F456777

General Info

Members Datasets Scaffolds Average Seq Length
508 264 1016 148

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100001215|Ga0070668_10000121510
Length 157
Sequence VAVFLALILGSLAARVLGWLGVDYVDGWPQAIAVGLAVMFTMTGVAHFVGLRRDMIAIVPPRLTAFPSLRSPQSAAAQLVTITGVLELLGAVGLLYPPTRVAAAVCLFLLMLVMFPANVHAARMPNPPKSMTSRLSVRTAEEVVYLAAAVVVAVCGG

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
257 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
258 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
259 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
263 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
264 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 0
Rhizoplane 13.78
Rhizosphere 71.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100001215 3300005347 Bacteria 18315
2 JGI24737J22298_10016806 3300001990 Bacteria 2362
3 JGI24737J22298_10156225 3300001990 Bacteria 673
4 JGI24748J21848_1019003 3300002074 Bacteria 825
5 JGI24749J21850_1007195 3300002076 Bacteria 1547
6 JGI24744J21845_10000674 3300002077 Bacteria 6251
7 JGI24742J22300_10004633 3300002244 Bacteria 2255
8 JGI24742J22300_10050522 3300002244 Bacteria 752
9 Ga0055540_1000071 3300003792 Bacteria 117607
10 Ga0070658_11361510 3300005327 Bacteria 616
11 Ga0070676_10036315 3300005328 Bacteria 2839
12 Ga0070676_10646592 3300005328 Bacteria 767
13 Ga0070690_100024161 3300005330 Bacteria 3737
14 Ga0070690_100603122 3300005330 Bacteria 834
15 Ga0070670_101264812 3300005331 Bacteria 675
16 Ga0070677_10178095 3300005333 Bacteria 1010
17 Ga0068869_100023810 3300005334 Bacteria 4236
18 Ga0070666_10263507 3300005335 Bacteria 1222
19 Ga0070666_10305156 3300005335 Bacteria 1134
20 Ga0070680_100447773 3300005336 Bacteria 1103
21 Ga0070682_100024647 3300005337 Bacteria 3583
22 Ga0070682_101237422 3300005337 Bacteria 632
23 Ga0068868_100000247 3300005338 Bacteria 36780
24 Ga0068868_100179581 3300005338 Bacteria 1755
25 Ga0068868_100505195 3300005338 Bacteria 1059
26 Ga0070660_100682958 3300005339 Bacteria 860
27 Ga0070660_101580061 3300005339 Bacteria 558
28 Ga0070689_100227933 3300005340 Bacteria 1531
29 Ga0070691_10013420 3300005341 Bacteria 3751
30 Ga0070691_10131087 3300005341 Bacteria 1271
31 Ga0070692_10047773 3300005345 Bacteria 2216
32 Ga0070668_100006741 3300005347 Bacteria 8511
33 Ga0070668_100069955 3300005347 Bacteria 2731
34 Ga0070669_100021840 3300005353 Bacteria 4577
35 Ga0070669_100058808 3300005353 Bacteria 2822
36 Ga0070675_100240857 3300005354 Bacteria 1581
37 Ga0070675_100432885 3300005354 Bacteria 1178
38 Ga0070671_100000923 3300005355 Bacteria 21454
39 Ga0070671_100196755 3300005355 Bacteria 1709
40 Ga0070671_100366597 3300005355 Bacteria 1230
41 Ga0070674_100001479 3300005356 Bacteria 12527
42 Ga0070674_100017589 3300005356 Bacteria 4502
43 Ga0070674_100165420 3300005356 Bacteria 1682
44 Ga0070673_100157963 3300005364 Bacteria 1926
45 Ga0070673_100313676 3300005364 Bacteria 1384
46 Ga0070688_100072806 3300005365 Bacteria 2202
47 Ga0070688_100235844 3300005365 Bacteria 1296
48 Ga0070659_100030907 3300005366 Bacteria 4146
49 Ga0070659_100043264 3300005366 Bacteria 3522
50 Ga0070667_100001027 3300005367 Bacteria 25488
51 Ga0070667_100008266 3300005367 Bacteria 8624
52 Ga0070667_100034855 3300005367 Bacteria 4213
53 Ga0070667_100117804 3300005367 Bacteria 2307
54 Ga0070667_100245847 3300005367 Bacteria 1598
55 Ga0070667_100424183 3300005367 Bacteria 1213
56 Ga0070709_10032032 3300005434 Bacteria 3167
57 Ga0070709_10148882 3300005434 Bacteria 1616
58 Ga0070714_100245103 3300005435 Bacteria 1655
59 Ga0070714_100864764 3300005435 Bacteria 877
60 Ga0070713_100244547 3300005436 Bacteria 1635
61 Ga0070710_10021801 3300005437 Bacteria 3344
