3300026095 Bacteria 1349
399 Ga0207676_10544692 3300026095 Bacteria 1108
400 Ga0207676_10571759 3300026095 Bacteria 1082
401 Ga0207674_10131775 3300026116 Bacteria 2462
402 Ga0207675_100004969 3300026118 Bacteria 12815
403 Ga0207675_100008025 3300026118 Bacteria 9946
404 Ga0207675_100035902 3300026118 Bacteria 4623
405 Ga0207675_100324786 3300026118 Bacteria 1503
406 Ga0207675_101354107 3300026118 Bacteria 732
407 Ga0207683_10008023 3300026121 Bacteria 9029
408 Ga0207683_10058575 3300026121 Bacteria 3382
409 Ga0207683_10070522 3300026121 Bacteria 3088
410 Ga0207683_11325370 3300026121 Bacteria 666
411 Ga0207683_11560215 3300026121 Bacteria 609
412 Ga0209967_1006119 3300027364 Bacteria 1628
413 Ga0209995_1058798 3300027471 Bacteria 654
414 Ga0209179_1001767 3300027512 Bacteria 2753
415 Ga0209983_1126688 3300027665 Bacteria 583
416 Ga0209588_1029936 3300027671 Bacteria 1738
417 Ga0209588_1205970 3300027671 Bacteria 612
418 Ga0209588_1279794 3300027671 Bacteria 505
419 Ga0209966_1001170 3300027695 Bacteria 4683
420 Ga0209974_10069829 3300027876 Bacteria 1197
421 Ga0207428_10126266 3300027907 Bacteria 1959
422 Ga0268266_12092659 3300028379 Bacteria 539
423 Ga0268265_10088679 3300028380 Bacteria 2465
424 Ga0268265_10097607 3300028380 Bacteria 2364
425 Ga0268265_10174139 3300028380 Bacteria 1842
426 Ga0268265_10308847 3300028380 Bacteria 1427
427 Ga0268265_10460658 3300028380 Bacteria 1190
428 Ga0268265_10558911 3300028380 Bacteria 1087
429 Ga0268265_11005521 3300028380 Bacteria 824
430 Ga0268265_11867817 3300028380 Bacteria 607
431 Ga0268265_12442216 3300028380 Bacteria 529
432 Ga0268264_10118966 3300028381 Bacteria 2326
433 Ga0268264_12238142 3300028381 Bacteria 554
434 Ga0373958_0029501 3300034819 Bacteria 1068
435 Ga0373928_0077731 3300035084 Bacteria 832
436 Ga0373934_0000124 3300035086 Bacteria 28118
437 Ga0373952_0034302 3300035092 Bacteria 1143
438 Ga0373932_0396647 3300035112 Bacteria 533
439 Ga0373936_0133914 3300035113 Bacteria 1067
440 Ga0373939_0039681 3300035114 Bacteria 1410
441 Ga0373954_0000540 3300035118 Bacteria 14148
442 Ga0373956_0000881 3300035119 Bacteria 12445
443 Ga0373957_0092171 3300035120 Bacteria 1205
444 Ga0373955_0169556 3300035172 Bacteria 1291
445 Ga0373961_0006402 3300035241 Bacteria 2827
446 Ga0373931_0039947 3300035691 Bacteria 2459
447 Ga0373931_0210242 3300035691 Bacteria 1166
448 Ga0373931_0462684 3300035691 Bacteria 813
449 Ga0373935_0426801 3300035692 Bacteria 955
450 Ga0373935_1026788 3300035692 Bacteria 613
451 Ga0373933_0000729 3300035724 Bacteria 20193
452 Ga0373937_0000371 3300036401 Bacteria 41765
453 Ga0373937_0047556 3300036401 Bacteria 3926
454 Ga0373937_0167621 3300036401 Bacteria 2060
455 Ga0451793_1224646 3300041452 Bacteria 1084
456 Ga0439441_121079 3300042001 Bacteria 600
457 Ga0451577_0157683 3300042876 Bacteria 2043
458 Ga0451577_0519096 3300042876 Bacteria 1082
459 Ga0453683_0555870 3300044673 Bacteria 747
460 Ga0451576_0659311 3300045051 Bacteria 1100
461 Ga0451576_1675006 3300045051 Bacteria 659
462 Ga0451576_1677641 3300045051 Bacteria 658
463 Ga0495592_0440355 3300046454 Bacteria 818
