F456754

General Info

Members Datasets Scaffolds Average Seq Length
507 328 1014 327

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_25945_c1|nmdc:mga06z11_25945_c1_1311_2441
Length 376
Sequence MNGIHKGLPISPATAAGREPLRWDPDRRRRGNGIDAPRLRRSHSKSKEQVMQTRRLGGSGLEVSAMGLGCMGMSFGYGPAGDTSEMIALLQSAVDRGITFFDTAEAYGPYTNEELLGEALAPVRDRVVIATKFGFTFGEPRGLNSRPEHIRAVAEASLTRLRIDTIDLFYQHRVDPDVPIEDVAGTVRDLISEGKVRHFGLSEAGVQTIRRAHAVQPVAALQSEYSLWWRQPEAEVIPTLEELGIGFVPFSPLGKGFLTGAISETTTFDSTDFRNVVPRFTPEARKANQAVVDLLRQIGERKGATPAQIALAWLLAQKPWIVPIPGTTKLARLDENIDAVSVELSAEDLRDIDRAAAAITVQGDRYPEHLARMTGR

Samples

Sample ID Description Type Environment
1 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
277 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
278 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
296 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
297 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
298 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
299 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
300 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
307 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
308 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
309 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
310 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
311 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
312 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
313 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
314 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
315 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
316 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
317 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
318 2906610324
319 2922425934
320 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
321 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
322 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
323 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
324 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
325 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
326 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
327 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
328 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0.79
Isolates 4.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.02
Nodule 1.97
Rhizoplane 2.96
Rhizosphere 75.94
Stem 0
Stem Tuber 0.2
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06z11_25945_c1 3300050494 Bacteria 2784
2 JGI25150J39212_1000421 3300002774 Bacteria 19529
3 JGI25151J46595_10000224 3300003187 Bacteria 67033
4 Ga0055526_1001664 3300003771 Bacteria 15587
5 Ga0055537_1000005 3300003773 Bacteria 160497
6 Ga0055524_1011789 3300003775 Bacteria 3392
7 Ga0055536_1000012 3300003781 Bacteria 263217
8 Ga0055536_1002681 3300003781 Bacteria 9875
9 Ga0055536_1004123 3300003781 Bacteria 7538
10 Ga0055534_1000127 3300003784 Bacteria 57100
11 Ga0055528_1000063 3300003790 Bacteria 85587
12 Ga0055530_10002752 3300003791 Bacteria 10879
13 Ga0055530_10009591 3300003791 Bacteria 3699
14 Ga0055530_10009978 3300003791 Bacteria 3572
15 Ga0055540_1024756 3300003792 Bacteria 1484
16 Ga0055531_10000291 3300003794 Bacteria 50096
17 Ga0065715_10000409 3300005293 Bacteria 12174
18 Ga0065707_10033672 3300005295 Bacteria 1211
19 Ga0065707_10160858 3300005295 Bacteria 1564
20 Ga0070658_10084200 3300005327 Bacteria 2615
21 Ga0070676_10215054 3300005328 Bacteria 1267
22 Ga0070670_100028857 3300005331 Bacteria 4776
23 Ga0070666_10037448 3300005335 Bacteria 3225
24 Ga0070680_100399294 3300005336 Bacteria 1172
25 Ga0070682_100064069 3300005337 Bacteria 2332
26 Ga0070660_100232363 3300005339 Bacteria 1501
27 Ga0070687_100128966 3300005343 Bacteria 1458
28 Ga0070661_100109779 3300005344 Bacteria 2059
29 Ga0070661_100274214 3300005344 Bacteria 1307
30 Ga0070692_10130720 3300005345 Bacteria 1411
31 Ga0070669_100029754 3300005353 Bacteria 3940
32 Ga0070674_100023075 3300005356 Bacteria 4021
33 Ga0070688_100006784 3300005365 Bacteria 6139
34 Ga0070709_10001627 3300005434 Bacteria 12150
35 Ga0070709_10112261 3300005434 Bacteria 1834
36 Ga0070714_100114810 3300005435 Bacteria 2389
37 Ga0070714_100194974 3300005435 Bacteria 1850
38 Ga0070713_100048759 3300005436 Bacteria 3489
39 Ga0070713_100069082 3300005436 Bacteria 2978
40 Ga0070713_100089538 3300005436 Bacteria 2644
41 Ga0070710_10266204 3300005437 Bacteria 1107
42 Ga0070711_100004269 3300005439 Bacteria 8405
43 Ga0070711_100323582 3300005439 Bacteria 1233
44 Ga0070708_100042021 3300005445 Bacteria 4010
45 Ga0070662_100044666 3300005457 Bacteria 3175
46 Ga0070681_10018216 3300005458 Bacteria 7020
47 Ga0070681_10110386 3300005458 Bacteria 2690
48 Ga0070681_10323307 3300005458 Bacteria 1452
49 Ga0070707_100406460 3300005468 Bacteria 1322
50 Ga0070698_100000819 3300005471 Bacteria 33992
51 Ga0070698_100094985 3300005471 Bacteria 2960