62 Ga0070710_10061626 3300005437 Bacteria 2137
63 Ga0070701_10000386 3300005438 Bacteria 14839
64 Ga0070711_100051705 3300005439 Bacteria 2823
65 Ga0070711_100065413 3300005439 Bacteria 2543
66 Ga0070705_100005612 3300005440 Bacteria 6123
67 Ga0070705_100171216 3300005440 Bacteria 1462
68 Ga0070700_100002202 3300005441 Bacteria 9906
69 Ga0070700_101600282 3300005441 Bacteria 556
70 Ga0070694_100014961 3300005444 Bacteria 4861
71 Ga0070694_101632292 3300005444 Bacteria 547
72 Ga0070663_100088531 3300005455 Bacteria 2289
73 Ga0070678_100016997 3300005456 Bacteria 4670
74 Ga0070678_100023341 3300005456 Bacteria 4121
75 Ga0070678_100042484 3300005456 Bacteria 3231
76 Ga0070662_100019843 3300005457 Bacteria 4571
77 Ga0070662_100025252 3300005457 Bacteria 4101
78 Ga0068867_100018261 3300005459 Bacteria 4983
79 Ga0068867_100215706 3300005459 Bacteria 1544
80 Ga0070685_10126428 3300005466 Bacteria 1593
81 Ga0070697_100298024 3300005536 Bacteria 1386
82 Ga0068853_100001631 3300005539 Bacteria 16398
83 Ga0070672_100715821 3300005543 Bacteria 877
84 Ga0070695_100013704 3300005545 Bacteria 4874
85 Ga0070696_100009364 3300005546 Bacteria 6557
86 Ga0070696_100062644 3300005546 Bacteria 2604
87 Ga0070693_100045672 3300005547 Bacteria 2484
88 Ga0070693_100651690 3300005547 Bacteria 766
89 Ga0070665_100021205 3300005548 Bacteria 6532
90 Ga0070665_100110320 3300005548 Bacteria 2754
91 Ga0070704_100003757 3300005549 Bacteria 8741
92 Ga0070704_100490374 3300005549 Bacteria 1064
93 Ga0068855_100813899 3300005563 Bacteria 992
94 Ga0068854_100047088 3300005578 Bacteria 3072
95 Ga0068854_100061539 3300005578 Bacteria 2719
96 Ga0068856_100255300 3300005614 Bacteria 1768
97 Ga0068856_100334149 3300005614 Bacteria 1533
98 Ga0070702_100002393 3300005615 Bacteria 8076
99 Ga0070702_100195079 3300005615 Bacteria 1336
100 Ga0068852_100130102 3300005616 Bacteria 2317
101 Ga0068859_100002325 3300005617 Bacteria 19318
102 Ga0068864_100093578 3300005618 Bacteria 2655
103 Ga0068864_100370143 3300005618 Bacteria 1356
104 Ga0068866_10000253 3300005718 Bacteria 25012
105 Ga0068866_10066913 3300005718 Bacteria 1884
106 Ga0068866_10817983 3300005718 Bacteria 649
107 Ga0068861_100016600 3300005719 Bacteria 5212
108 Ga0068870_10211820 3300005840 Bacteria 1181
109 Ga0068863_100046189 3300005841 Bacteria 4133
110 Ga0068858_100002178 3300005842 Bacteria 19860
111 Ga0068858_100208351 3300005842 Bacteria 1850
112 Ga0068858_100438691 3300005842 Bacteria 1257
113 Ga0068860_100003457 3300005843 Bacteria 16245
114 Ga0068860_100236672 3300005843 Bacteria 1775
115 Ga0068862_100002241 3300005844 Bacteria 17329
116 Ga0068862_100365762 3300005844 Bacteria 1341
117 Ga0068862_100929649 3300005844 Bacteria 856
118 Ga0081455_10091834 3300005937 Bacteria 2458
119 Ga0081455_10563594 3300005937 Bacteria 750
120 Ga0081538_10090558 3300005981 Bacteria 1583
121 Ga0075365_10055957 3300006038 Bacteria 2621
122 Ga0075363_100022236 3300006048 Bacteria 3205
123 Ga0075363_100057782 3300006048 Bacteria 2083
124 Ga0075363_100079942 3300006048 Bacteria 1787
125 Ga0075364_10003555 3300006051 Bacteria 8873
126 Ga0075364_10005466 3300006051 Bacteria 7386
127 Ga0075364_10135421 3300006051 Bacteria 1655
128 Ga0075364_10637562 3300006051 Bacteria 728
129 Ga0070715_10281763 3300006163 Bacteria 882
130 Ga0070716_100006495 3300006173 Bacteria 5714
131 Ga0070716_100009985 3300006173 Bacteria 4748
132 Ga0070716_100258567 3300006173 Bacteria 1190
133 Ga0070716_100992377 3300006173 Bacteria 663
134 Ga0070712_100000630 3300006175 Bacteria 20763
135 Ga0070712_100010036 3300006175 Bacteria 5969
136 Ga0070712_101614281 3300006175 Bacteria 567
137 Ga0075362_10019583 3300006177 Bacteria 2817