464 Ga0495651_0001610 3300046462 Bacteria 17485
465 Ga0495630_0027719 3300046517 Bacteria 4206
466 Ga0495667_0007612 3300046559 Bacteria 7348
467 Ga0495667_0514381 3300046559 Unclassified 749
468 Ga0495657_0046305 3300046675 Bacteria 2946
469 Ga0495599_0390036 3300046678 Bacteria 830
470 Ga0495623_0275611 3300046679 Bacteria 938
471 Ga0495636_0032100 3300047318 Bacteria 2153
472 Ga0495636_0136571 3300047318 Bacteria 1093
473 Ga0495675_0086122 3300047444 Bacteria 1975
474 Ga0496108_0208542 3300048911 Bacteria 1696
475 Ga0496108_0251407 3300048911 Bacteria 1538
476 Ga0496109_0571154 3300048912 Bacteria 1066
477 Ga0496109_2076214 3300048912 Bacteria 500
478 Ga0496110_1784376 3300048913 Bacteria 525
479 Ga0496113_0798361 3300048916 Bacteria 750
480 Ga0501039_0158848 3300049575 Bacteria 1776
481 Ga0501039_0968538 3300049575 Bacteria 661
482 Ga0501048_1337040 3300049582 Bacteria 515
483 Ga0501068_0290241 3300049584 Bacteria 1046
484 Ga0501072_0106529 3300049588 Bacteria 2230
485 Ga0501252_004981 3300049682 Bacteria 1431
486 Ga0501080_0322277 3300049742 Bacteria 1399
487 Ga0501081_1052835 3300049743 Bacteria 615
488 Ga0501241_146916 3300049758 Bacteria 541
489 nmdc:mga0qj67_1020558_c1 3300050509 Bacteria 648
490 nmdc:mga08y16_29646_c1 3300050511 Bacteria 5762
491 nmdc:mga0n895_1782841_c1 3300050512 Bacteria 576
492 nmdc:mga0n895_225201_c1 3300050512 Bacteria 1903
493 nmdc:mga0n895_315519_c1 3300050512 Bacteria 1584
494 nmdc:mga0n895_838017_c1 3300050512 Bacteria 908
495 nmdc:mga0n895_89742_c1 3300050512 Bacteria 3075
496 nmdc:mga0rr50_1288570_c1 3300050513 Bacteria 620
497 nmdc:mga0rr50_472359_c1 3300050513 Bacteria 1065
498 nmdc:mga0rr50_541509_c1 3300050513 Unclassified 991
499 nmdc:mga0rr50_77938_c1 3300050513 Bacteria 2548
500 nmdc:mga0rr50_94850_c1 3300050513 Bacteria 2331
501 nmdc:mga08x19_1027231_c1 3300050514 Unclassified 585
502 nmdc:mga08x19_1059526_c1 3300050514 Bacteria 576
503 nmdc:mga08x19_298502_c1 3300050514 Bacteria 1119
504 nmdc:mga08x19_419452_c2 3300050514 Bacteria 631
505 nmdc:mga08x19_90786_c1 3300050514 Bacteria 2016
506 nmdc:mga0a205_13415_c1 3300050515 Bacteria 7629
507 2891636553 2891633521 Bacteria 4602265
508 Ga0207646_11178000
509 Ga0058859_11577090
510 Ga0058860_11818238
511 Ga0065707_10148719
512 Ga0065707_10369601
513 Ga0070676_10287450
514 Ga0070676_10451699
515 Ga0070676_11302143
516 Ga0070690_100001319
517 Ga0070690_100013972
518 Ga0070690_100105547
519 Ga0070690_101671710
520 Ga0070670_100000272
521 Ga0070670_100211296
522 Ga0070670_100304903
523 Ga0070670_100930627
524 Ga0070670_101335165
525 Ga0070677_10045241
526 Ga0070677_10420166
527 Ga0070677_10730904
528 Ga0068869_100007766
529 Ga0068869_101305472
530 Ga0070666_10871395
531 Ga0070680_101097516
532 Ga0070682_100091494
533 Ga0070682_100386625
534 Ga0068868_100056807
535 Ga0068868_100266914
536 Ga0068868_100635511
537 Ga0068868_101059209
538 Ga0068868_101294074
539 Ga0070689_100017280
540 Ga0070689_100169622
541 Ga0070689_100969677
542 Ga0070687_100162082
543 Ga0070687_100186284
544 Ga0070687_100398064
545 Ga0070687_101268707
546 Ga0070661_100829609
547 Ga0070661_101151684