52 Ga0070679_100002653 3300005530 Bacteria 16279
53 Ga0070679_100019340 3300005530 Bacteria 6619
54 Ga0070679_100478605 3300005530 Bacteria 1189
55 Ga0068853_100045273 3300005539 Bacteria 3768
56 Ga0068853_100045875 3300005539 Bacteria 3745
57 Ga0070672_100042467 3300005543 Bacteria 3501
58 Ga0070672_100173762 3300005543 Bacteria 1793
59 Ga0070696_100260515 3300005546 Bacteria 1315
60 Ga0070665_100265494 3300005548 Bacteria 1718
61 Ga0068855_100062628 3300005563 Bacteria 4342
62 Ga0068855_100103578 3300005563 Bacteria 3274
63 Ga0070664_100039192 3300005564 Bacteria 3991
64 Ga0070664_100329438 3300005564 Bacteria 1385
65 Ga0068857_100236107 3300005577 Bacteria 1673
66 Ga0068859_100045633 3300005617 Bacteria 4402
67 Ga0068859_100078943 3300005617 Bacteria 3331
68 Ga0068864_100166772 3300005618 Bacteria 2005
69 Ga0068866_10029968 3300005718 Bacteria 2607
70 Ga0068861_100013308 3300005719 Bacteria 5756
71 Ga0068863_100345086 3300005841 Bacteria 1449
72 Ga0068862_100004858 3300005844 Bacteria 11313
73 Ga0068862_100337727 3300005844 Bacteria 1394
74 Ga0068862_100399509 3300005844 Bacteria 1285
75 Ga0081455_10027872 3300005937 Bacteria 5170
76 Ga0070717_10236743 3300006028 Bacteria 1609
77 Ga0075365_10263177 3300006038 Bacteria 1213
78 Ga0075368_10005246 3300006042 Bacteria 4449
79 Ga0075368_10057090 3300006042 Bacteria 1558
80 Ga0075364_10096696 3300006051 Bacteria 1964
81 Ga0070712_100003472 3300006175 Bacteria 9703
82 Ga0075367_10006803 3300006178 Bacteria 5809
83 Ga0075367_10032677 3300006178 Bacteria 2996
84 Ga0075369_10009690 3300006186 Bacteria 3749
85 Ga0075366_10008024 3300006195 Bacteria 5851
86 Ga0075366_10082935 3300006195 Bacteria 1916
87 Ga0075370_10012815 3300006353 Bacteria 4441
88 Ga0075428_100269363 3300006844 Bacteria 1833
89 Ga0075433_10237674 3300006852 Bacteria 1617
90 Ga0075434_100045774 3300006871 Bacteria 4340
91 Ga0075434_100047909 3300006871 Bacteria 4241
92 Ga0075434_100058763 3300006871 Bacteria 3822
93 Ga0097620_100045633 3300006931 Bacteria 4402
94 Ga0097620_100078944 3300006931 Bacteria 3331
95 Ga0097620_100381559 3300006931 Bacteria 1505
96 Ga0105240_10000034 3300009093 Bacteria 278179
97 Ga0105245_10158723 3300009098 Bacteria 2144
98 Ga0105245_10202274 3300009098 Bacteria 1908
99 Ga0105247_10007286 3300009101 Bacteria 6798
100 Ga0114129_10013577 3300009147 Bacteria 11605
101 Ga0105242_10378893 3300009176 Bacteria 1314
102 Ga0105249_10150565 3300009553 Bacteria 2240
103 Ga0105239_10000028 3300010375 Bacteria 243470
104 Ga0105239_10298548 3300010375 Bacteria 1814
105 Ga0157373_10043720 3300013100 Bacteria 3199
106 Ga0157373_10044292 3300013100 Bacteria 3177
107 Ga0157371_10016852 3300013102 Bacteria 5440
108 Ga0157370_10328573 3300013104 Bacteria 1410
109 Ga0157369_10004377 3300013105 Bacteria 16674
110 Ga0157369_10147461 3300013105 Bacteria 2487
111 Ga0157374_10001967 3300013296 Bacteria 17228
112 Ga0157374_10061547 3300013296 Bacteria 3516
113 Ga0157378_10333437 3300013297 Bacteria 1477
114 Ga0163162_10637250 3300013306 Bacteria 1190
115 Ga0157372_10065743 3300013307 Bacteria 4073
116 Ga0157375_10353210 3300013308 Bacteria 1636
117 Ga0163163_10072035 3300014325 Bacteria 3444
118 Ga0157380_10586926 3300014326 Bacteria 1100
119 Ga0182008_10008624 3300014497 Bacteria 5551
120 Ga0157376_10061586 3300014969 Bacteria 3155
121 Ga0182006_1000041 3300015261 Bacteria 203413
122 Ga0182007_10008901 3300015262 Bacteria 4091
123 Ga0163161_10094544 3300017792 Bacteria 2216
124 Ga0209129_1000265 3300025258 Bacteria 51980
125 Ga0209129_1003690 3300025258 Bacteria 6498
126 Ga0209565_1000074 3300025263 Bacteria 164237
127 Ga0209673_1000129 3300025273 Bacteria 164238
128 Ga0209675_1000072 3300025291 Bacteria 164237
129 Ga0209676_1000001 3300025292 Bacteria 1852142
130 Ga0209676_1000708 3300025292 Bacteria 46267
131 Ga0209676_1000872 3300025292 Bacteria 38628
132 Ga0209025_1000204 3300025294 Bacteria 142193
133 Ga0209564_1000160 3300025295 Bacteria 164214
134 Ga0209050_1000018 3300025298 Bacteria 723263
135 Ga0209050_1000727 3300025298 Bacteria 47930
136 Ga0209050_1001246 3300025298 Bacteria 29439
137 Ga0209256_1000125 3300025299 Bacteria 165336
138 Ga0207426_1009669 3300025302 Bacteria 3795
139 Ga0209051_1002380 3300025303 Bacteria 13577
140 Ga0209257_1000134 3300025304 Bacteria 207628
141 Ga0209257_1011650 3300025304 Bacteria 4196
142 Ga0207653_10064512 3300025885 Bacteria 1242
143 Ga0207682_10030334 3300025893 Bacteria 2165
144 Ga0207642_10040721 3300025899 Bacteria 2029
145 Ga0207680_10034800 3300025903 Unclassified 2885
146 Ga0207699_10015364 3300025906 Bacteria 3974
147 Ga0207699_10093108 3300025906 Bacteria 1896
148 Ga0207707_10017872 3300025912 Bacteria 6182
149 Ga0207695_10000101 3300025913 Bacteria 258504
150 Ga0207693_10014642 3300025915 Bacteria 6302
151 Ga0207693_10015721 3300025915 Bacteria 6065
152 Ga0207663_10000576 3300025916 Bacteria 16195