138 Ga0075362_10235503 3300006177 Bacteria 898
139 Ga0075367_10012728 3300006178 Bacteria 4499
140 Ga0075367_10345022 3300006178 Bacteria 939
141 Ga0075369_10000029 3300006186 Bacteria 39213
142 Ga0075369_10015259 3300006186 Bacteria 3081
143 Ga0075369_10036929 3300006186 Bacteria 2080
144 Ga0075369_10190104 3300006186 Bacteria 946
145 Ga0075369_10191084 3300006186 Bacteria 943
146 Ga0075369_10477380 3300006186 Bacteria 591
147 Ga0097621_100021985 3300006237 Bacteria 4944
148 Ga0075370_10008923 3300006353 Bacteria 5181
149 Ga0075370_10015782 3300006353 Bacteria 4052
150 Ga0075370_10098182 3300006353 Bacteria 1694
151 Ga0075370_10257082 3300006353 Bacteria 1035
152 Ga0068871_100030788 3300006358 Bacteria 4229
153 Ga0075428_100015186 3300006844 Bacteria 8542
154 Ga0075430_100724652 3300006846 Bacteria 820
155 Ga0075429_100324619 3300006880 Bacteria 1347
156 Ga0068865_100007152 3300006881 Bacteria 6855
157 Ga0068865_100090975 3300006881 Bacteria 2213
158 Ga0097620_100002325 3300006931 Bacteria 19318
159 Ga0099795_10012778 3300007788 Bacteria 2557
160 Ga0105244_10204052 3300009036 Bacteria 931
161 Ga0105250_10146712 3300009092 Bacteria 980
162 Ga0111539_12878148 3300009094 Bacteria 557
163 Ga0105245_10066244 3300009098 Bacteria 3269
164 Ga0105245_10216136 3300009098 Bacteria 1847
165 Ga0105247_10001591 3300009101 Bacteria 16075
166 Ga0105247_10005195 3300009101 Bacteria 8231
167 Ga0114129_10034110 3300009147 Bacteria 7189
168 Ga0105243_10006202 3300009148 Bacteria 9246
169 Ga0105243_10342278 3300009148 Bacteria 1370
170 Ga0105241_10276486 3300009174 Bacteria 1432
171 Ga0105241_11541981 3300009174 Bacteria 641
172 Ga0105242_10115844 3300009176 Bacteria 2292
173 Ga0105242_10206466 3300009176 Bacteria 1747
174 Ga0105242_10236828 3300009176 Bacteria 1639
175 Ga0105248_10068663 3300009177 Bacteria 3979
176 Ga0105248_10354013 3300009177 Bacteria 1653
177 Ga0105237_10245929 3300009545 Bacteria 1790
178 Ga0105238_10877921 3300009551 Bacteria 915
179 Ga0105238_10961875 3300009551 Bacteria 874
180 Ga0105249_10009395 3300009553 Bacteria 8556
181 Ga0105249_10127628 3300009553 Bacteria 2424
182 Ga0099796_10026567 3300010159 Bacteria 1840
183 Ga0105239_10074509 3300010375 Bacteria 3732
184 Ga0105239_10132642 3300010375 Bacteria 2772
185 Ga0105239_12356619 3300010375 Bacteria 620
186 Ga0105246_10139703 3300011119 Bacteria 1820
187 Ga0157369_10511166 3300013105 Bacteria 1243
188 Ga0157374_10007942 3300013296 Bacteria 9063
189 Ga0157378_10002404 3300013297 Bacteria 16640
190 Ga0157378_10021567 3300013297 Bacteria 5665
191 Ga0163162_10071198 3300013306 Bacteria 3530
192 Ga0163162_10354110 3300013306 Bacteria 1601
193 Ga0163162_10364639 3300013306 Bacteria 1578
194 Ga0163162_10676146 3300013306 Bacteria 1155
195 Ga0163162_11680404 3300013306 Bacteria 725
196 Ga0157372_10000917 3300013307 Bacteria 32072
197 Ga0157372_10316922 3300013307 Bacteria 1816
198 Ga0157372_11508368 3300013307 Bacteria 774
199 Ga0157375_10000573 3300013308 Bacteria 32942
200 Ga0157375_10213928 3300013308 Bacteria 2085
201 Ga0157375_11042908 3300013308 Bacteria 956
202 Ga0163163_10146429 3300014325 Bacteria 2406
203 Ga0157380_10001337 3300014326 Bacteria 16040
204 Ga0157377_10020243 3300014745 Bacteria 3484
205 Ga0157377_10739704 3300014745 Bacteria 718
206 Ga0157379_10070948 3300014968 Bacteria 3117
207 Ga0157379_10897774 3300014968 Bacteria 840
208 Ga0163161_10009207 3300017792 Bacteria 6828
209 Ga0213874_10152899 3300021377 Bacteria 806
210 Ga0213875_10043805 3300021388 Bacteria 2101
211 Ga0209051_1000033 3300025303 Bacteria 380540
212 Ga0207692_10005720 3300025898 Bacteria 4998
213 Ga0207642_10000191 3300025899 Bacteria 17844
214 Ga0207710_10000350 3300025900 Bacteria 33273
