F456722

General Info

Members Datasets Scaffolds Average Seq Length
507 231 1014 333

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_019804|Ga0495617_019804_1188_2252
Length 354
Sequence MNIPSPGAHCCCSSCNTKKKIDMDLHSYLARRPPDYANTTALGSCLRAMVEAGHDRLPLPGSGRTLERFQHLADVGGHDLGLCKLFEGHTDALAIIEQLGGSPTPGSTWGMWAAEPPQARVKVSAAGHMVALHGRKAWCSGAAVLSHALLTAWDADDQQQLVAVALDQPGVTITDQGWQAVGMAATGSVEVVFEGAEAQAIGNPGDYLQRPGFWQGGIGIAACWYGAARQLGESLRQHCARREEAHALAHLGAVDTALQAGADVLRFSALHIDAHPEDDAELLARRARAVVEQSAEQVMREVGRALGAGPFCKDRHFARLIADLPVFLRQSHAERDLAALGQLITAQSDEVWTL

Samples

Sample ID Description Type Environment
1 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
60 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
69 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
70 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
73 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
74 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
75 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
76 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
77 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
78 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
79 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
80 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
81 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
85 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
162 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
163 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
164 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
165 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
166 2511231008 Pseudomonas sp. GM21 Isolate Nodule
167 2511231010 Pseudomonas sp. GM25 Isolate Nodule
168 2511231011 Pseudomonas sp. GM30 Isolate Nodule
169 2511231023 Pseudomonas sp. GM80 Isolate Nodule
170 2511231031 Pseudomonas sp. GM16 Isolate Nodule
171 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
172 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
173 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
174 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
175 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
176 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
177 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
178 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
179 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
180 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
181 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
182 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
183 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
184 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
185 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
186 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
187 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
188 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
189 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
190 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
191 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
192 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
193 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
194 2773857673 Pseudomonas sp. 443 Isolate Unclassified
195 2784132063 Pseudomonas sp. 424 Isolate Unclassified
196 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
197 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
198 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
199 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
200 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
201 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
202 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
203 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
204 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
205 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
206 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
207 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
208 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
209 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
210 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
211 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
212 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
213 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
214 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
215 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
216 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
217 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
218 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
219 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
220 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
221 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
222 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
223 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
224 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
225 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
226 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
227 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