153 Ga0207660_10257265 3300025917 Bacteria 1379
154 Ga0207662_10170954 3300025918 Bacteria 1393
155 Ga0207649_10258894 3300025920 Bacteria 1257
156 Ga0207652_10000077 3300025921 Bacteria 106573
157 Ga0207652_10001025 3300025921 Bacteria 25629
158 Ga0207652_10024589 3300025921 Bacteria 4998
159 Ga0207652_10309938 3300025921 Bacteria 1425
160 Ga0207646_10068932 3300025922 Bacteria 3159
161 Ga0207681_10032145 3300025923 Bacteria 3434
162 Ga0207681_10274431 3300025923 Bacteria 1325
163 Ga0207659_10059592 3300025926 Bacteria 2745
164 Ga0207700_10108789 3300025928 Bacteria 2227
165 Ga0207664_10092075 3300025929 Bacteria 2487
166 Ga0207664_10229258 3300025929 Bacteria 1614
167 Ga0207644_10063747 3300025931 Bacteria 2677
168 Ga0207644_10069153 3300025931 Bacteria 2578
169 Ga0207690_10445255 3300025932 Bacteria 1040
170 Ga0207706_10025382 3300025933 Bacteria 5310
171 Ga0207706_10060487 3300025933 Bacteria 3335
172 Ga0207706_10251367 3300025933 Bacteria 1544
173 Ga0207669_10035086 3300025937 Bacteria 2850
174 Ga0207669_10077806 3300025937 Bacteria 2111
175 Ga0207665_10311146 3300025939 Bacteria 1180
176 Ga0207691_10002909 3300025940 Bacteria 16703
177 Ga0207691_10031634 3300025940 Bacteria 4937
178 Ga0207691_10133086 3300025940 Bacteria 2195
179 Ga0207691_10237806 3300025940 Bacteria 1575
180 Ga0207711_10053072 3300025941 Bacteria 3476
181 Ga0207711_10077580 3300025941 Bacteria 2896
182 Ga0207711_10170740 3300025941 Bacteria 1973
183 Ga0207661_10030727 3300025944 Bacteria 4141
184 Ga0207679_10023666 3300025945 Bacteria 4203
185 Ga0207679_10068942 3300025945 Bacteria 2659
186 Ga0207667_10021702 3300025949 Bacteria 7113
187 Ga0207667_10091903 3300025949 Bacteria 3135
188 Ga0207667_10536223 3300025949 Bacteria 1185
189 Ga0207639_10036949 3300026041 Bacteria 3624
190 Ga0207639_10106802 3300026041 Bacteria 2273
191 Ga0207678_10067242 3300026067 Bacteria 3076
192 Ga0207708_10172812 3300026075 Bacteria 1712
193 Ga0207708_10265580 3300026075 Bacteria 1386
194 Ga0207702_10012962 3300026078 Bacteria 6935
195 Ga0207641_10235733 3300026088 Bacteria 1703
196 Ga0207641_10590945 3300026088 Bacteria 1086
197 Ga0207676_10350966 3300026095 Bacteria 1364
198 Ga0207674_10103904 3300026116 Bacteria 2820
199 Ga0207674_10158786 3300026116 Bacteria 2216
200 Ga0207675_100019019 3300026118 Bacteria 6411
201 Ga0207675_100475781 3300026118 Bacteria 1241
202 Ga0207683_10034139 3300026121 Bacteria 4420
203 Ga0207683_10064731 3300026121 Bacteria 3222
204 Ga0265354_1000204 3300028016 Bacteria 10905
205 Ga0265354_1002794 3300028016 Bacteria 2083
206 Ga0268266_10487030 3300028379 Bacteria 1176
207 Ga0268265_10001657 3300028380 Bacteria 18220
208 Ga0268265_10398183 3300028380 Bacteria 1272
209 Ga0265337_1001242 3300028556 Bacteria 12879
210 Ga0265337_1001411 3300028556 Bacteria 11812
211 Ga0265319_1000049 3300028563 Bacteria 98925
212 Ga0265319_1002169 3300028563 Bacteria 10954
213 Ga0265319_1006393 3300028563 Bacteria 5464
214 Ga0265319_1019946 3300028563 Bacteria 2493
215 Ga0265334_10004826 3300028573 Bacteria 5926
216 Ga0265334_10016767 3300028573 Bacteria 3029
217 Ga0265318_10000700 3300028577 Bacteria 22523
218 Ga0265318_10010490 3300028577 Bacteria 4033
219 Ga0265318_10015260 3300028577 Bacteria 3200
220 Ga0265318_10026913 3300028577 Bacteria 2263
221 Ga0265323_10007817 3300028653 Bacteria 4422
222 Ga0265336_10000152 3300028666 Bacteria 49208
223 Ga0265336_10010870 3300028666 Bacteria 3107
224 Ga0265336_10044361 3300028666 Bacteria 1353
225 Ga0265338_10000295 3300028800 Bacteria 89990
226 Ga0265338_10011076 3300028800 Bacteria 10460
227 Ga0265338_10026966 3300028800 Bacteria 5778
228 Ga0265338_10030547 3300028800 Bacteria 5305
229 Ga0265338_10061675 3300028800 Bacteria 3285
230 Ga0265338_10128318 3300028800 Bacteria 2008
231 Ga0265770_1001598 3300030878 Bacteria 3108
232 Ga0265770_1002623 3300030878 Bacteria 2443
233 Ga0265765_1000070 3300030879 Bacteria 5324
234 Ga0265760_10002054 3300031090 Bacteria 5928
235 Ga0265330_10017956 3300031235 Bacteria 3252
236 Ga0265330_10029552 3300031235 Bacteria 2464
237 Ga0265330_10114819 3300031235 Bacteria 1148
238 Ga0265332_10032144 3300031238 Bacteria 2287
239 Ga0265320_10001189 3300031240 Bacteria 19143
240 Ga0265320_10003608 3300031240 Bacteria 10341
241 Ga0265320_10006720 3300031240 Bacteria 7225
242 Ga0265325_10004437 3300031241 Bacteria 8871
243 Ga0265340_10000498 3300031247 Bacteria 21498
244 Ga0265340_10004463 3300031247 Bacteria 7823
245 Ga0265339_10028928 3300031249 Bacteria 3148
246 Ga0265339_10043427 3300031249 Bacteria 2486
247 Ga0265331_10002016 3300031250 Bacteria 14125
248 Ga0265331_10023223 3300031250 Bacteria 3154
249 Ga0265327_10000664 3300031251 Bacteria 55153
250 Ga0265327_10010624 3300031251 Bacteria 6445
251 Ga0265316_10003240 3300031344 Bacteria 16535
252 Ga0265316_10057115 3300031344 Bacteria 3045
253 Ga0265316_10075199 3300031344 Bacteria 2598
254 Ga0307513_10002376 3300031456 Bacteria 26125