215 Ga0207710_10114174 3300025900 Bacteria 1285
216 Ga0207688_10003159 3300025901 Bacteria 8988
217 Ga0207688_10018131 3300025901 Bacteria 3832
218 Ga0207680_10108401 3300025903 Bacteria 1797
219 Ga0207647_10018984 3300025904 Bacteria 4632
220 Ga0207685_10557688 3300025905 Bacteria 610
221 Ga0207699_10316062 3300025906 Bacteria 1094
222 Ga0207645_10027579 3300025907 Bacteria 3666
223 Ga0207654_10109669 3300025911 Bacteria 1715
224 Ga0207671_10009509 3300025914 Bacteria 8120
225 Ga0207671_10012463 3300025914 Bacteria 6832
226 Ga0207671_10284010 3300025914 Bacteria 1306
227 Ga0207693_10000197 3300025915 Bacteria 54675
228 Ga0207693_10000771 3300025915 Bacteria 28766
229 Ga0207663_10001796 3300025916 Bacteria 10120
230 Ga0207663_10681348 3300025916 Bacteria 813
231 Ga0207660_10398870 3300025917 Bacteria 1108
232 Ga0207662_10078524 3300025918 Bacteria 2009
233 Ga0207657_10589267 3300025919 Bacteria 868
234 Ga0207657_10815887 3300025919 Bacteria 721
235 Ga0207681_10016662 3300025923 Bacteria 4602
236 Ga0207681_10418358 3300025923 Bacteria 1085
237 Ga0207694_10213606 3300025924 Bacteria 1572
238 Ga0207650_11459225 3300025925 Bacteria 582
239 Ga0207659_10639893 3300025926 Bacteria 908
240 Ga0207687_10031639 3300025927 Bacteria 3577
241 Ga0207687_10052833 3300025927 Bacteria 2837
242 Ga0207700_10060412 3300025928 Bacteria 2871
243 Ga0207664_10202157 3300025929 Bacteria 1715
244 Ga0207644_10043133 3300025931 Bacteria 3200
245 Ga0207690_10052314 3300025932 Bacteria 2735
246 Ga0207690_10060667 3300025932 Bacteria 2568
247 Ga0207690_10451831 3300025932 Bacteria 1033
248 Ga0207706_10013062 3300025933 Bacteria 7557
249 Ga0207706_10082911 3300025933 Bacteria 2818
250 Ga0207706_10257455 3300025933 Bacteria 1524
251 Ga0207686_10015647 3300025934 Bacteria 4244
252 Ga0207686_10107347 3300025934 Bacteria 1876
253 Ga0207709_10087674 3300025935 Bacteria 2024
254 Ga0207670_10489567 3300025936 Bacteria 997
255 Ga0207669_10004626 3300025937 Bacteria 6076
256 Ga0207669_10072386 3300025937 Bacteria 2170
257 Ga0207669_10188523 3300025937 Bacteria 1485
258 Ga0207704_10000448 3300025938 Bacteria 18392
259 Ga0207704_10347074 3300025938 Bacteria 1154
260 Ga0207665_10002506 3300025939 Bacteria 12363
261 Ga0207665_10008287 3300025939 Bacteria 6862
262 Ga0207665_10272169 3300025939 Bacteria 1258
263 Ga0207691_10871353 3300025940 Bacteria 755
264 Ga0207711_10048064 3300025941 Bacteria 3650
265 Ga0207689_10009089 3300025942 Bacteria 8603
266 Ga0207689_10069905 3300025942 Bacteria 2884
267 Ga0207651_10236280 3300025960 Bacteria 1487
268 Ga0207712_10010767 3300025961 Bacteria 5814
269 Ga0207668_10000838 3300025972 Bacteria 18580
270 Ga0207668_10001862 3300025972 Bacteria 12311
271 Ga0207668_10274731 3300025972 Bacteria 1379
272 Ga0207640_10098742 3300025981 Bacteria 2042
273 Ga0207640_10100082 3300025981 Bacteria 2030
274 Ga0207640_11247068 3300025981 Bacteria 662
275 Ga0207658_10001213 3300025986 Bacteria 20454
276 Ga0207658_10002007 3300025986 Bacteria 15172
277 Ga0207658_10071799 3300025986 Bacteria 2622
278 Ga0207658_10109951 3300025986 Bacteria 2177
279 Ga0207658_10235327 3300025986 Bacteria 1548
280 Ga0207658_10675088 3300025986 Bacteria 932
281 Ga0207658_11514769 3300025986 Bacteria 613
282 Ga0207677_10019286 3300026023 Bacteria 4116
283 Ga0207677_10594702 3300026023 Bacteria 970
284 Ga0207677_10790527 3300026023 Bacteria 849
285 Ga0207703_10015904 3300026035 Bacteria 5868
286 Ga0207703_10089322 3300026035 Bacteria 2588
287 Ga0207703_10180753 3300026035 Bacteria 1861
288 Ga0207639_10058617 3300026041 Bacteria 2963
289 Ga0207639_10074378 3300026041 Bacteria 2668
290 Ga0207678_10059055 3300026067 Bacteria 3300
291 Ga0207708_10001480 3300026075 Bacteria 17558