228 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
229 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
230 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
231 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.79
Metatranscriptomes 0.2
Isolates 13.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.13
Nodule 0.99
Rhizoplane 4.54
Rhizosphere 78.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495617_019804 3300046452 Bacteria 2274
2 JGI25162J39368_1000004 3300002737 Bacteria 441040
3 JGI25163J39215_1000244 3300002771 Bacteria 19990
4 JGI25164J39214_1000026 3300002772 Bacteria 156863
5 JGI25165J46597_1000011 3300003214 Bacteria 441040
6 Ga0055536_1000047 3300003781 Bacteria 117289
7 Ga0055536_1000066 3300003781 Bacteria 97166
8 Ga0055530_10000321 3300003791 Bacteria 43445
9 Ga0055530_10003565 3300003791 Bacteria 8752
10 Ga0055540_1000006 3300003792 Bacteria 372018
11 Ga0055531_10000099 3300003794 Bacteria 93823
12 Ga0065714_10004642 3300005288 Bacteria 4645
13 Ga0065714_10066122 3300005288 Bacteria 7566
14 Ga0065714_10098565 3300005288 Bacteria 1683
15 Ga0070681_10010839 3300005458 Bacteria 9009
16 Ga0070679_100059767 3300005530 Bacteria 3799
17 Ga0068853_100036347 3300005539 Bacteria 4187
18 Ga0070704_100144823 3300005549 Bacteria 1860
19 Ga0068855_100046297 3300005563 Bacteria 5143
20 Ga0068856_100317869 3300005614 Bacteria 1574
21 Ga0105251_10020423 3300009011 Bacteria 3481
22 Ga0105251_10022355 3300009011 Bacteria 3284
23 Ga0105251_10022389 3300009011 Bacteria 3281
24 Ga0105244_10001051 3300009036 Bacteria 23124
25 Ga0105244_10001644 3300009036 Bacteria 17691
26 Ga0105244_10005786 3300009036 Bacteria 8140
27 Ga0105244_10009647 3300009036 Bacteria 5914
28 Ga0105250_10010189 3300009092 Bacteria 3922
29 Ga0105250_10011019 3300009092 Bacteria 3758
30 Ga0105250_10016123 3300009092 Bacteria 3050
31 Ga0105243_10000026 3300009148 Bacteria 191522
32 Ga0105243_10005363 3300009148 Bacteria 10005
33 Ga0105243_10013596 3300009148 Bacteria 6156
34 Ga0105237_10287378 3300009545 Bacteria 1647
35 Ga0105239_10027260 3300010375 Bacteria 6289
36 Ga0105246_10001587 3300011119 Bacteria 13533
37 Ga0157345_1000015 3300012498 Bacteria 48949
38 Ga0157373_10000389 3300013100 Bacteria 35149
39 Ga0157373_10014192 3300013100 Bacteria 5843
40 Ga0157373_10022012 3300013100 Bacteria 4625
41 Ga0157373_10048051 3300013100 Bacteria 3043
42 Ga0157373_10197661 3300013100 Bacteria 1417
43 Ga0157371_10000142 3300013102 Bacteria 103825
44 Ga0157371_10000202 3300013102 Bacteria 87749
45 Ga0157371_10000453 3300013102 Bacteria 50312
46 Ga0157371_10003125 3300013102 Bacteria 15297
47 Ga0157370_10125670 3300013104 Bacteria 2393
48 Ga0157370_10341175 3300013104 Bacteria 1381
49 Ga0157369_10001032 3300013105 Bacteria 35169
50 Ga0157369_10005042 3300013105 Bacteria 15457
51 Ga0157369_10113361 3300013105 Bacteria 2880
52 Ga0163162_10000346 3300013306 Bacteria 42061
53 Ga0157372_10000552 3300013307 Bacteria 41170
54 Ga0157375_10630207 3300013308 Bacteria 1230
55 Ga0182008_10002080 3300014497 Bacteria 12804
56 Ga0182008_10003917 3300014497 Bacteria 8815
57 Ga0182008_10017935 3300014497 Bacteria 3668
58 Ga0182008_10023159 3300014497 Bacteria 3176
59 Ga0182006_1000459 3300015261 Bacteria 32081
60 Ga0182006_1003150 3300015261 Bacteria 8627
61 Ga0182006_1007624 3300015261 Bacteria 4945
62 Ga0182005_1002937 3300015265 Bacteria 5917
63 Ga0182005_1003950 3300015265 Bacteria 4893
64 Ga0182005_1006276 3300015265 Bacteria 3645
65 Ga0182005_1018080 3300015265 Bacteria 1949
66 Ga0182005_1038724 3300015265 Bacteria 1297
67 Ga0163161_10004310 3300017792 Bacteria 9911
68 Ga0163161_10084523 3300017792 Bacteria 2340
69 Ga0224712_10067769 3300022467 Bacteria 1441
70 Ga0209760_100083 3300025207 Bacteria 75839
71 Ga0209563_101958 3300025230 Bacteria 4968
72 Ga0207427_100003 3300025231 Bacteria 1035004
73 Ga0209437_100002 3300025233 Bacteria 1574801
74 Ga0209233_1000004 3300025261 Bacteria 1574798
75 Ga0209675_1014489 3300025291 Bacteria 2399
76 Ga0209676_1000002 3300025292 Bacteria 1732948
77 Ga0209676_1000158 3300025292 Bacteria 162469
78 Ga0209050_1000006 3300025298 Bacteria 1359702
79 Ga0209051_1000001 3300025303 Bacteria 1732974
80 Ga0209257_1000029 3300025304 Bacteria 695617
81 Ga0207696_1000002 3300025711 Bacteria 1098043
82 Ga0207696_1000724 3300025711 Bacteria 22166
83 Ga0207655_1000518 3300025728 Bacteria 49081
84 Ga0207655_1001944 3300025728 Bacteria 17675
85 Ga0207655_1004414 3300025728 Bacteria 9984
86 Ga0207655_1004921 3300025728 Bacteria 9267
87 Ga0207655_1007549 3300025728 Bacteria 7042
88 Ga0207713_1000275 3300025735 Bacteria 61536
89 Ga0207713_1003617 3300025735 Bacteria 10414
90 Ga0207713_1034353 3300025735 Bacteria 2204
91 Ga0207713_1091135 3300025735 Bacteria 1071
92 Ga0207707_10019461 3300025912 Bacteria 5927
93 Ga0207671_10227453 3300025914 Bacteria 1463
94 Ga0207652_10079096 3300025921 Bacteria 2872
95 Ga0207709_10000004 3300025935 Bacteria 825156
96 Ga0207709_10003305 3300025935 Bacteria 9670
97 Ga0207709_10067449 3300025935 Bacteria 2258
98 Ga0207639_10004894 3300026041 Bacteria 9021
99 Ga0207702_10456224 3300026078 Bacteria 1241
100 Ga0207674_10058636 3300026116 Bacteria 3899
101 Ga0209371_1000395 3300027312 Bacteria 46013