548 Ga0070692_10015130
549 Ga0070692_10689340
550 Ga0070692_11096295
551 Ga0070668_100000766
552 Ga0070668_100031818
553 Ga0070668_100070906
554 Ga0070668_100432208
555 Ga0070669_100042477
556 Ga0070669_100065051
557 Ga0070669_100116391
558 Ga0070669_100291641
559 Ga0070669_100776614
560 Ga0070675_100007316
561 Ga0070675_100035721
562 Ga0070675_100510089
563 Ga0070675_101076748
564 Ga0070671_100530968
565 Ga0070674_100018094
566 Ga0070674_100098692
567 Ga0070674_100698405
568 Ga0070674_101587074
569 Ga0070674_102229173
570 Ga0070673_100061162
571 Ga0070673_100126863
572 Ga0070673_100212204
573 Ga0070673_101009949
574 Ga0070688_100108168
575 Ga0070667_100012875
576 Ga0070667_100061329
577 Ga0070667_100692630
578 Ga0070667_100820016
579 Ga0070667_101062731
580 Ga0070709_10461904
581 Ga0070713_100356619
582 Ga0070701_10001159
583 Ga0070701_10241412
584 Ga0070701_10386882
585 Ga0070705_100010452
586 Ga0070705_100039388
587 Ga0070705_100041780
588 Ga0070705_100345003
589 Ga0070705_100373693
590 Ga0070705_100747408
591 Ga0070705_100788815
592 Ga0070700_100001212
593 Ga0070700_100064067
594 Ga0070700_100339551
595 Ga0070700_100628026
596 Ga0070694_100015191
597 Ga0070694_100128513
598 Ga0070694_100145307
599 Ga0070694_100360949
600 Ga0070694_100477833
601 Ga0070694_100598107
602 Ga0070694_101052794
603 Ga0070708_102082517
604 Ga0070663_100241147
605 Ga0070678_100064794
606 Ga0070678_100170263
607 Ga0070678_100273367
608 Ga0070678_100945719
609 Ga0070678_101206053
610 Ga0070678_101513321
611 Ga0070662_100081780
612 Ga0070662_100204856
613 Ga0070681_10042789
614 Ga0068867_100010078
615 Ga0068867_100168576
616 Ga0068867_101024033
617 Ga0068867_101940111
618 Ga0070685_10095647
619 Ga0070685_10120506
620 Ga0070706_100288342
621 Ga0070706_100971124
622 Ga0070707_100051776
623 Ga0070707_100298949
624 Ga0070707_100665283
625 Ga0070707_100911410
626 Ga0070698_100012646
627 Ga0070698_100299561
628 Ga0070699_100103007
629 Ga0070699_101878766
630 Ga0070699_102154283
631 Ga0070679_100171893
632 Ga0070684_100275419
633 Ga0070684_100944000
634 Ga0070697_100054080
635 Ga0070697_100127783
636 Ga0070697_101091857
637 Ga0070672_100005594
638 Ga0070672_100109500
639 Ga0070672_100908422
640 Ga0070686_100000828
641 Ga0070686_100004165
642 Ga0070686_100974144
643 Ga0070695_100038330
644 Ga0070695_100058933
645 Ga0070695_100125599
646 Ga0070695_101282529
647 Ga0070696_100069113
648 Ga0070696_100189107
649 Ga0070696_100375202
650 Ga0070696_100738485
651 Ga0070696_101585431
652 Ga0070693_100262232
653 Ga0070693_100290247
654 Ga0070693_100625621
655 Ga0070704_100001933
656 Ga0070704_100023485
657 Ga0070704_100062858
658 Ga0070704_100070470
659 Ga0070704_101150004
660 Ga0068855_102309846
661 Ga0070664_102248138
662 Ga0068857_100056137
663 Ga0068856_100049208
664 Ga0070702_100017999
665 Ga0070702_100575398
666 Ga0070702_100715285
667 Ga0070702_101133027
668 Ga0068859_100014737
669 Ga0068859_100016670
670 Ga0068859_100110809
671 Ga0068859_100321994
672 Ga0068859_101031863
673 Ga0068864_100010368
674 Ga0068864_100039584
675 Ga0068864_100248407
676 Ga0068864_100441756