292 Ga0207702_10248896 3300026078 Bacteria 1668
293 Ga0207702_10370856 3300026078 Bacteria 1374
294 Ga0207641_10192423 3300026088 Bacteria 1875
295 Ga0207648_10001458 3300026089 Bacteria 26029
296 Ga0207648_10037813 3300026089 Bacteria 4249
297 Ga0207648_11688872 3300026089 Bacteria 595
298 Ga0207676_10084097 3300026095 Bacteria 2593
299 Ga0207676_10344490 3300026095 Bacteria 1376
300 Ga0207676_10462783 3300026095 Bacteria 1198
301 Ga0207675_100063273 3300026118 Bacteria 3457
302 Ga0207675_100213826 3300026118 Bacteria 1855
303 Ga0207675_100260165 3300026118 Bacteria 1681
304 Ga0207675_100376170 3300026118 Bacteria 1396
305 Ga0207675_100391813 3300026118 Bacteria 1368
306 Ga0207683_10000996 3300026121 Bacteria 25929
307 Ga0207683_10433097 3300026121 Bacteria 1212
308 Ga0207683_10563504 3300026121 Bacteria 1054
309 Ga0207683_10768056 3300026121 Bacteria 894
310 Ga0207698_10026087 3300026142 Bacteria 4129
311 Ga0207698_10131720 3300026142 Bacteria 2138
312 Ga0268266_10022186 3300028379 Bacteria 5411
313 Ga0268266_10417580 3300028379 Bacteria 1271
314 Ga0268266_10521734 3300028379 Bacteria 1136
315 Ga0268265_10008991 3300028380 Bacteria 6757
316 Ga0268264_10068754 3300028381 Bacteria 2994
317 Ga0268264_10408112 3300028381 Bacteria 1307
318 Ga0265327_10005208 3300031251 Bacteria 10976
319 Ga0307410_10295331 3300031852 Bacteria 1277
320 Ga0307406_11029208 3300031901 Bacteria 708
321 Ga0307409_100082903 3300031995 Bacteria 2598
322 Ga0307416_100368465 3300032002 Bacteria 1462
323 Ga0307411_10603242 3300032005 Bacteria 944
324 Ga0307415_100408280 3300032126 Bacteria 1162
325 Ga0373961_0046243 3300035241 Bacteria 1275
326 Ga0373962_0169569 3300035242 Bacteria 724
327 Ga0373931_0013996 3300035691 Bacteria 3915
328 Ga0373931_0121866 3300035691 Bacteria 1491
329 Ga0436364_0043290 3300037853 Bacteria 14356
330 Ga0436365_0328142 3300039437 Bacteria 1426
331 Ga0436365_0678783 3300039437 Bacteria 6908
332 Ga0436363_0132291 3300039450 Bacteria 2319
333 Ga0436363_0674883 3300039450 Bacteria 790
334 Ga0436363_1195077 3300039450 Bacteria 835
335 Ga0436363_1659400 3300039450 Bacteria 1375
336 Ga0439461_0006924 3300041410 Bacteria 1990
337 Ga0439461_0058129 3300041410 Bacteria 873
338 Ga0439466_0019022 3300041411 Bacteria 2460
339 Ga0439466_0071055 3300041411 Bacteria 1108
340 Ga0439465_0018953 3300041413 Bacteria 2151
341 Ga0439465_0062290 3300041413 Bacteria 1237
342 Ga0439442_005512 3300042002 Bacteria 2530
343 Ga0439448_0149259 3300042005 Bacteria 811
344 Ga0439459_0005617 3300042438 Bacteria 2068
345 Ga0439460_0124021 3300042461 Bacteria 847
346 Ga0466972_0013402 3300044658 Bacteria 4116
347 Ga0466972_0016283 3300044658 Bacteria 3715
348 Ga0466972_0029543 3300044658 Bacteria 2699
349 Ga0466972_0042393 3300044658 Bacteria 2213
350 Ga0466972_0088801 3300044658 Bacteria 1467
351 Ga0466972_0162995 3300044658 Bacteria 1047
352 Ga0466965_0005462 3300044683 Bacteria 5730
353 Ga0466965_0018385 3300044683 Bacteria 3350
354 Ga0466965_0022542 3300044683 Bacteria 3036
355 Ga0466966_0462602 3300044684 Bacteria 763
356 Ga0466961_0136726 3300044693 Bacteria 1535
357 Ga0466971_0137269 3300044719 Bacteria 1138
358 Ga0466968_0014027 3300044735 Bacteria 3161
359 Ga0466968_0026654 3300044735 Bacteria 2374
360 Ga0466970_0082898 3300044765 Bacteria 1734
361 Ga0466970_0136593 3300044765 Bacteria 1349
362 Ga0466970_0175638 3300044765 Bacteria 1188
363 Ga0466957_0006105 3300044842 Bacteria 6801
364 Ga0466957_0073041 3300044842 Bacteria 2125
365 Ga0466960_0000170 3300044901 Bacteria 22220
366 Ga0466960_0034568 3300044901 Bacteria 2356
367 Ga0466959_0088750 3300045049 Bacteria 2222
368 Ga0466959_0316354 3300045049 Bacteria 1067
369 Ga0466958_0566973 3300045836 Bacteria 738