102 Ga0268256_1000838 3300030500 Bacteria 21832
103 Ga0316179_1008742 3300030734 Bacteria 2486
104 Ga0316178_1100526 3300030735 Bacteria 2686
105 Ga0307408_100009831 3300031548 Bacteria 6304
106 Ga0307408_100025296 3300031548 Bacteria 4065
107 Ga0307516_10148010 3300031730 Bacteria 2112
108 Ga0307516_10222261 3300031730 Bacteria 1597
109 Ga0307412_10014951 3300031911 Bacteria 4589
110 Ga0307412_10045726 3300031911 Bacteria 2864
111 Ga0307412_10054964 3300031911 Bacteria 2645
112 Ga0307409_100033856 3300031995 Bacteria 3724
113 Ga0307414_10020295 3300032004 Bacteria 4139
114 Ga0307411_10109721 3300032005 Bacteria 1971
115 Ga0307510_10018740 3300033180 Bacteria 8134
116 Ga0237819_04950 3300038705 Bacteria 2134
117 Ga0439438_000250 3300041405 Bacteria 23986
118 Ga0439438_001395 3300041405 Bacteria 10651
119 Ga0439438_001998 3300041405 Bacteria 8906
120 Ga0439447_001286 3300041407 Bacteria 9129
121 Ga0439447_021745 3300041407 Bacteria 1686
122 Ga0439466_0024297 3300041411 Bacteria 2125
123 Ga0439466_0055909 3300041411 Bacteria 1281
124 Ga0439445_0025610 3300042004 Bacteria 1505
125 Ga0439432_000867 3300042006 Bacteria 11322
126 Ga0439432_030940 3300042006 Bacteria 1733
127 Ga0439452_000087 3300042010 Bacteria 79439
128 Ga0439452_000111 3300042010 Bacteria 65396
129 Ga0439452_021305 3300042010 Bacteria 1690
130 Ga0439456_000552 3300042013 Bacteria 7869
131 Ga0450911_000513 3300042115 Bacteria 12271
132 Ga0450902_000869 3300042137 Bacteria 3935
133 Ga0450902_010037 3300042137 Bacteria 1496
134 Ga0450904_001836 3300042139 Bacteria 2760
135 Ga0450905_005426 3300042142 Bacteria 1713
136 Ga0450905_005607 3300042142 Bacteria 1685
137 Ga0450906_000499 3300042145 Bacteria 8253
138 Ga0439464_0002112 3300042439 Bacteria 4844
139 Ga0495617_002427 3300046452 Bacteria 7412
140 Ga0495617_011878 3300046452 Bacteria 2970
141 Ga0495617_015322 3300046452 Bacteria 2598
142 Ga0495617_043147 3300046452 Bacteria 1505
143 Ga0495617_044339 3300046452 Bacteria 1484
144 Ga0495627_000009 3300046453 Bacteria 463964
145 Ga0495627_000064 3300046453 Bacteria 132648
146 Ga0495627_000491 3300046453 Bacteria 33157
147 Ga0495627_002070 3300046453 Bacteria 10227
148 Ga0495627_002757 3300046453 Bacteria 8163
149 Ga0495627_020252 3300046453 Bacteria 2219
150 Ga0495592_0004976 3300046454 Bacteria 9779
151 Ga0495590_0005230 3300046457 Bacteria 5155
152 Ga0495590_0012425 3300046457 Bacteria 3159
153 Ga0495591_000155 3300046458 Bacteria 72717
154 Ga0495591_000667 3300046458 Bacteria 25312
155 Ga0495591_001178 3300046458 Bacteria 17098
156 Ga0495591_004360 3300046458 Bacteria 6968
157 Ga0495591_007120 3300046458 Bacteria 4813
158 Ga0495591_008113 3300046458 Bacteria 4340
159 Ga0495591_013466 3300046458 Bacteria 2990
160 Ga0495591_021968 3300046458 Bacteria 2071
161 Ga0495591_027515 3300046458 Bacteria 1752
162 Ga0495638_0000651 3300046460 Bacteria 38019
163 Ga0495638_0004108 3300046460 Bacteria 11137
164 Ga0495638_0040146 3300046460 Bacteria 2966
165 Ga0495638_0094368 3300046460 Bacteria 1798
166 Ga0495653_0004416 3300046463 Bacteria 11372
167 Ga0495653_0026013 3300046463 Bacteria 4696
168 Ga0495650_0005163 3300046471 Bacteria 8604
169 Ga0495650_0006606 3300046471 Bacteria 7200
170 Ga0495650_0011618 3300046471 Bacteria 4807
171 Ga0495650_0018420 3300046471 Bacteria 3470
172 Ga0495650_0038308 3300046471 Bacteria 2078
173 Ga0495605_0000080 3300046474 Bacteria 125370
174 Ga0495605_0000264 3300046474 Bacteria 60349
175 Ga0495605_0001607 3300046474 Bacteria 14642
176 Ga0495605_0008430 3300046474 Bacteria 5826
177 Ga0495605_0013929 3300046474 Bacteria 4417
178 Ga0495605_0032785 3300046474 Bacteria 2642
179 Ga0495584_0000669 3300046491 Bacteria 22772
180 Ga0495584_0001334 3300046491 Bacteria 14960
181 Ga0495584_0004207 3300046491 Bacteria 7764
182 Ga0495584_0005203 3300046491 Bacteria 6906
183 Ga0495585_0000274 3300046492 Bacteria 51562
184 Ga0495585_0001686 3300046492 Bacteria 16882
185 Ga0495585_0005606 3300046492 Bacteria 7885
186 Ga0495585_0010222 3300046492 Bacteria 5601
187 Ga0495585_0012800 3300046492 Bacteria 4934
188 Ga0495585_0036415 3300046492 Bacteria 2775
189 Ga0495585_0057938 3300046492 Bacteria 2137
190 Ga0495585_0063201 3300046492 Bacteria 2032
191 Ga0495596_0054329 3300046500 Bacteria 1567
192 Ga0495607_0000016 3300046501 Bacteria 177613
193 Ga0495607_0001934 3300046501 Bacteria 17490
194 Ga0495607_0006285 3300046501 Bacteria 8374
195 Ga0495607_0007520 3300046501 Bacteria 7525
196 Ga0495607_0018447 3300046501 Bacteria 4449
197 Ga0495607_0056269 3300046501 Bacteria 2259
198 Ga0495607_0061115 3300046501 Bacteria 2141
199 Ga0495607_0102017 3300046501 Bacteria 1535
200 Ga0495583_0000089 3300046506 Bacteria 163349
201 Ga0495583_0001359 3300046506 Bacteria 25301
202 Ga0495583_0012250 3300046506 Bacteria 4866
203 Ga0495583_0021330 3300046506 Bacteria 3337
204 Ga0495606_0002914 3300046507 Bacteria 18888
205 Ga0495606_0011164 3300046507 Bacteria 7353
206 Ga0495606_0011208 3300046507 Bacteria 7337
207 Ga0495606_0028556 3300046507 Bacteria 3932
208 Ga0495606_0041339 3300046507 Bacteria 3091
209 Ga0495606_0108649 3300046507 Bacteria 1676
210 Ga0495610_0006134 3300046512 Bacteria 8376
211 Ga0495610_0006481 3300046512 Bacteria 8048