255 Ga0307509_10023602 3300031507 Bacteria 6901
256 Ga0265313_10000194 3300031595 Bacteria 65054
257 Ga0265313_10004999 3300031595 Bacteria 9919
258 Ga0265313_10010331 3300031595 Bacteria 5923
259 Ga0307508_10000024 3300031616 Bacteria 176806
260 Ga0307508_10160607 3300031616 Bacteria 1851
261 Ga0265314_10000155 3300031711 Bacteria 103216
262 Ga0265314_10005846 3300031711 Bacteria 11015
263 Ga0265314_10034515 3300031711 Bacteria 3697
264 Ga0265314_10100371 3300031711 Bacteria 1862
265 Ga0265342_10001148 3300031712 Bacteria 25317
266 Ga0265342_10001239 3300031712 Bacteria 24132
267 Ga0265342_10003506 3300031712 Bacteria 12836
268 Ga0265342_10012007 3300031712 Bacteria 5884
269 Ga0307405_10168029 3300031731 Bacteria 1561
270 Ga0307410_10097998 3300031852 Bacteria 2096
271 Ga0307410_10355944 3300031852 Bacteria 1171
272 Ga0307409_100009651 3300031995 Bacteria 5946
273 Ga0316212_1003450 3300033547 Bacteria 2283
274 Ga0316212_1006754 3300033547 Bacteria 1662
275 Ga0395900_0005956 3300037418 Bacteria 12729
276 Ga0395905_0004391 3300037471 Bacteria 14679
277 Ga0395901_0224223 3300038443 Bacteria 1964
278 Ga0436365_0021158 3300039437 Bacteria 1411
279 Ga0436365_0668515 3300039437 Bacteria 3141
280 Ga0436360_0466019 3300039438 Bacteria 1981
281 Ga0451835_0225738 3300041492 Bacteria 1544
282 Ga0439448_0006146 3300042005 Bacteria 3445
283 Ga0450923_001098 3300042125 Bacteria 3419
284 Ga0439458_0001410 3300042157 Bacteria 6060
285 Ga0439458_0007833 3300042157 Bacteria 2377
286 Ga0450908_008803 3300042184 Bacteria 1886
287 Ga0451577_0379610 3300042876 Bacteria 1282
288 Ga0453683_0097209 3300044673 Bacteria 1848
289 Ga0453684_0075446 3300044712 Bacteria 4238
290 Ga0453684_0160288 3300044712 Bacteria 2662
291 Ga0466957_0002578 3300044842 Bacteria 9755
292 Ga0495617_000071 3300046452 Bacteria 83031
293 Ga0495617_000222 3300046452 Bacteria 34541
294 Ga0495617_005121 3300046452 Bacteria 4682
295 Ga0495627_000009 3300046453 Bacteria 463964
296 Ga0495627_000061 3300046453 Bacteria 139366
297 Ga0495627_016901 3300046453 Bacteria 2490
298 Ga0495629_0000004 3300046459 Bacteria 433516
299 Ga0495638_0000041 3300046460 Bacteria 235584
300 Ga0495653_0001498 3300046463 Bacteria 18244
301 Ga0495605_0001783 3300046474 Bacteria 13809
302 Ga0495584_0073497 3300046491 Bacteria 1718
303 Ga0495585_0000008 3300046492 Bacteria 278949
304 Ga0495585_0004882 3300046492 Bacteria 8595
305 Ga0495596_0006660 3300046500 Bacteria 5288
306 Ga0495596_0008646 3300046500 Bacteria 4517
307 Ga0495596_0013409 3300046500 Bacteria 3479
308 Ga0495596_0023485 3300046500 Bacteria 2501
309 Ga0495596_0024862 3300046500 Bacteria 2423
310 Ga0495607_0000141 3300046501 Bacteria 75379
311 Ga0495583_0007890 3300046506 Bacteria 6601
312 Ga0495583_0044374 3300046506 Bacteria 2063
313 Ga0495583_0057354 3300046506 Bacteria 1751
314 Ga0495608_0082188 3300046511 Bacteria 2092
315 Ga0495616_0000437 3300046513 Bacteria 31792
316 Ga0495616_0002646 3300046513 Bacteria 11773
317 Ga0495616_0012680 3300046513 Bacteria 4774
318 Ga0495616_0041674 3300046513 Bacteria 2341
319 Ga0495616_0071370 3300046513 Bacteria 1679
320 Ga0495620_0000008 3300046515 Bacteria 186489
321 Ga0495631_0000001 3300046518 Bacteria 216492
322 Ga0495631_0013770 3300046518 Bacteria 3919
323 Ga0495631_0020869 3300046518 Bacteria 3055
324 Ga0495637_0001775 3300046520 Bacteria 12337
325 Ga0495643_0004398 3300046522 Bacteria 9873
326 Ga0495644_0009604 3300046523 Bacteria 3726
327 Ga0495648_0000416 3300046524 Bacteria 46995
328 Ga0495648_0003340 3300046524 Bacteria 14156
329 Ga0495648_0021361 3300046524 Bacteria 4484
330 Ga0495642_0002765 3300046528 Bacteria 7035
331 Ga0495642_0028516 3300046528 Bacteria 2224
332 Ga0495642_0037178 3300046528 Bacteria 1969
333 Ga0495654_0000431 3300046530 Bacteria 35486
334 Ga0495654_0019804 3300046530 Bacteria 3514
335 Ga0495609_0009729 3300046538 Bacteria 4637
336 Ga0495609_0015193 3300046538 Bacteria 3607
337 Ga0495597_0000171 3300046542 Bacteria 57667
338 Ga0495597_0007594 3300046542 Bacteria 5493
339 Ga0495597_0043853 3300046542 Bacteria 1990
340 Ga0495668_0000105 3300046616 Bacteria 133981
341 Ga0495668_0007265 3300046616 Bacteria 7106
342 Ga0495668_0010213 3300046616 Bacteria 5702
343 Ga0495611_0000002 3300046648 Bacteria 705677
344 Ga0495611_0064069 3300046648 Bacteria 1673
345 Ga0495625_0000002 3300046660 Bacteria 813323
346 Ga0495625_0143027 3300046660 Bacteria 1612
347 Ga0495635_0032110 3300046663 Bacteria 3644
348 Ga0495635_0240531 3300046663 Bacteria 1221
349 Ga0495661_0000184 3300046665 Bacteria 71844
350 Ga0495661_0003786 3300046665 Bacteria 11076
351 Ga0495661_0037590 3300046665 Bacteria 3021
352 Ga0495657_0016395 3300046675 Bacteria 5399
353 Ga0495669_0000070 3300046684 Bacteria 68096
354 Ga0495613_0011135 3300046689 Bacteria 6679
355 Ga0495670_0006141 3300046691 Bacteria 5898
356 Ga0495671_0000598 3300046692 Bacteria 26613
357 Ga0495671_0001284 3300046692 Bacteria 17145