370 Ga0466967_0024083 3300045976 Bacteria 4999
371 Ga0466967_0322684 3300045976 Bacteria 1489
372 Ga0466967_0488815 3300045976 Bacteria 1207
373 Ga0466967_0693131 3300045976 Bacteria 1009
374 Ga0466967_1372485 3300045976 Bacteria 704
375 Ga0495672_0122675 3300047320 Bacteria 1379
376 Ga0495626_0062922 3300048091 Bacteria 1684
377 Ga0495626_0233254 3300048091 Bacteria 743
378 Ga0496100_0000029 3300048903 Bacteria 110710
379 Ga0496100_0000780 3300048903 Bacteria 15181
380 Ga0496100_0001560 3300048903 Bacteria 11268
381 Ga0496100_0002719 3300048903 Bacteria 9042
382 Ga0496100_0217054 3300048903 Bacteria 1402
383 Ga0496100_0354266 3300048903 Bacteria 1109
384 Ga0496101_0000015 3300048904 Bacteria 252368
385 Ga0496101_0000031 3300048904 Bacteria 195195
386 Ga0496101_0000717 3300048904 Bacteria 19800
387 Ga0496101_0015234 3300048904 Bacteria 5176
388 Ga0496101_0051263 3300048904 Bacteria 2973
389 Ga0496101_0359762 3300048904 Bacteria 1144
390 Ga0496102_0000065 3300048905 Bacteria 161370
391 Ga0496102_0002030 3300048905 Bacteria 17497
392 Ga0496102_0005978 3300048905 Bacteria 10367
393 Ga0496102_0016754 3300048905 Bacteria 6408
394 Ga0496102_0028265 3300048905 Bacteria 5008
395 Ga0496102_0055426 3300048905 Bacteria 3615
396 Ga0496102_0126813 3300048905 Bacteria 2386
397 Ga0496102_0206799 3300048905 Bacteria 1850
398 Ga0496102_0332152 3300048905 Bacteria 1432
399 Ga0496102_0756219 3300048905 Bacteria 895
400 Ga0496103_0000048 3300048906 Bacteria 160911
401 Ga0496103_0003067 3300048906 Bacteria 10268
402 Ga0496103_0005902 3300048906 Bacteria 7318
403 Ga0496103_0086929 3300048906 Bacteria 1970
404 Ga0496103_0163170 3300048906 Bacteria 1429
405 Ga0496103_0215673 3300048906 Bacteria 1234
406 Ga0496104_0001343 3300048907 Bacteria 21285
407 Ga0496104_0015016 3300048907 Bacteria 7006
408 Ga0496105_0006560 3300048908 Bacteria 8952
409 Ga0496105_0068811 3300048908 Bacteria 2925
410 Ga0496106_0000396 3300048909 Bacteria 31087
411 Ga0496106_0001046 3300048909 Bacteria 20352
412 Ga0496106_0018223 3300048909 Bacteria 5191
413 Ga0496106_0029597 3300048909 Bacteria 4082
414 Ga0496106_0131472 3300048909 Bacteria 1963
415 Ga0496106_0415066 3300048909 Bacteria 1082
416 Ga0496107_0000330 3300048910 Bacteria 25647
417 Ga0496107_0015942 3300048910 Bacteria 5272
418 Ga0496107_0510722 3300048910 Bacteria 891
419 Ga0496107_0687917 3300048910 Bacteria 753
420 Ga0496107_0857246 3300048910 Bacteria 663
421 Ga0496108_0001084 3300048911 Bacteria 21234
422 Ga0496108_0003464 3300048911 Bacteria 12661
423 Ga0496108_0183044 3300048911 Bacteria 1815
424 Ga0496108_0567034 3300048911 Bacteria 990
425 Ga0496109_0000134 3300048912 Bacteria 75662
426 Ga0496109_0004328 3300048912 Bacteria 11860
427 Ga0496109_0098560 3300048912 Bacteria 2709
428 Ga0496109_0191298 3300048912 Bacteria 1923
429 Ga0496109_0241209 3300048912 Bacteria 1701
430 Ga0496109_0277222 3300048912 Bacteria 1580
431 Ga0496109_2057016 3300048912 Bacteria 503
432 Ga0496110_0162051 3300048913 Bacteria 2028
433 Ga0496110_0927615 3300048913 Bacteria 777
434 Ga0496111_0057283 3300048914 Bacteria 2821
435 Ga0496111_0876370 3300048914 Bacteria 647
436 Ga0496112_0027671 3300048915 Bacteria 5468
437 Ga0496112_0034944 3300048915 Bacteria 4892
438 Ga0496112_0256411 3300048915 Bacteria 1699
439 Ga0496112_1138798 3300048915 Bacteria 698
440 Ga0496113_0453149 3300048916 Bacteria 1031
441 Ga0496114_0001231 3300048917 Bacteria 19347
442 Ga0496114_0004867 3300048917 Bacteria 10462
443 Ga0496114_0006256 3300048917 Bacteria 9372
444 Ga0496114_0151301 3300048917 Bacteria 2013
445 Ga0496115_0002005 3300048918 Bacteria 14559
446 Ga0496115_0003450 3300048918 Bacteria 11356
447 Ga0496115_0018149 3300048918 Bacteria 5395