212 Ga0495610_0008572 3300046512 Bacteria 6596
213 Ga0495610_0023891 3300046512 Bacteria 3311
214 Ga0495610_0024766 3300046512 Bacteria 3233
215 Ga0495610_0062134 3300046512 Bacteria 1772
216 Ga0495610_0067035 3300046512 Bacteria 1688
217 Ga0495616_0000104 3300046513 Bacteria 72819
218 Ga0495616_0003578 3300046513 Bacteria 9932
219 Ga0495616_0005316 3300046513 Bacteria 7938
220 Ga0495616_0005465 3300046513 Bacteria 7817
221 Ga0495616_0035508 3300046513 Bacteria 2579
222 Ga0495616_0075157 3300046513 Bacteria 1626
223 Ga0495620_0000805 3300046515 Bacteria 19286
224 Ga0495620_0002255 3300046515 Bacteria 11168
225 Ga0495620_0006369 3300046515 Bacteria 6490
226 Ga0495620_0043099 3300046515 Bacteria 1967
227 Ga0495620_0067998 3300046515 Bacteria 1464
228 Ga0495620_0079630 3300046515 Bacteria 1327
229 Ga0495628_0139735 3300046516 Bacteria 1849
230 Ga0495631_0000014 3300046518 Bacteria 109076
231 Ga0495631_0000519 3300046518 Bacteria 25886
232 Ga0495631_0001375 3300046518 Bacteria 14826
233 Ga0495631_0038604 3300046518 Bacteria 2122
234 Ga0495632_0000150 3300046519 Bacteria 72066
235 Ga0495632_0000219 3300046519 Bacteria 58093
236 Ga0495632_0004341 3300046519 Bacteria 9663
237 Ga0495632_0011398 3300046519 Bacteria 5188
238 Ga0495632_0013491 3300046519 Bacteria 4661
239 Ga0495632_0018323 3300046519 Bacteria 3844
240 Ga0495632_0021248 3300046519 Bacteria 3500
241 Ga0495632_0065648 3300046519 Bacteria 1753
242 Ga0495632_0099621 3300046519 Bacteria 1370
243 Ga0495637_0001145 3300046520 Bacteria 16245
244 Ga0495637_0004524 3300046520 Bacteria 7195
245 Ga0495637_0005618 3300046520 Bacteria 6368
246 Ga0495637_0008705 3300046520 Bacteria 4976
247 Ga0495637_0011460 3300046520 Bacteria 4261
248 Ga0495637_0011868 3300046520 Bacteria 4175
249 Ga0495637_0049879 3300046520 Bacteria 1757
250 Ga0495637_0068301 3300046520 Bacteria 1440
251 Ga0495643_0006381 3300046522 Bacteria 7785
252 Ga0495643_0006835 3300046522 Bacteria 7444
253 Ga0495643_0028795 3300046522 Bacteria 3111
254 Ga0495643_0055829 3300046522 Bacteria 2110
255 Ga0495644_0016769 3300046523 Bacteria 2802
256 Ga0495648_0002237 3300046524 Bacteria 18093
257 Ga0495648_0006508 3300046524 Bacteria 9520
258 Ga0495648_0010740 3300046524 Bacteria 6953
259 Ga0495648_0011145 3300046524 Bacteria 6796
260 Ga0495648_0015263 3300046524 Bacteria 5585
261 Ga0495648_0025800 3300046524 Bacteria 3969
262 Ga0495648_0030115 3300046524 Bacteria 3594
263 Ga0495666_0014243 3300046526 Bacteria 3962
264 Ga0495666_0018343 3300046526 Bacteria 3483
265 Ga0495652_0074029 3300046529 Bacteria 2834
266 Ga0495654_0000731 3300046530 Bacteria 25586
267 Ga0495654_0014388 3300046530 Bacteria 4210
268 Ga0495654_0090527 3300046530 Bacteria 1420
269 Ga0495587_0013443 3300046536 Bacteria 5144
270 Ga0495609_0000027 3300046538 Bacteria 234661
271 Ga0495609_0003968 3300046538 Bacteria 8278
272 Ga0495609_0004270 3300046538 Bacteria 7886
273 Ga0495609_0008334 3300046538 Bacteria 5080
274 Ga0495609_0060925 3300046538 Bacteria 1667
275 Ga0495609_0118741 3300046538 Bacteria 1138
276 Ga0495597_0000002 3300046542 Bacteria 420382
277 Ga0495597_0000166 3300046542 Bacteria 58474
278 Ga0495622_0000219 3300046557 Bacteria 45417
279 Ga0495633_0002262 3300046558 Bacteria 13777
280 Ga0495633_0027773 3300046558 Bacteria 2762
281 Ga0495633_0107149 3300046558 Bacteria 1296
282 Ga0495633_0116970 3300046558 Bacteria 1235
283 Ga0495668_0006387 3300046616 Bacteria 7725
284 Ga0495668_0030202 3300046616 Bacteria 3061
285 Ga0495634_0001919 3300046642 Bacteria 17793
286 Ga0495634_0034357 3300046642 Bacteria 3480
287 Ga0495611_0000012 3300046648 Bacteria 131579
288 Ga0495611_0016124 3300046648 Bacteria 3194
289 Ga0495611_0020350 3300046648 Bacteria 2855
290 Ga0495625_0000383 3300046660 Bacteria 67584
291 Ga0495625_0003858 3300046660 Bacteria 14487
292 Ga0495625_0019866 3300046660 Bacteria 5198
293 Ga0495625_0026397 3300046660 Bacteria 4389
294 Ga0495625_0044356 3300046660 Bacteria 3219
295 Ga0495625_0101134 3300046660 Bacteria 1980
296 Ga0495625_0126379 3300046660 Bacteria 1735
297 Ga0495635_0004543 3300046663 Bacteria 9617
298 Ga0495661_0000141 3300046665 Bacteria 84404
299 Ga0495661_0016937 3300046665 Bacteria 4816
300 Ga0495661_0031783 3300046665 Bacteria 3343
301 Ga0495661_0035966 3300046665 Bacteria 3104
302 Ga0495661_0054929 3300046665 Bacteria 2389
303 Ga0495661_0083130 3300046665 Bacteria 1841
304 Ga0495588_0175411 3300046674 Bacteria 1133
305 Ga0495623_0005312 3300046679 Bacteria 8436
306 Ga0495646_0002158 3300046680 Bacteria 11968
307 Ga0495646_0030938 3300046680 Bacteria 3339
308 Ga0495613_0025671 3300046689 Bacteria 4390
309 Ga0495613_0032233 3300046689 Bacteria 3891
310 Ga0495613_0088923 3300046689 Bacteria 2238
311 Ga0495624_0000016 3300046690 Bacteria 106958
312 Ga0495624_0044704 3300046690 Bacteria 2823
313 Ga0495670_0000489 3300046691 Bacteria 18754
314 Ga0495671_0003504 3300046692 Bacteria 9623
315 Ga0495671_0004786 3300046692 Bacteria 8001
316 Ga0495671_0010897 3300046692 Bacteria 5022
317 Ga0495671_0023352 3300046692 Bacteria 3230
318 Ga0495671_0057522 3300046692 Bacteria 1924
319 Ga0495671_0071242 3300046692 Bacteria 1707
320 Ga0495649_0002572 3300046694 Bacteria 12702
321 Ga0495649_0005706 3300046694 Bacteria 7854