358 Ga0495649_0000670 3300046694 Bacteria 27938
359 Ga0495649_0023370 3300046694 Bacteria 3454
360 Ga0495649_0066849 3300046694 Bacteria 1928
361 Ga0495589_0000111 3300046794 Bacteria 77466
362 Ga0495589_0011125 3300046794 Bacteria 4670
363 Ga0495589_0011559 3300046794 Bacteria 4583
364 Ga0495589_0138711 3300046794 Bacteria 1165
365 Ga0495660_0000232 3300046810 Bacteria 54549
366 Ga0495660_0000265 3300046810 Bacteria 49322
367 Ga0495604_0025284 3300047317 Bacteria 4732
368 Ga0495636_0129789 3300047318 Bacteria 1120
369 Ga0495672_0003357 3300047320 Bacteria 13791
370 Ga0495672_0032613 3300047320 Bacteria 3238
371 Ga0495680_0013108 3300047322 Bacteria 7245
372 Ga0495683_0002439 3300047323 Bacteria 11240
373 Ga0495687_009903 3300047443 Bacteria 5276
374 Ga0495675_0011049 3300047444 Bacteria 5660
375 Ga0495677_0013203 3300047445 Bacteria 3005
376 Ga0495679_000003 3300047446 Bacteria 787868
377 Ga0495673_0000004 3300047469 Bacteria 1354526
378 Ga0495673_0000144 3300047469 Bacteria 127747
379 Ga0495673_0000283 3300047469 Bacteria 68581
380 Ga0495681_0047267 3300047470 Bacteria 2048
381 Ga0495686_0009889 3300047472 Bacteria 6834
382 Ga0495593_0002661 3300047673 Bacteria 10744
383 Ga0495626_0014768 3300048091 Bacteria 4014
384 Ga0495626_0046425 3300048091 Bacteria 2023
385 Ga0496100_0002604 3300048903 Bacteria 9198
386 Ga0496101_0000522 3300048904 Bacteria 23966
387 Ga0496101_0072951 3300048904 Bacteria 2521
388 Ga0496102_0002925 3300048905 Bacteria 14485
389 Ga0496102_0367182 3300048905 Bacteria 1355
390 Ga0496103_0191557 3300048906 Bacteria 1315
391 Ga0496104_0022010 3300048907 Bacteria 5857
392 Ga0496104_0410031 3300048907 Bacteria 1267
393 Ga0496105_0026956 3300048908 Bacteria 4690
394 Ga0496106_0002996 3300048909 Bacteria 12575
395 Ga0496109_0053614 3300048912 Bacteria 3679
396 Ga0496110_0004185 3300048913 Bacteria 11148
397 Ga0496110_0350565 3300048913 Bacteria 1345
398 Ga0496114_0317048 3300048917 Bacteria 1377
399 Ga0496115_0029156 3300048918 Bacteria 4332
400 Ga0496117_0094767 3300048920 Bacteria 1909
401 Ga0496118_0001577 3300048921 Bacteria 33807
402 Ga0496118_0103336 3300048921 Bacteria 1917
403 Ga0496119_0000030 3300048922 Bacteria 240167
404 Ga0496120_0000033 3300048923 Bacteria 218355
405 Ga0496121_0000770 3300048924 Bacteria 58816
406 Ga0496121_0064177 3300048924 Bacteria 2996
407 Ga0496121_0149655 3300048924 Bacteria 1719
408 Ga0496123_0028091 3300048926 Bacteria 4173
409 Ga0496124_0039306 3300048927 Bacteria 4102
410 Ga0496125_0106733 3300048928 Bacteria 2043
411 Ga0496126_0002567 3300048929 Bacteria 24293
412 Ga0496126_0183774 3300048929 Bacteria 1774
413 Ga0495678_000019 3300049459 Bacteria 269723
414 Ga0495678_000216 3300049459 Bacteria 66661
415 Ga0495678_000239 3300049459 Bacteria 61896
416 Ga0495682_0000353 3300049460 Bacteria 33691
417 Ga0495682_0002475 3300049460 Bacteria 8725
418 Ga0495682_0009352 3300049460 Bacteria 3825
419 Ga0501298_026570 3300049521 Bacteria 1114
420 Ga0501032_0004804 3300049569 Bacteria 10132
421 Ga0501033_0024632 3300049570 Bacteria 4538
422 Ga0501034_0400340 3300049571 Bacteria 1295
423 Ga0501036_0067658 3300049572 Bacteria 3022
424 Ga0501037_0043934 3300049573 Bacteria 3283
425 Ga0501039_0006776 3300049575 Bacteria 8716
426 Ga0501039_0051088 3300049575 Bacteria 3200
427 Ga0501043_0046824 3300049579 Bacteria 3400
428 Ga0501046_0015215 3300049580 Bacteria 6469
429 Ga0501046_0151159 3300049580 Bacteria 1751
430 Ga0501047_0001017 3300049581 Bacteria 28284
431 Ga0501047_0166624 3300049581 Bacteria 2073
432 Ga0501048_0061125 3300049582 Bacteria 2668
433 Ga0501067_0021813 3300049583 Bacteria 3543
434 Ga0501069_0001577 3300049585 Bacteria 11265
435 Ga0501071_0046749 3300049587 Bacteria 3108
436 Ga0501072_0028524 3300049588 Bacteria 4358
437 Ga0501073_0008880 3300049589 Bacteria 7430
438 Ga0501074_0047083 3300049590 Bacteria 3117
439 Ga0501075_0027124 3300049591 Bacteria 4220
440 Ga0501076_0019111 3300049592 Bacteria 5231
441 Ga0501077_0320158 3300049593 Bacteria 989
442 Ga0501235_026120 3300049669 Bacteria 1307
443 Ga0501249_019261 3300049679 Bacteria 1481
444 Ga0501257_010052 3300049686 Bacteria 2143
445 Ga0501079_0101230 3300049741 Bacteria 2234
446 Ga0501080_0051066 3300049742 Bacteria 3846
447 Ga0501083_0197767 3300049744 Bacteria 1311
448 Ga0501270_002077 3300049767 Bacteria 2011
449 Ga0501035_0084285 3300049822 Bacteria 2803
450 Ga0501035_0088337 3300049822 Bacteria 2731
451 Ga0501044_0151657 3300049823 Bacteria 2299
452 Ga0501044_0427674 3300049823 Bacteria 1234
453 Ga0501045_0002695 3300049824 Bacteria 12119
454 Ga0501045_0159646 3300049824 Bacteria 1678
455 nmdc:mga00v17_26131_c1 3300050491 Bacteria 3398
456 nmdc:mga00v17_320307_c1 3300050491 Bacteria 1007
457 nmdc:mga0k408_1942_c2 3300050493 Bacteria 5086
458 nmdc:mga0k408_53855_c1 3300050493 Bacteria 2332
459 nmdc:mga06z11_12644_c1 3300050494 Bacteria 3677