448 Ga0496116_0000125 3300048919 Bacteria 160885
449 Ga0496116_0019255 3300048919 Bacteria 5230
450 Ga0496117_0000111 3300048920 Bacteria 184570
451 Ga0496117_0063747 3300048920 Bacteria 2517
452 Ga0496118_0000083 3300048921 Bacteria 184570
453 Ga0496118_0076671 3300048921 Bacteria 2375
454 Ga0496118_0597146 3300048921 Bacteria 529
455 Ga0496119_0003439 3300048922 Bacteria 16441
456 Ga0496119_0044961 3300048922 Bacteria 2773
457 Ga0496120_0034219 3300048923 Bacteria 3046
458 Ga0496120_0083249 3300048923 Bacteria 1727
459 Ga0496121_0000004 3300048924 Bacteria 1139011
460 Ga0496121_0000728 3300048924 Bacteria 60874
461 Ga0496122_0000138 3300048925 Bacteria 169434
462 Ga0496123_0007235 3300048926 Bacteria 10535
463 Ga0496124_0000012 3300048927 Bacteria 512581
464 Ga0496125_0000003 3300048928 Bacteria 1189767
465 Ga0496126_0000001 3300048929 Bacteria 1139011
466 Ga0496126_0000220 3300048929 Bacteria 124547
467 Ga0501032_0012850 3300049569 Bacteria 5968
468 Ga0501033_0112936 3300049570 Bacteria 1976
469 Ga0501034_0398218 3300049571 Bacteria 1300
470 Ga0501034_0512153 3300049571 Bacteria 1112
471 Ga0501036_0001872 3300049572 Bacteria 16318
472 Ga0501037_0000401 3300049573 Bacteria 36095
473 Ga0501038_0007683 3300049574 Bacteria 9941
474 Ga0501039_0003187 3300049575 Bacteria 12267
475 Ga0501043_0001795 3300049579 Bacteria 18430
476 Ga0501070_0012220 3300049586 Bacteria 7244
477 Ga0501073_0152706 3300049589 Bacteria 1600
478 Ga0501080_1632875 3300049742 Bacteria 545
479 Ga0501035_0900134 3300049822 Bacteria 701
480 Ga0501044_0005938 3300049823 Bacteria 13523
481 Ga0501044_0198977 3300049823 Bacteria 1963
482 nmdc:mga03683_1900_c1 3300050489 Bacteria 5668
483 nmdc:mga03n38_43469_c1 3300050490 Bacteria 1969
484 nmdc:mga03n38_60501_c1 3300050490 Bacteria 1722
485 nmdc:mga03n38_78638_c1 3300050490 Bacteria 1544
486 nmdc:mga00v17_362393_c1 3300050491 Bacteria 942
487 nmdc:mga00v17_386393_c1 3300050491 Bacteria 910
488 nmdc:mga00v17_709_c1 3300050491 Bacteria 18242
489 nmdc:mga00v17_99628_c1 3300050491 Bacteria 1833
490 nmdc:mga0yw44_70180_c1 3300050492 Bacteria 2172
491 nmdc:mga06z11_20821_c1 3300050494 Bacteria 3037
492 nmdc:mga07m45_29176_c1 3300050496 Bacteria 3049
493 nmdc:mga09592_195442_c1 3300050508 Bacteria 1751
494 nmdc:mga0qj67_102738_c1 3300050509 Bacteria 2305
495 nmdc:mga0sz30_29439_c1 3300050516 Bacteria 2264
496 nmdc:mga0sz30_338_c1 3300050516 Bacteria 17911
497 nmdc:mga0sz30_60468_c1 3300050516 Bacteria 1618
498 Ga0500610_0030694 3300053079 Bacteria 2726
499 Ga0500635_0012370 3300053080 Bacteria 2449
500 Ga0500556_0002212 3300053104 Bacteria 6503
501 Ga0500562_001188 3300053108 Bacteria 6427
502 Ga0500593_222152 3300053117 Bacteria 663
503 Ga0500652_307546 3300053131 Bacteria 611
504 Ga0500577_0119976 3300053142 Bacteria 1094
505 Ga0500616_0034831 3300053153 Bacteria 2741
506 2738667360 2738541264 Bacteria 5935393
507 2739146203 2738541356 Bacteria 5935017
508 2939585137 2939582691 Bacteria 7088898
509 Ga0070668_100001215
510 JGI24737J22298_10016806
511 JGI24737J22298_10156225
512 JGI24748J21848_1019003
513 JGI24749J21850_1007195
514 JGI24744J21845_10000674
515 JGI24742J22300_10004633
516 JGI24742J22300_10050522
517 Ga0055540_1000071
518 Ga0070658_11361510
519 Ga0070676_10036315
520 Ga0070676_10646592
521 Ga0070690_100024161
522 Ga0070690_100603122
523 Ga0070670_101264812
524 Ga0070677_10178095
525 Ga0068869_100023810
526 Ga0070666_10263507
527 Ga0070666_10305156
528 Ga0070680_100447773
529 Ga0070682_100024647
530 Ga0070682_101237422
531 Ga0068868_100000247
532 Ga0068868_100179581
533 Ga0068868_100505195
534 Ga0070660_100682958
535 Ga0070660_101580061
536 Ga0070689_100227933
537 Ga0070691_10013420
538 Ga0070691_10131087
539 Ga0070692_10047773