322 Ga0495649_0022011 3300046694 Bacteria 3569
323 Ga0495649_0051590 3300046694 Bacteria 2230
324 Ga0495649_0101664 3300046694 Bacteria 1527
325 Ga0495589_0000975 3300046794 Bacteria 17423
326 Ga0495589_0005386 3300046794 Bacteria 6752
327 Ga0495600_0017209 3300046809 Bacteria 4594
328 Ga0495660_0000106 3300046810 Bacteria 89437
329 Ga0495660_0000589 3300046810 Bacteria 28836
330 Ga0495660_0002334 3300046810 Bacteria 12152
331 Ga0495660_0003630 3300046810 Bacteria 9498
332 Ga0495660_0003689 3300046810 Bacteria 9417
333 Ga0495660_0004401 3300046810 Bacteria 8532
334 Ga0495660_0015318 3300046810 Bacteria 4430
335 Ga0495660_0016348 3300046810 Bacteria 4279
336 Ga0495660_0043971 3300046810 Bacteria 2459
337 Ga0495660_0047560 3300046810 Bacteria 2348
338 Ga0495660_0049654 3300046810 Bacteria 2289
339 Ga0495660_0054827 3300046810 Bacteria 2159
340 Ga0495604_0057476 3300047317 Bacteria 2990
341 Ga0495604_0061342 3300047317 Bacteria 2876
342 Ga0495674_0026527 3300047319 Bacteria 5301
343 Ga0495672_0000283 3300047320 Bacteria 70623
344 Ga0495672_0011324 3300047320 Bacteria 6302
345 Ga0495672_0012659 3300047320 Bacteria 5871
346 Ga0495672_0022169 3300047320 Bacteria 4133
347 Ga0495676_0003470 3300047321 Bacteria 14269
348 Ga0495676_0009088 3300047321 Bacteria 9064
349 Ga0495680_0009345 3300047322 Bacteria 8825
350 Ga0495680_0060949 3300047322 Bacteria 2904
351 Ga0495683_0000057 3300047323 Bacteria 118509
352 Ga0495683_0003119 3300047323 Bacteria 9711
353 Ga0495683_0012601 3300047323 Bacteria 4440
354 Ga0495683_0061192 3300047323 Bacteria 1864
355 Ga0495675_0026356 3300047444 Bacteria 3706
356 Ga0495679_001267 3300047446 Bacteria 14834
357 Ga0495679_003296 3300047446 Bacteria 7818
358 Ga0495679_003902 3300047446 Bacteria 7052
359 Ga0495679_006956 3300047446 Bacteria 4794
360 Ga0495679_020389 3300047446 Bacteria 2309
361 Ga0495673_0000234 3300047469 Bacteria 80453
362 Ga0495673_0000518 3300047469 Bacteria 40740
363 Ga0495673_0001200 3300047469 Bacteria 21619
364 Ga0495673_0004645 3300047469 Bacteria 8538
365 Ga0495673_0004792 3300047469 Bacteria 8368
366 Ga0495673_0031088 3300047469 Bacteria 2502
367 Ga0495673_0031728 3300047469 Bacteria 2471
368 Ga0495673_0032500 3300047469 Bacteria 2431
369 Ga0495673_0032846 3300047469 Bacteria 2414
370 Ga0495673_0060186 3300047469 Bacteria 1630
371 Ga0495681_0003334 3300047470 Bacteria 11170
372 Ga0495681_0005959 3300047470 Bacteria 8083
373 Ga0495681_0007818 3300047470 Bacteria 6770
374 Ga0495681_0012396 3300047470 Bacteria 5012
375 Ga0495681_0014434 3300047470 Bacteria 4526
376 Ga0495681_0019410 3300047470 Bacteria 3712
377 Ga0495681_0037484 3300047470 Bacteria 2387
378 Ga0495681_0071570 3300047470 Bacteria 1570
379 Ga0495684_0082957 3300047471 Bacteria 2431
380 Ga0495686_0005400 3300047472 Bacteria 10091
381 Ga0495686_0008114 3300047472 Bacteria 7765
382 Ga0495593_0042774 3300047673 Bacteria 2430
383 Ga0495602_0011560 3300048088 Bacteria 9120
384 Ga0495626_0001687 3300048091 Bacteria 17018
385 Ga0495626_0011568 3300048091 Bacteria 4664
386 Ga0495626_0015245 3300048091 Bacteria 3939
387 Ga0495626_0015471 3300048091 Bacteria 3904
388 Ga0495626_0030825 3300048091 Bacteria 2584
389 Ga0495626_0054907 3300048091 Bacteria 1828
390 Ga0496102_0000440 3300048905 Bacteria 47446
391 Ga0496102_0276433 3300048905 Bacteria 1583
392 Ga0496103_0070316 3300048906 Bacteria 2189
393 Ga0496106_0023415 3300048909 Bacteria 4588
394 Ga0496116_0000038 3300048919 Bacteria 370217
395 Ga0496116_0002938 3300048919 Bacteria 17362
396 Ga0496116_0004737 3300048919 Bacteria 12846
397 Ga0496116_0010379 3300048919 Bacteria 7816
398 Ga0496117_0006546 3300048920 Bacteria 11728
399 Ga0496117_0016625 3300048920 Bacteria 6194
400 Ga0496117_0024596 3300048920 Bacteria 4758
401 Ga0496117_0029658 3300048920 Bacteria 4213
402 Ga0496117_0039635 3300048920 Bacteria 3473
403 Ga0496117_0049753 3300048920 Bacteria 2977
404 Ga0496118_0006336 3300048921 Bacteria 13068
405 Ga0496118_0007574 3300048921 Bacteria 11455
406 Ga0496118_0039421 3300048921 Bacteria 3770
407 Ga0496118_0083442 3300048921 Bacteria 2234
408 Ga0496118_0121584 3300048921 Bacteria 1700
409 Ga0496119_0040148 3300048922 Bacteria 2997
410 Ga0496119_0129024 3300048922 Bacteria 1380
411 Ga0496121_0000117 3300048924 Bacteria 176263
412 Ga0496121_0026910 3300048924 Bacteria 5398
413 Ga0496121_0096838 3300048924 Bacteria 2288
414 Ga0496122_0008613 3300048925 Bacteria 10951
415 Ga0496122_0013921 3300048925 Bacteria 7822
416 Ga0496122_0103732 3300048925 Bacteria 1891
417 Ga0496123_0000319 3300048926 Bacteria 91891
418 Ga0496123_0009666 3300048926 Bacteria 8649
419 Ga0496123_0038161 3300048926 Bacteria 3380
420 Ga0496124_0037895 3300048927 Bacteria 4188
421 Ga0496124_0105795 3300048927 Bacteria 2272
422 Ga0496124_0109373 3300048927 Bacteria 2227
423 Ga0496124_0184191 3300048927 Bacteria 1604
424 Ga0496125_0033164 3300048928 Bacteria 4575
425 Ga0496125_0034609 3300048928 Bacteria 4449
426 Ga0496126_0255033 3300048929 Bacteria 1460
427 Ga0495678_001482 3300049459 Bacteria 18348
428 Ga0495678_002175 3300049459 Bacteria 13778
429 Ga0495678_003108 3300049459 Bacteria 10519
430 Ga0495678_005863 3300049459 Bacteria 6651