677 Ga0068864_100878840
678 Ga0068866_10529102
679 Ga0068866_10848469
680 Ga0068861_100307965
681 Ga0068861_100321132
682 Ga0068861_100369217
683 Ga0068861_100409797
684 Ga0068861_100589092
685 Ga0068870_10060333
686 Ga0068870_10198713
687 Ga0068863_100003169
688 Ga0068863_100359522
689 Ga0068863_100899225
690 Ga0068863_101784171
691 Ga0068858_100057527
692 Ga0068858_100357253
693 Ga0068858_102299512
694 Ga0068860_100102971
695 Ga0068862_100015035
696 Ga0068862_100015774
697 Ga0068862_100035482
698 Ga0068862_100167388
699 Ga0068862_100212860
700 Ga0068862_101175472
701 Ga0068862_102216807
702 Ga0070715_11045123
703 Ga0070716_100002410
704 Ga0070716_100434212
705 Ga0075366_10026036
706 Ga0097621_100000358
707 Ga0097621_100031370
708 Ga0097621_100558032
709 Ga0097621_100649488
710 Ga0097621_101886488
711 Ga0068871_100006646
712 Ga0068871_100064449
713 Ga0068871_100341706
714 Ga0068871_100841881
715 Ga0075428_100366690
716 Ga0075428_100582966
717 Ga0075430_101612294
718 Ga0075433_10014945
719 Ga0075434_100157040
720 Ga0075434_100161383
721 Ga0075434_101124035
722 Ga0068865_100001028
723 Ga0068865_100097031
724 Ga0068865_100808380
725 Ga0075436_100008614
726 Ga0075436_100061335
727 Ga0075436_100364084
728 Ga0075436_100816351
729 Ga0097620_100014737
730 Ga0097620_100016670
731 Ga0097620_100110819
732 Ga0097620_100321967
733 Ga0097620_101031872
734 Ga0075435_100077874
735 Ga0075435_100118692
736 Ga0075435_100523425
737 Ga0099794_10006405
738 Ga0099794_10044607
739 Ga0099794_10081301
740 Ga0099794_10216010
741 Ga0099795_10008354
742 Ga0111539_10117580
743 Ga0111539_10153306
744 Ga0105245_10004069
745 Ga0105245_10775440
746 Ga0105245_10988560
747 Ga0105245_13111571
748 Ga0114129_10689841
749 Ga0114129_11383238
750 Ga0105243_10001855
751 Ga0105243_10030684
752 Ga0105243_10629791
753 Ga0105243_11014778
754 Ga0105243_11630416
755 Ga0105242_10067888
756 Ga0105242_10363336
757 Ga0105248_10328026
758 Ga0105248_10364259
759 Ga0105248_11231138
760 Ga0105238_10487571
761 Ga0105249_10090770
762 Ga0105249_12715061
763 Ga0105249_13472432
764 Ga0157374_10374510
765 Ga0157378_10002331
766 Ga0157378_10172345
767 Ga0163162_10092350
768 Ga0163162_10140581
769 Ga0163162_10739504
770 Ga0163162_10752280
771 Ga0163162_11246063
772 Ga0163162_11578500
773 Ga0163162_11652126
774 Ga0163162_12447529
775 Ga0157375_10027244
776 Ga0157375_10128382
777 Ga0157375_10330023
778 Ga0157375_11017507
779 Ga0157375_11388342
780 Ga0157375_13252355
781 Ga0157375_13807826
782 Ga0163163_10002859
783 Ga0163163_11438881
784 Ga0157380_10002730
785 Ga0157380_10014276
786 Ga0157380_10111859
787 Ga0157380_11483607
788 Ga0157380_12879785
789 Ga0157377_10437046
790 Ga0157379_10065814
791 Ga0157379_10177974
792 Ga0157376_10164898
793 Ga0157376_10484940
794 Ga0157376_11951085
795 Ga0163161_10074329
796 Ga0163161_10119045
797 Ga0209129_1015816
798 Ga0209758_1000078
799 Ga0207697_10273495
800 Ga0207653_10102585
801 Ga0207682_10235360
802 Ga0207682_10512009
803 Ga0207692_10808352
804 Ga0207642_10499423
805 Ga0207680_11180477
806 Ga0207685_10273177
807 Ga0207645_10419975
808 Ga0207645_10907847
809 Ga0207643_10009467