460 nmdc:mga06z11_16692_c1 3300050494 Bacteria 3313
461 nmdc:mga05p37_203620_c1 3300050507 Bacteria 2395
462 nmdc:mga05p37_46946_c1 3300050507 Bacteria 5311
463 nmdc:mga0n895_107040_c1 3300050512 Bacteria 2809
464 nmdc:mga0n895_12041_c1 3300050512 Bacteria 7743
465 nmdc:mga0n895_157058_c1 3300050512 Bacteria 2305
466 nmdc:mga08x19_55690_c1 3300050514 Bacteria 2550
467 nmdc:mga0a205_327602_c1 3300050515 Bacteria 1402
468 nmdc:mga0sz30_15095_c1 3300050516 Bacteria 3050
469 Ga0500635_0000980 3300053080 Bacteria 6863
470 Ga0500578_0007622 3300053086 Bacteria 7137
471 Ga0500643_000054 3300053087 Bacteria 135351
472 Ga0500555_000063 3300053103 Bacteria 54165
473 Ga0500555_032917 3300053103 Bacteria 1463
474 Ga0500556_0000888 3300053104 Bacteria 16754
475 Ga0500556_0052639 3300053104 Bacteria 1478
476 Ga0500594_0028618 3300053118 Bacteria 1451
477 Ga0500608_000089 3300053122 Bacteria 37325
478 Ga0500573_0006375 3300053140 Bacteria 6380
479 Ga0500577_0004937 3300053142 Bacteria 3554
480 Ga0500622_0002781 3300053156 Bacteria 12298
481 Ga0500645_000484 3300053730 Bacteria 26930
482 Ga0500645_000778 3300053730 Bacteria 19306
483 Ga0500609_003452 3300053731 Bacteria 2215
484 Ga0501082_0013160 3300060353 Bacteria 7113
485 2524533010 2524023228 Bacteria 10118060
486 2585846372 2585427594 Bacteria 6180594
487 2721025428 2718218334 Bacteria 4765486
488 2738695318 2738541272 Bacteria 6848551
489 2739606288 2739367654 Bacteria 6049412
490 2760306899 2758568522 Bacteria 5953541
491 2838043521 2838042994 Bacteria 6046894
492 2842511697 2842509118 Bacteria 6850950
493 2857507235 2857504554 Bacteria 5369913
494 2884961922 2884960567 Bacteria 5437054
495 2900053152 2900051742 Bacteria 4985156
496 2904560303 2904555929 Bacteria 5218588
497 2906612458
498 2922433010
499 2935632997 2935630451 Bacteria 8169952
500 2941509701 2941507105 Bacteria 8166816
501 2941517530 2941515067 Bacteria 8166720
502 2941526517 2941523033 Bacteria 8169134
503 8006937325 8006933436 Bacteria 10410654
504 8006977356 8006973647 Bacteria 10679141
505 8019571388 8019565922 Bacteria 9639779
506 8024490004 8024486573 Bacteria 6540512
507 8056534226 8056533031 Bacteria 8964429
508 nmdc:mga06z11_25945_c1
509 JGI25150J39212_1000421
510 JGI25151J46595_10000224
511 Ga0055526_1001664
512 Ga0055537_1000005
513 Ga0055524_1011789
514 Ga0055536_1000012
515 Ga0055536_1002681
516 Ga0055536_1004123
517 Ga0055534_1000127
518 Ga0055528_1000063
519 Ga0055530_10002752
520 Ga0055530_10009591
521 Ga0055530_10009978
522 Ga0055540_1024756
523 Ga0055531_10000291
524 Ga0065715_10000409
525 Ga0065707_10033672
526 Ga0065707_10160858
527 Ga0070658_10084200
528 Ga0070676_10215054
529 Ga0070670_100028857
530 Ga0070666_10037448
531 Ga0070680_100399294
532 Ga0070682_100064069
533 Ga0070660_100232363
534 Ga0070687_100128966
535 Ga0070661_100109779
536 Ga0070661_100274214
537 Ga0070692_10130720
538 Ga0070669_100029754
539 Ga0070674_100023075
540 Ga0070688_100006784
541 Ga0070709_10001627
542 Ga0070709_10112261
543 Ga0070714_100114810
544 Ga0070714_100194974
545 Ga0070713_100048759
546 Ga0070713_100069082
547 Ga0070713_100089538
548 Ga0070710_10266204
549 Ga0070711_100004269
550 Ga0070711_100323582
551 Ga0070708_100042021
552 Ga0070662_100044666
553 Ga0070681_10018216
554 Ga0070681_10110386
555 Ga0070681_10323307
556 Ga0070707_100406460
557 Ga0070698_100000819
558 Ga0070698_100094985
559 Ga0070679_100002653
560 Ga0070679_100019340
561 Ga0070679_100478605
562 Ga0068853_100045273
563 Ga0068853_100045875
564 Ga0070672_100042467
565 Ga0070672_100173762
566 Ga0070696_100260515
567 Ga0070665_100265494
568 Ga0068855_100062628
569 Ga0068855_100103578
570 Ga0070664_100039192
571 Ga0070664_100329438
572 Ga0068857_100236107
573 Ga0068859_100045633
574 Ga0068859_100078943
575 Ga0068864_100166772
576 Ga0068866_10029968
577 Ga0068861_100013308
578 Ga0068863_100345086
579 Ga0068862_100004858
580 Ga0068862_100337727
581 Ga0068862_100399509
582 Ga0081455_10027872
583 Ga0070717_10236743
584 Ga0075365_10263177
585 Ga0075368_10005246
586 Ga0075368_10057090
587 Ga0075364_10096696
588 Ga0070712_100003472
589 Ga0075367_10006803
590 Ga0075367_10032677
591 Ga0075369_10009690
592 Ga0075366_10008024
593 Ga0075366_10082935
594 Ga0075370_10012815
595 Ga0075428_100269363
596 Ga0075433_10237674
597 Ga0075434_100045774
598 Ga0075434_100047909
599 Ga0075434_100058763
600 Ga0097620_100045633
601 Ga0097620_100078944
602 Ga0097620_100381559
603 Ga0105240_10000034
604 Ga0105245_10158723
605 Ga0105245_10202274
606 Ga0105247_10007286
607 Ga0114129_10013577
608 Ga0105242_10378893
609 Ga0105249_10150565
610 Ga0105239_10000028
611 Ga0105239_10298548
612 Ga0157373_10043720
613 Ga0157373_10044292
614 Ga0157371_10016852
615 Ga0157370_10328573
616 Ga0157369_10004377
617 Ga0157369_10147461
618 Ga0157374_10001967
619 Ga0157374_10061547
620 Ga0157378_10333437
621 Ga0163162_10637250
622 Ga0157372_10065743
623 Ga0157375_10353210
624 Ga0163163_10072035