431 Ga0495678_005916 3300049459 Bacteria 6616
432 Ga0495678_009878 3300049459 Bacteria 4678
433 Ga0495678_012249 3300049459 Bacteria 4071
434 Ga0495682_0015936 3300049460 Bacteria 2845
435 Ga0495682_0036642 3300049460 Bacteria 1805
436 Ga0501241_000656 3300049758 Bacteria 7435
437 Ga0500572_001850 3300053111 Bacteria 5365
438 Ga0500621_014561 3300053126 Bacteria 2867
439 Ga0500573_0006627 3300053140 Bacteria 6284
440 Ga0500586_040985 3300053145 Bacteria 1571
441 Ga0500586_061630 3300053145 Bacteria 1305
442 2511280172 2511231008 Bacteria 6624100
443 2511288662 2511231010 Bacteria 6373152
444 2511296792 2511231011 Bacteria 6149768
445 2511370391 2511231023 Bacteria 6808468
446 2511415480 2511231031 Bacteria 6558529
447 2555669870 2554235341 Bacteria 6867980
448 2599328964 2599185155 Bacteria 5827168
449 2599353102 2599185160 Bacteria 6844013
450 2599359463 2599185161 Bacteria 6960462
451 2599365016 2599185162 Bacteria 6957254
452 2599372157 2599185163 Bacteria 6995158
453 2599378210 2599185164 Bacteria 6841688
454 2599384413 2599185165 Bacteria 6843250
455 2599391015 2599185166 Bacteria 6959206
456 2599403200 2599185168 Bacteria 6997636
457 2599459936 2599185181 Bacteria 6844519
458 2599465703 2599185182 Bacteria 6883168
459 2599488957 2599185186 Bacteria 6831633
460 2600212543 2599185356 Bacteria 6843884
461 2601772711 2600255313 Bacteria 6842543
462 2601799567 2600255318 Bacteria 6383414
463 2606078199 2603880185 Bacteria 6379190
464 2606130307 2603880199 Bacteria 6377649
465 2624480595 2623620443 Bacteria 6427864
466 2671095298 2667528171 Bacteria 6900659
467 2715751519 2713897148 Bacteria 5883533
468 2715756553 2713897149 Bacteria 6506249
469 2739311977 2738543025 Bacteria 6600348
470 2774133615 2773857673 Bacteria 6513460
471 2784264630 2784132063 Bacteria 6262788
472 2808929204 2808606377 Bacteria 6646337
473 2808951325 2808606381 Bacteria 6646461
474 2808958475 2808606382 Bacteria 6841132
475 2809214978 2808606445 Bacteria 6057339
476 2812366647 2811994881 Bacteria 6298475
477 2819658705 2818991456 Bacteria 6123676
478 2819701222 2818991464 Bacteria 6907494
479 2826584762 2826581358 Bacteria 5963467
480 2842816412 2842815866 Bacteria 5947510
481 2842834561 2842832357 Bacteria 5959113
482 2842848776 2842843487 Bacteria 6004777
483 2842850007 2842849001 Bacteria 5924277
484 2852661953 2852657418 Bacteria 6472974
485 2860344784 2860339153 Bacteria 6846989
486 2878032469 2878029506 Bacteria 6418441
487 2880233320 2880230671 Bacteria 6140320
488 2904524011 2904518522 Bacteria 6068986
489 2917073691 2917070673 Bacteria 6868303
490 2919065153 2919063839 Bacteria 6302690
491 2919386936 2919385768 Bacteria 5897293
492 2919458840 2919456309 Bacteria 6586567
493 2919489121 2919487758 Bacteria 5929766
494 2923520679 2923519811 Bacteria 6298479
495 2931402302 2931396565 Bacteria 7251677
496 2935357285 2935353572 Unclassified 6955622
497 2969307340 2969304461 Bacteria 6601805
498 2974291003 2974289157 Bacteria 6080362
499 2998142816 2998139840 Bacteria 6073514
500 3007514445 3007511990 Bacteria 6481491
501 3007614311 3007614139 Bacteria 6053559
502 3007719233 3007718800 Bacteria 5971527
503 3007856838 3007855910 Bacteria 5637581
504 637320220 637000220 Bacteria 7074893
505 8029997976 8029995093 Bacteria 5990776
506 8056168384 8056166840 Bacteria 5820959
507 8056574547 8056569372 Bacteria 5997322
508 Ga0495617_019804
509 JGI25162J39368_1000004
510 JGI25163J39215_1000244
511 JGI25164J39214_1000026
512 JGI25165J46597_1000011
513 Ga0055536_1000047
514 Ga0055536_1000066
515 Ga0055530_10000321
516 Ga0055530_10003565
517 Ga0055540_1000006
518 Ga0055531_10000099
519 Ga0065714_10004642
520 Ga0065714_10066122
521 Ga0065714_10098565
522 Ga0070681_10010839
523 Ga0070679_100059767
524 Ga0068853_100036347
525 Ga0070704_100144823
526 Ga0068855_100046297
527 Ga0068856_100317869
528 Ga0105251_10020423
529 Ga0105251_10022355
530 Ga0105251_10022389
531 Ga0105244_10001051
532 Ga0105244_10001644
533 Ga0105244_10005786
534 Ga0105244_10009647
535 Ga0105250_10010189
536 Ga0105250_10011019
537 Ga0105250_10016123
538 Ga0105243_10000026
539 Ga0105243_10005363
540 Ga0105243_10013596
541 Ga0105237_10287378
542 Ga0105239_10027260
543 Ga0105246_10001587
544 Ga0157345_1000015
545 Ga0157373_10000389
546 Ga0157373_10014192
547 Ga0157373_10022012
548 Ga0157373_10048051
549 Ga0157373_10197661
550 Ga0157371_10000142
551 Ga0157371_10000202
552 Ga0157371_10000453
553 Ga0157371_10003125
554 Ga0157370_10125670
555 Ga0157370_10341175
556 Ga0157369_10001032
557 Ga0157369_10005042
558 Ga0157369_10113361
559 Ga0163162_10000346
560 Ga0157372_10000552
561 Ga0157375_10630207
562 Ga0182008_10002080
563 Ga0182008_10003917
564 Ga0182008_10017935
565 Ga0182008_10023159
566 Ga0182006_1000459
567 Ga0182006_1003150
568 Ga0182006_1007624
569 Ga0182005_1002937
570 Ga0182005_1003950
571 Ga0182005_1006276
572 Ga0182005_1018080
573 Ga0182005_1038724
574 Ga0163161_10004310
575 Ga0163161_10084523
576 Ga0224712_10067769
577 Ga0209760_100083
578 Ga0209563_101958
579 Ga0207427_100003
580 Ga0209437_100002
581 Ga0209233_1000004
582 Ga0209675_1014489
583 Ga0209676_1000002
584 Ga0209676_1000158
585 Ga0209050_1000006
586 Ga0209051_1000001
587 Ga0209257_1000029
588 Ga0207696_1000002