810 Ga0207643_10111616
811 Ga0207707_10273009
812 Ga0207660_11659710
813 Ga0207662_10306678
814 Ga0207662_10371226
815 Ga0207662_10422008
816 Ga0207646_10435654
817 Ga0207646_11475954
818 Ga0207681_10065449
819 Ga0207681_10238207
820 Ga0207681_10411226
821 Ga0207681_10623922
822 Ga0207681_10842336
823 Ga0207681_10988449
824 Ga0207694_11235771
825 Ga0207650_10002956
826 Ga0207650_10025833
827 Ga0207650_10092583
828 Ga0207650_10283900
829 Ga0207650_11310287
830 Ga0207659_10027298
831 Ga0207659_10380182
832 Ga0207659_10762795
833 Ga0207687_10060801
834 Ga0207687_10568226
835 Ga0207644_10090157
836 Ga0207706_10011408
837 Ga0207706_11054651
838 Ga0207686_10002060
839 Ga0207686_11054584
840 Ga0207709_10002015
841 Ga0207709_10471581
842 Ga0207709_11191601
843 Ga0207709_11527098
844 Ga0207670_10016949
845 Ga0207670_10314496
846 Ga0207670_10432231
847 Ga0207669_10018009
848 Ga0207669_10363890
849 Ga0207669_10444647
850 Ga0207669_10453019
851 Ga0207704_10002134
852 Ga0207704_10095440
853 Ga0207665_10003164
854 Ga0207665_10445873
855 Ga0207691_10001920
856 Ga0207691_10013771
857 Ga0207691_11237968
858 Ga0207711_10058505
859 Ga0207711_10133683
860 Ga0207711_10729284
861 Ga0207711_11499282
862 Ga0207689_10000392
863 Ga0207689_10038275
864 Ga0207689_10899768
865 Ga0207661_10064724
866 Ga0207651_10041905
867 Ga0207651_10161493
868 Ga0207651_10233342
869 Ga0207712_10191638
870 Ga0207712_10748895
871 Ga0207712_11122860
872 Ga0207668_10002689
873 Ga0207668_10005462
874 Ga0207668_10012427
875 Ga0207668_10016405
876 Ga0207668_10833582
877 Ga0207658_10224112
878 Ga0207658_10255050
879 Ga0207658_10278126
880 Ga0207658_10498111
881 Ga0207658_11011948
882 Ga0207677_10064801
883 Ga0207677_10573063
884 Ga0207677_10661095
885 Ga0207677_10696921
886 Ga0207677_11197814
887 Ga0207703_10128258
888 Ga0207703_11159736
889 Ga0207703_11293548
890 Ga0207639_11298455
891 Ga0207639_11484144
892 Ga0207678_10092790
893 Ga0207678_10476565
894 Ga0207708_10001533
895 Ga0207708_10013944
896 Ga0207708_11362065
897 Ga0207702_10086669
898 Ga0207641_10029346
899 Ga0207641_10106791
900 Ga0207641_10544049
901 Ga0207648_10004347
902 Ga0207648_10037431
903 Ga0207648_11508406
904 Ga0207676_10193808
905 Ga0207676_10359457
906 Ga0207676_10544692
907 Ga0207676_10571759
908 Ga0207674_10131775
909 Ga0207675_100004969
910 Ga0207675_100008025
911 Ga0207675_100035902
912 Ga0207675_100324786
913 Ga0207675_101354107
914 Ga0207683_10008023
915 Ga0207683_10058575
916 Ga0207683_10070522
917 Ga0207683_11325370
918 Ga0207683_11560215
919 Ga0209967_1006119
920 Ga0209995_1058798
921 Ga0209179_1001767
922 Ga0209983_1126688
923 Ga0209588_1029936
924 Ga0209588_1205970
925 Ga0209588_1279794
926 Ga0209966_1001170
927 Ga0209974_10069829
928 Ga0207428_10126266
929 Ga0268266_12092659
930 Ga0268265_10088679
931 Ga0268265_10097607
932 Ga0268265_10174139
933 Ga0268265_10308847
934 Ga0268265_10460658
935 Ga0268265_10558911
936 Ga0268265_11005521
937 Ga0268265_11867817
938 Ga0268265_12442216
939 Ga0268264_10118966
940 Ga0268264_12238142
941 Ga0373958_0029501
942 Ga0373928_0077731
943 Ga0373934_0000124
944 Ga0373952_0034302