625 Ga0157380_10586926
626 Ga0182008_10008624
627 Ga0157376_10061586
628 Ga0182006_1000041
629 Ga0182007_10008901
630 Ga0163161_10094544
631 Ga0209129_1000265
632 Ga0209129_1003690
633 Ga0209565_1000074
634 Ga0209673_1000129
635 Ga0209675_1000072
636 Ga0209676_1000001
637 Ga0209676_1000708
638 Ga0209676_1000872
639 Ga0209025_1000204
640 Ga0209564_1000160
641 Ga0209050_1000018
642 Ga0209050_1000727
643 Ga0209050_1001246
644 Ga0209256_1000125
645 Ga0207426_1009669
646 Ga0209051_1002380
647 Ga0209257_1000134
648 Ga0209257_1011650
649 Ga0207653_10064512
650 Ga0207682_10030334
651 Ga0207642_10040721
652 Ga0207680_10034800
653 Ga0207699_10015364
654 Ga0207699_10093108
655 Ga0207707_10017872
656 Ga0207695_10000101
657 Ga0207693_10014642
658 Ga0207693_10015721
659 Ga0207663_10000576
660 Ga0207660_10257265
661 Ga0207662_10170954
662 Ga0207649_10258894
663 Ga0207652_10000077
664 Ga0207652_10001025
665 Ga0207652_10024589
666 Ga0207652_10309938
667 Ga0207646_10068932
668 Ga0207681_10032145
669 Ga0207681_10274431
670 Ga0207659_10059592
671 Ga0207700_10108789
672 Ga0207664_10092075
673 Ga0207664_10229258
674 Ga0207644_10063747
675 Ga0207644_10069153
676 Ga0207690_10445255
677 Ga0207706_10025382
678 Ga0207706_10060487
679 Ga0207706_10251367
680 Ga0207669_10035086
681 Ga0207669_10077806
682 Ga0207665_10311146
683 Ga0207691_10002909
684 Ga0207691_10031634
685 Ga0207691_10133086
686 Ga0207691_10237806
687 Ga0207711_10053072
688 Ga0207711_10077580
689 Ga0207711_10170740
690 Ga0207661_10030727
691 Ga0207679_10023666
692 Ga0207679_10068942
693 Ga0207667_10021702
694 Ga0207667_10091903
695 Ga0207667_10536223
696 Ga0207639_10036949
697 Ga0207639_10106802
698 Ga0207678_10067242
699 Ga0207708_10172812
700 Ga0207708_10265580
701 Ga0207702_10012962
702 Ga0207641_10235733
703 Ga0207641_10590945
704 Ga0207676_10350966
705 Ga0207674_10103904
706 Ga0207674_10158786
707 Ga0207675_100019019
708 Ga0207675_100475781
709 Ga0207683_10034139
710 Ga0207683_10064731
711 Ga0265354_1000204
712 Ga0265354_1002794
713 Ga0268266_10487030
714 Ga0268265_10001657
715 Ga0268265_10398183
716 Ga0265337_1001242
717 Ga0265337_1001411
718 Ga0265319_1000049
719 Ga0265319_1002169
720 Ga0265319_1006393
721 Ga0265319_1019946
722 Ga0265334_10004826
723 Ga0265334_10016767
724 Ga0265318_10000700
725 Ga0265318_10010490
726 Ga0265318_10015260
727 Ga0265318_10026913
728 Ga0265323_10007817
729 Ga0265336_10000152
730 Ga0265336_10010870
731 Ga0265336_10044361
732 Ga0265338_10000295
733 Ga0265338_10011076
734 Ga0265338_10026966
735 Ga0265338_10030547
736 Ga0265338_10061675
737 Ga0265338_10128318
738 Ga0265770_1001598
739 Ga0265770_1002623
740 Ga0265765_1000070
741 Ga0265760_10002054
742 Ga0265330_10017956
743 Ga0265330_10029552
744 Ga0265330_10114819
745 Ga0265332_10032144
746 Ga0265320_10001189
747 Ga0265320_10003608
748 Ga0265320_10006720
749 Ga0265325_10004437
750 Ga0265340_10000498
751 Ga0265340_10004463
752 Ga0265339_10028928
753 Ga0265339_10043427
754 Ga0265331_10002016
755 Ga0265331_10023223
756 Ga0265327_10000664
757 Ga0265327_10010624
758 Ga0265316_10003240
759 Ga0265316_10057115
760 Ga0265316_10075199
761 Ga0307513_10002376
762 Ga0307509_10023602
763 Ga0265313_10000194
764 Ga0265313_10004999
765 Ga0265313_10010331
766 Ga0307508_10000024
767 Ga0307508_10160607
768 Ga0265314_10000155
769 Ga0265314_10005846
770 Ga0265314_10034515
771 Ga0265314_10100371
772 Ga0265342_10001148
773 Ga0265342_10001239
774 Ga0265342_10003506
775 Ga0265342_10012007
776 Ga0307405_10168029
777 Ga0307410_10097998
778 Ga0307410_10355944
779 Ga0307409_100009651
780 Ga0316212_1003450
781 Ga0316212_1006754
782 Ga0395900_0005956
783 Ga0395905_0004391
784 Ga0395901_0224223
785 Ga0436365_0021158
786 Ga0436365_0668515
787 Ga0436360_0466019
788 Ga0451835_0225738
789 Ga0439448_0006146
790 Ga0450923_001098
791 Ga0439458_0001410
792 Ga0439458_0007833
793 Ga0450908_008803
794 Ga0451577_0379610
795 Ga0453683_0097209
796 Ga0453684_0075446
797 Ga0453684_0160288
798 Ga0466957_0002578
799 Ga0495617_000071
800 Ga0495617_000222
801 Ga0495617_005121
802 Ga0495627_000009
803 Ga0495627_000061
804 Ga0495627_016901
805 Ga0495629_0000004
806 Ga0495638_0000041
807 Ga0495653_0001498
808 Ga0495605_0001783
809 Ga0495584_0073497
810 Ga0495585_0000008
811 Ga0495585_0004882
812 Ga0495596_0006660
813 Ga0495596_0008646
814 Ga0495596_0013409
815 Ga0495596_0023485
816 Ga0495596_0024862
817 Ga0495607_0000141
818 Ga0495583_0007890
819 Ga0495583_0044374
820 Ga0495583_0057354
821 Ga0495608_0082188
822 Ga0495616_0000437
823 Ga0495616_0002646
824 Ga0495616_0012680
825 Ga0495616_0041674
826 Ga0495616_0071370
827 Ga0495620_0000008
828 Ga0495631_0000001
829 Ga0495631_0013770
830 Ga0495631_0020869
831 Ga0495637_0001775
832 Ga0495643_0004398
833 Ga0495644_0009604
834 Ga0495648_0000416
835 Ga0495648_0003340
836 Ga0495648_0021361
837 Ga0495642_0002765
838 Ga0495642_0028516
839 Ga0495642_0037178
840 Ga0495654_0000431