589 Ga0207696_1000724
590 Ga0207655_1000518
591 Ga0207655_1001944
592 Ga0207655_1004414
593 Ga0207655_1004921
594 Ga0207655_1007549
595 Ga0207713_1000275
596 Ga0207713_1003617
597 Ga0207713_1034353
598 Ga0207713_1091135
599 Ga0207707_10019461
600 Ga0207671_10227453
601 Ga0207652_10079096
602 Ga0207709_10000004
603 Ga0207709_10003305
604 Ga0207709_10067449
605 Ga0207639_10004894
606 Ga0207702_10456224
607 Ga0207674_10058636
608 Ga0209371_1000395
609 Ga0268256_1000838
610 Ga0316179_1008742
611 Ga0316178_1100526
612 Ga0307408_100009831
613 Ga0307408_100025296
614 Ga0307516_10148010
615 Ga0307516_10222261
616 Ga0307412_10014951
617 Ga0307412_10045726
618 Ga0307412_10054964
619 Ga0307409_100033856
620 Ga0307414_10020295
621 Ga0307411_10109721
622 Ga0307510_10018740
623 Ga0237819_04950
624 Ga0439438_000250
625 Ga0439438_001395
626 Ga0439438_001998
627 Ga0439447_001286
628 Ga0439447_021745
629 Ga0439466_0024297
630 Ga0439466_0055909
631 Ga0439445_0025610
632 Ga0439432_000867
633 Ga0439432_030940
634 Ga0439452_000087
635 Ga0439452_000111
636 Ga0439452_021305
637 Ga0439456_000552
638 Ga0450911_000513
639 Ga0450902_000869
640 Ga0450902_010037
641 Ga0450904_001836
642 Ga0450905_005426
643 Ga0450905_005607
644 Ga0450906_000499
645 Ga0439464_0002112
646 Ga0495617_002427
647 Ga0495617_011878
648 Ga0495617_015322
649 Ga0495617_043147
650 Ga0495617_044339
651 Ga0495627_000009
652 Ga0495627_000064
653 Ga0495627_000491
654 Ga0495627_002070
655 Ga0495627_002757
656 Ga0495627_020252
657 Ga0495592_0004976
658 Ga0495590_0005230
659 Ga0495590_0012425
660 Ga0495591_000155
661 Ga0495591_000667
662 Ga0495591_001178
663 Ga0495591_004360
664 Ga0495591_007120
665 Ga0495591_008113
666 Ga0495591_013466
667 Ga0495591_021968
668 Ga0495591_027515
669 Ga0495638_0000651
670 Ga0495638_0004108
671 Ga0495638_0040146
672 Ga0495638_0094368
673 Ga0495653_0004416
674 Ga0495653_0026013
675 Ga0495650_0005163
676 Ga0495650_0006606
677 Ga0495650_0011618
678 Ga0495650_0018420
679 Ga0495650_0038308
680 Ga0495605_0000080
681 Ga0495605_0000264
682 Ga0495605_0001607
683 Ga0495605_0008430
684 Ga0495605_0013929
685 Ga0495605_0032785
686 Ga0495584_0000669
687 Ga0495584_0001334
688 Ga0495584_0004207
689 Ga0495584_0005203
690 Ga0495585_0000274
691 Ga0495585_0001686
692 Ga0495585_0005606
693 Ga0495585_0010222
694 Ga0495585_0012800
695 Ga0495585_0036415
696 Ga0495585_0057938
697 Ga0495585_0063201
698 Ga0495596_0054329
699 Ga0495607_0000016
700 Ga0495607_0001934
701 Ga0495607_0006285
702 Ga0495607_0007520
703 Ga0495607_0018447
704 Ga0495607_0056269
705 Ga0495607_0061115
706 Ga0495607_0102017
707 Ga0495583_0000089
708 Ga0495583_0001359
709 Ga0495583_0012250
710 Ga0495583_0021330
711 Ga0495606_0002914
712 Ga0495606_0011164
713 Ga0495606_0011208
714 Ga0495606_0028556
715 Ga0495606_0041339
716 Ga0495606_0108649
717 Ga0495610_0006134
718 Ga0495610_0006481
719 Ga0495610_0008572
720 Ga0495610_0023891
721 Ga0495610_0024766
722 Ga0495610_0062134
723 Ga0495610_0067035
724 Ga0495616_0000104
725 Ga0495616_0003578
726 Ga0495616_0005316
727 Ga0495616_0005465
728 Ga0495616_0035508
729 Ga0495616_0075157
730 Ga0495620_0000805
731 Ga0495620_0002255
732 Ga0495620_0006369
733 Ga0495620_0043099
734 Ga0495620_0067998
735 Ga0495620_0079630
736 Ga0495628_0139735
737 Ga0495631_0000014
738 Ga0495631_0000519
739 Ga0495631_0001375
740 Ga0495631_0038604
741 Ga0495632_0000150
742 Ga0495632_0000219
743 Ga0495632_0004341
744 Ga0495632_0011398
745 Ga0495632_0013491
746 Ga0495632_0018323
747 Ga0495632_0021248
748 Ga0495632_0065648
749 Ga0495632_0099621
750 Ga0495637_0001145
751 Ga0495637_0004524
752 Ga0495637_0005618
753 Ga0495637_0008705
754 Ga0495637_0011460
755 Ga0495637_0011868
756 Ga0495637_0049879
757 Ga0495637_0068301
758 Ga0495643_0006381
759 Ga0495643_0006835
760 Ga0495643_0028795
761 Ga0495643_0055829
762 Ga0495644_0016769
763 Ga0495648_0002237
764 Ga0495648_0006508
765 Ga0495648_0010740
766 Ga0495648_0011145
767 Ga0495648_0015263
768 Ga0495648_0025800
769 Ga0495648_0030115
770 Ga0495666_0014243
771 Ga0495666_0018343
772 Ga0495652_0074029
773 Ga0495654_0000731
774 Ga0495654_0014388
775 Ga0495654_0090527
776 Ga0495587_0013443
777 Ga0495609_0000027
778 Ga0495609_0003968
779 Ga0495609_0004270
780 Ga0495609_0008334
781 Ga0495609_0060925
782 Ga0495609_0118741
783 Ga0495597_0000002
784 Ga0495597_0000166
785 Ga0495622_0000219
786 Ga0495633_0002262
787 Ga0495633_0027773
788 Ga0495633_0107149
789 Ga0495633_0116970
790 Ga0495668_0006387
791 Ga0495668_0030202
792 Ga0495634_0001919
793 Ga0495634_0034357
794 Ga0495611_0000012
795 Ga0495611_0016124
796 Ga0495611_0020350
797 Ga0495625_0000383
798 Ga0495625_0003858
799 Ga0495625_0019866
800 Ga0495625_0026397
801 Ga0495625_0044356
802 Ga0495625_0101134
803 Ga0495625_0126379
804 Ga0495635_0004543
805 Ga0495661_0000141
806 Ga0495661_0016937
807 Ga0495661_0031783
808 Ga0495661_0035966
809 Ga0495661_0054929
810 Ga0495661_0083130
811 Ga0495588_0175411
812 Ga0495623_0005312
813 Ga0495646_0002158
814 Ga0495646_0030938
815 Ga0495613_0025671
816 Ga0495613_0032233
817 Ga0495613_0088923
818 Ga0495624_0000016
819 Ga0495624_0044704
820 Ga0495670_0000489
821 Ga0495671_0003504
822 Ga0495671_0004786
823 Ga0495671_0010897
824 Ga0495671_0023352
825 Ga0495671_0057522