945 Ga0373932_0396647
946 Ga0373936_0133914
947 Ga0373939_0039681
948 Ga0373954_0000540
949 Ga0373956_0000881
950 Ga0373957_0092171
951 Ga0373955_0169556
952 Ga0373961_0006402
953 Ga0373931_0039947
954 Ga0373931_0210242
955 Ga0373931_0462684
956 Ga0373935_0426801
957 Ga0373935_1026788
958 Ga0373933_0000729
959 Ga0373937_0000371
960 Ga0373937_0047556
961 Ga0373937_0167621
962 Ga0451793_1224646
963 Ga0439441_121079
964 Ga0451577_0157683
965 Ga0451577_0519096
966 Ga0453683_0555870
967 Ga0451576_0659311
968 Ga0451576_1675006
969 Ga0451576_1677641
970 Ga0495592_0440355
971 Ga0495651_0001610
972 Ga0495630_0027719
973 Ga0495667_0007612
974 Ga0495667_0514381
975 Ga0495657_0046305
976 Ga0495599_0390036
977 Ga0495623_0275611
978 Ga0495636_0032100
979 Ga0495636_0136571
980 Ga0495675_0086122
981 Ga0496108_0208542
982 Ga0496108_0251407
983 Ga0496109_0571154
984 Ga0496109_2076214
985 Ga0496110_1784376
986 Ga0496113_0798361
987 Ga0501039_0158848
988 Ga0501039_0968538
989 Ga0501048_1337040
990 Ga0501068_0290241
991 Ga0501072_0106529
992 Ga0501252_004981
993 Ga0501080_0322277
994 Ga0501081_1052835
995 Ga0501241_146916
996 nmdc:mga0qj67_1020558_c1
997 nmdc:mga08y16_29646_c1
998 nmdc:mga0n895_1782841_c1
999 nmdc:mga0n895_225201_c1
1000 nmdc:mga0n895_315519_c1
1001 nmdc:mga0n895_838017_c1
1002 nmdc:mga0n895_89742_c1
1003 nmdc:mga0rr50_1288570_c1
1004 nmdc:mga0rr50_472359_c1
1005 nmdc:mga0rr50_541509_c1
1006 nmdc:mga0rr50_77938_c1
1007 nmdc:mga0rr50_94850_c1
1008 nmdc:mga08x19_1027231_c1
1009 nmdc:mga08x19_1059526_c1
1010 nmdc:mga08x19_298502_c1
1011 nmdc:mga08x19_419452_c2
1012 nmdc:mga08x19_90786_c1
1013 nmdc:mga0a205_13415_c1
1014 2891636553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rkl-assembly2.cif.gz_D crystal structure of s.cerevisiae vta1 c-terminal domain 0.9843 44 81
2oo2-assembly1.cif.gz_A-2 crystal structure of protein af1782 from archaeoglobus fulgidus, pfam duf357 0.8811 17 81
4fzp-assembly1.cif.gz_B crystal structure of the uranyl binding protein complexed with uranyl 0.875 25 81
2rkl-assembly2.cif.gz_D crystal structure of s.cerevisiae vta1 c-terminal domain 0.8731 44 81
2pmr-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function from methanobacterium thermoautotrophicum 0.8243 22 81
ID Description Score Start End Superfamily
2rklD00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9843 44 81 1.20.5.420
2rklC00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9709 44 81 1.20.5.420
af_Q8VBW8_25_166_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9409 41 81 1.25.40.10
af_I1KZB5_142_248_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9111 41 79 1.25.40.10
2oo2A00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;AF1782-like 0.8811 17 81 1.20.1270.90
ID Description Score Start End GO Terms
AF-A0A537BBM2-F1-model_v4 Uncharacterized protein 1.01 24 83
AF-A0A2V7DIK1-F1-model_v4 Uncharacterized protein 0.9961 20 82
AF-M3U6Q1-F1-model_v4 Uncharacterized protein 0.9943 24 81
AF-A0A1G8S3X2-F1-model_v4 Tetratricopeptide repeat-containing protein 0.991 20 82
AF-W7W000-F1-model_v4 Uncharacterized protein 0.9901 22 82

Map