841 Ga0495654_0019804
842 Ga0495609_0009729
843 Ga0495609_0015193
844 Ga0495597_0000171
845 Ga0495597_0007594
846 Ga0495597_0043853
847 Ga0495668_0000105
848 Ga0495668_0007265
849 Ga0495668_0010213
850 Ga0495611_0000002
851 Ga0495611_0064069
852 Ga0495625_0000002
853 Ga0495625_0143027
854 Ga0495635_0032110
855 Ga0495635_0240531
856 Ga0495661_0000184
857 Ga0495661_0003786
858 Ga0495661_0037590
859 Ga0495657_0016395
860 Ga0495669_0000070
861 Ga0495613_0011135
862 Ga0495670_0006141
863 Ga0495671_0000598
864 Ga0495671_0001284
865 Ga0495649_0000670
866 Ga0495649_0023370
867 Ga0495649_0066849
868 Ga0495589_0000111
869 Ga0495589_0011125
870 Ga0495589_0011559
871 Ga0495589_0138711
872 Ga0495660_0000232
873 Ga0495660_0000265
874 Ga0495604_0025284
875 Ga0495636_0129789
876 Ga0495672_0003357
877 Ga0495672_0032613
878 Ga0495680_0013108
879 Ga0495683_0002439
880 Ga0495687_009903
881 Ga0495675_0011049
882 Ga0495677_0013203
883 Ga0495679_000003
884 Ga0495673_0000004
885 Ga0495673_0000144
886 Ga0495673_0000283
887 Ga0495681_0047267
888 Ga0495686_0009889
889 Ga0495593_0002661
890 Ga0495626_0014768
891 Ga0495626_0046425
892 Ga0496100_0002604
893 Ga0496101_0000522
894 Ga0496101_0072951
895 Ga0496102_0002925
896 Ga0496102_0367182
897 Ga0496103_0191557
898 Ga0496104_0022010
899 Ga0496104_0410031
900 Ga0496105_0026956
901 Ga0496106_0002996
902 Ga0496109_0053614
903 Ga0496110_0004185
904 Ga0496110_0350565
905 Ga0496114_0317048
906 Ga0496115_0029156
907 Ga0496117_0094767
908 Ga0496118_0001577
909 Ga0496118_0103336
910 Ga0496119_0000030
911 Ga0496120_0000033
912 Ga0496121_0000770
913 Ga0496121_0064177
914 Ga0496121_0149655
915 Ga0496123_0028091
916 Ga0496124_0039306
917 Ga0496125_0106733
918 Ga0496126_0002567
919 Ga0496126_0183774
920 Ga0495678_000019
921 Ga0495678_000216
922 Ga0495678_000239
923 Ga0495682_0000353
924 Ga0495682_0002475
925 Ga0495682_0009352
926 Ga0501298_026570
927 Ga0501032_0004804
928 Ga0501033_0024632
929 Ga0501034_0400340
930 Ga0501036_0067658
931 Ga0501037_0043934
932 Ga0501039_0006776
933 Ga0501039_0051088
934 Ga0501043_0046824
935 Ga0501046_0015215
936 Ga0501046_0151159
937 Ga0501047_0001017
938 Ga0501047_0166624
939 Ga0501048_0061125
940 Ga0501067_0021813
941 Ga0501069_0001577
942 Ga0501071_0046749
943 Ga0501072_0028524
944 Ga0501073_0008880
945 Ga0501074_0047083
946 Ga0501075_0027124
947 Ga0501076_0019111
948 Ga0501077_0320158
949 Ga0501235_026120
950 Ga0501249_019261
951 Ga0501257_010052
952 Ga0501079_0101230
953 Ga0501080_0051066
954 Ga0501083_0197767
955 Ga0501270_002077
956 Ga0501035_0084285
957 Ga0501035_0088337
958 Ga0501044_0151657
959 Ga0501044_0427674
960 Ga0501045_0002695
961 Ga0501045_0159646
962 nmdc:mga00v17_26131_c1
963 nmdc:mga00v17_320307_c1
964 nmdc:mga0k408_1942_c2
965 nmdc:mga0k408_53855_c1
966 nmdc:mga06z11_12644_c1
967 nmdc:mga06z11_16692_c1
968 nmdc:mga05p37_203620_c1
969 nmdc:mga05p37_46946_c1
970 nmdc:mga0n895_107040_c1
971 nmdc:mga0n895_12041_c1
972 nmdc:mga0n895_157058_c1
973 nmdc:mga08x19_55690_c1
974 nmdc:mga0a205_327602_c1
975 nmdc:mga0sz30_15095_c1
976 Ga0500635_0000980
977 Ga0500578_0007622
978 Ga0500643_000054
979 Ga0500555_000063
980 Ga0500555_032917
981 Ga0500556_0000888
982 Ga0500556_0052639
983 Ga0500594_0028618
984 Ga0500608_000089
985 Ga0500573_0006375
986 Ga0500577_0004937
987 Ga0500622_0002781
988 Ga0500645_000484
989 Ga0500645_000778
990 Ga0500609_003452
991 Ga0501082_0013160
992 2524533010
993 2585846372
994 2721025428
995 2738695318
996 2739606288
997 2760306899
998 2838043521
999 2842511697
1000 2857507235
1001 2884961922
1002 2900053152
1003 2904560303
1004 2906612458
1005 2922433010
1006 2935632997
1007 2941509701
1008 2941517530
1009 2941526517
1010 8006937325
1011 8006977356
1012 8019571388
1013 8024490004
1014 8056534226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

65

357

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9285 1 311
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9151 1 320
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9126 3 305
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.9103 1 308
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9073 2 309
ID Description Score Start End Superfamily
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9544 14 327 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9351 2 256 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9351 73 327 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.933 1 329 3.20.20.100
af_O14295_4_331_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9246 12 327 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A7X1W0Z7-F1-model_v4 deleted 0.9888 1 329
AF-A0A7X1W0Z7-F1-model_v4 deleted 0.9858 1 329
AF-Q0JE28-F1-model_v4 Os04g0338100 protein 0.9843 104 187
AF-A0A3L9ZL30-F1-model_v4 deleted 0.9832 1 329
AF-F0BI19-F1-model_v4 Putative oxidoreductase, aryl-alcohol dehydrogenase like protein 0.9829 1 329 GO:0004033
GO:0005737

Map