826 Ga0495671_0071242
827 Ga0495649_0002572
828 Ga0495649_0005706
829 Ga0495649_0022011
830 Ga0495649_0051590
831 Ga0495649_0101664
832 Ga0495589_0000975
833 Ga0495589_0005386
834 Ga0495600_0017209
835 Ga0495660_0000106
836 Ga0495660_0000589
837 Ga0495660_0002334
838 Ga0495660_0003630
839 Ga0495660_0003689
840 Ga0495660_0004401
841 Ga0495660_0015318
842 Ga0495660_0016348
843 Ga0495660_0043971
844 Ga0495660_0047560
845 Ga0495660_0049654
846 Ga0495660_0054827
847 Ga0495604_0057476
848 Ga0495604_0061342
849 Ga0495674_0026527
850 Ga0495672_0000283
851 Ga0495672_0011324
852 Ga0495672_0012659
853 Ga0495672_0022169
854 Ga0495676_0003470
855 Ga0495676_0009088
856 Ga0495680_0009345
857 Ga0495680_0060949
858 Ga0495683_0000057
859 Ga0495683_0003119
860 Ga0495683_0012601
861 Ga0495683_0061192
862 Ga0495675_0026356
863 Ga0495679_001267
864 Ga0495679_003296
865 Ga0495679_003902
866 Ga0495679_006956
867 Ga0495679_020389
868 Ga0495673_0000234
869 Ga0495673_0000518
870 Ga0495673_0001200
871 Ga0495673_0004645
872 Ga0495673_0004792
873 Ga0495673_0031088
874 Ga0495673_0031728
875 Ga0495673_0032500
876 Ga0495673_0032846
877 Ga0495673_0060186
878 Ga0495681_0003334
879 Ga0495681_0005959
880 Ga0495681_0007818
881 Ga0495681_0012396
882 Ga0495681_0014434
883 Ga0495681_0019410
884 Ga0495681_0037484
885 Ga0495681_0071570
886 Ga0495684_0082957
887 Ga0495686_0005400
888 Ga0495686_0008114
889 Ga0495593_0042774
890 Ga0495602_0011560
891 Ga0495626_0001687
892 Ga0495626_0011568
893 Ga0495626_0015245
894 Ga0495626_0015471
895 Ga0495626_0030825
896 Ga0495626_0054907
897 Ga0496102_0000440
898 Ga0496102_0276433
899 Ga0496103_0070316
900 Ga0496106_0023415
901 Ga0496116_0000038
902 Ga0496116_0002938
903 Ga0496116_0004737
904 Ga0496116_0010379
905 Ga0496117_0006546
906 Ga0496117_0016625
907 Ga0496117_0024596
908 Ga0496117_0029658
909 Ga0496117_0039635
910 Ga0496117_0049753
911 Ga0496118_0006336
912 Ga0496118_0007574
913 Ga0496118_0039421
914 Ga0496118_0083442
915 Ga0496118_0121584
916 Ga0496119_0040148
917 Ga0496119_0129024
918 Ga0496121_0000117
919 Ga0496121_0026910
920 Ga0496121_0096838
921 Ga0496122_0008613
922 Ga0496122_0013921
923 Ga0496122_0103732
924 Ga0496123_0000319
925 Ga0496123_0009666
926 Ga0496123_0038161
927 Ga0496124_0037895
928 Ga0496124_0105795
929 Ga0496124_0109373
930 Ga0496124_0184191
931 Ga0496125_0033164
932 Ga0496125_0034609
933 Ga0496126_0255033
934 Ga0495678_001482
935 Ga0495678_002175
936 Ga0495678_003108
937 Ga0495678_005863
938 Ga0495678_005916
939 Ga0495678_009878
940 Ga0495678_012249
941 Ga0495682_0015936
942 Ga0495682_0036642
943 Ga0501241_000656
944 Ga0500572_001850
945 Ga0500621_014561
946 Ga0500573_0006627
947 Ga0500586_040985
948 Ga0500586_061630
949 2511280172
950 2511288662
951 2511296792
952 2511370391
953 2511415480
954 2555669870
955 2599328964
956 2599353102
957 2599359463
958 2599365016
959 2599372157
960 2599378210
961 2599384413
962 2599391015
963 2599403200
964 2599459936
965 2599465703
966 2599488957
967 2600212543
968 2601772711
969 2601799567
970 2606078199
971 2606130307
972 2624480595
973 2671095298
974 2715751519
975 2715756553
976 2739311977
977 2774133615
978 2784264630
979 2808929204
980 2808951325
981 2808958475
982 2809214978
983 2812366647
984 2819658705
985 2819701222
986 2826584762
987 2842816412
988 2842834561
989 2842848776
990 2842850007
991 2852661953
992 2860344784
993 2878032469
994 2880233320
995 2904524011
996 2917073691
997 2919065153
998 2919386936
999 2919458840
1000 2919489121
1001 2923520679
1002 2931402302
1003 2935357285
1004 2969307340
1005 2974291003
1006 2998142816
1007 3007514445
1008 3007614311
1009 3007719233
1010 3007856838
1011 637320220
1012 8029997976
1013 8056168384
1014 8056574547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xdd-assembly1.cif.gz_A crystal structure of tertiary complex of tdsc from paenibacillus sp. a11-2 with fmn and indole 0.8045 3 325
4n5f-assembly1.cif.gz_A-2 crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315 0.8035 23 323
1ivh-assembly1.cif.gz_B structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity 0.8015 3 326
2d29-assembly1.cif.gz_A structural study on project id tt0172 from thermus thermophilus hb8 0.7998 3 326
7xp7-assembly2.cif.gz_C crystal structure of the flavoprotein colb1 catalyzing assembly line-tethered cysteine dehydrogenation 0.7955 3 318
ID Description Score Start End Superfamily
af_A0A1D6LYJ2_173_278_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.8316 99 176 2.40.110.10
af_P95187_227_332_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.8196 89 175 2.40.110.10
af_P95281_118_214_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.8193 96 179 2.40.110.10
af_Q2G1C8_142_249_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.8159 90 176 2.40.110.10
af_Q6NWF0_171_282_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.8151 99 176 2.40.110.10
ID Description Score Start End GO Terms
AF-A0A3M3GH25-F1-model_v4 deleted 0.9513 52 293
AF-A0A7Y2PEW6-F1-model_v4 Acyl-CoA dehydrogenase 0.9503 1 144 GO:0016627
AF-A0A6G1W9E3-F1-model_v4 deleted 0.9449 1 231
AF-A0A837B4Y2-F1-model_v4 deleted 0.939 3 166
AF-A0A7Y2PEW6-F1-model_v4 Acyl-CoA dehydrogenase 0.9377 1 144 GO:0016627

Map