540 Ga0070668_100006741
541 Ga0070668_100069955
542 Ga0070669_100021840
543 Ga0070669_100058808
544 Ga0070675_100240857
545 Ga0070675_100432885
546 Ga0070671_100000923
547 Ga0070671_100196755
548 Ga0070671_100366597
549 Ga0070674_100001479
550 Ga0070674_100017589
551 Ga0070674_100165420
552 Ga0070673_100157963
553 Ga0070673_100313676
554 Ga0070688_100072806
555 Ga0070688_100235844
556 Ga0070659_100030907
557 Ga0070659_100043264
558 Ga0070667_100001027
559 Ga0070667_100008266
560 Ga0070667_100034855
561 Ga0070667_100117804
562 Ga0070667_100245847
563 Ga0070667_100424183
564 Ga0070709_10032032
565 Ga0070709_10148882
566 Ga0070714_100245103
567 Ga0070714_100864764
568 Ga0070713_100244547
569 Ga0070710_10021801
570 Ga0070710_10061626
571 Ga0070701_10000386
572 Ga0070711_100051705
573 Ga0070711_100065413
574 Ga0070705_100005612
575 Ga0070705_100171216
576 Ga0070700_100002202
577 Ga0070700_101600282
578 Ga0070694_100014961
579 Ga0070694_101632292
580 Ga0070663_100088531
581 Ga0070678_100016997
582 Ga0070678_100023341
583 Ga0070678_100042484
584 Ga0070662_100019843
585 Ga0070662_100025252
586 Ga0068867_100018261
587 Ga0068867_100215706
588 Ga0070685_10126428
589 Ga0070697_100298024
590 Ga0068853_100001631
591 Ga0070672_100715821
592 Ga0070695_100013704
593 Ga0070696_100009364
594 Ga0070696_100062644
595 Ga0070693_100045672
596 Ga0070693_100651690
597 Ga0070665_100021205
598 Ga0070665_100110320
599 Ga0070704_100003757
600 Ga0070704_100490374
601 Ga0068855_100813899
602 Ga0068854_100047088
603 Ga0068854_100061539
604 Ga0068856_100255300
605 Ga0068856_100334149
606 Ga0070702_100002393
607 Ga0070702_100195079
608 Ga0068852_100130102
609 Ga0068859_100002325
610 Ga0068864_100093578
611 Ga0068864_100370143
612 Ga0068866_10000253
613 Ga0068866_10066913
614 Ga0068866_10817983
615 Ga0068861_100016600
616 Ga0068870_10211820
617 Ga0068863_100046189
618 Ga0068858_100002178
619 Ga0068858_100208351
620 Ga0068858_100438691
621 Ga0068860_100003457
622 Ga0068860_100236672
623 Ga0068862_100002241
624 Ga0068862_100365762
625 Ga0068862_100929649
626 Ga0081455_10091834
627 Ga0081455_10563594
628 Ga0081538_10090558
629 Ga0075365_10055957
630 Ga0075363_100022236
631 Ga0075363_100057782
632 Ga0075363_100079942
633 Ga0075364_10003555
634 Ga0075364_10005466
635 Ga0075364_10135421
636 Ga0075364_10637562
637 Ga0070715_10281763
638 Ga0070716_100006495
639 Ga0070716_100009985
640 Ga0070716_100258567
641 Ga0070716_100992377
642 Ga0070712_100000630
643 Ga0070712_100010036
644 Ga0070712_101614281
645 Ga0075362_10019583
646 Ga0075362_10235503
647 Ga0075367_10012728
648 Ga0075367_10345022
649 Ga0075369_10000029
650 Ga0075369_10015259
651 Ga0075369_10036929
652 Ga0075369_10190104
653 Ga0075369_10191084
654 Ga0075369_10477380
655 Ga0097621_100021985
656 Ga0075370_10008923
657 Ga0075370_10015782
658 Ga0075370_10098182
659 Ga0075370_10257082
660 Ga0068871_100030788
661 Ga0075428_100015186
662 Ga0075430_100724652
663 Ga0075429_100324619
664 Ga0068865_100007152
665 Ga0068865_100090975
666 Ga0097620_100002325
667 Ga0099795_10012778
668 Ga0105244_10204052
669 Ga0105250_10146712
670 Ga0111539_12878148
671 Ga0105245_10066244
672 Ga0105245_10216136
673 Ga0105247_10001591
674 Ga0105247_10005195
675 Ga0114129_10034110
676 Ga0105243_10006202
677 Ga0105243_10342278
678 Ga0105241_10276486
679 Ga0105241_11541981
680 Ga0105242_10115844
681 Ga0105242_10206466
682 Ga0105242_10236828
683 Ga0105248_10068663
684 Ga0105248_10354013
685 Ga0105237_10245929
686 Ga0105238_10877921
687 Ga0105238_10961875
688 Ga0105249_10009395
689 Ga0105249_10127628
690 Ga0099796_10026567
691 Ga0105239_10074509
692 Ga0105239_10132642
693 Ga0105239_12356619
694 Ga0105246_10139703
695 Ga0157369_10511166
696 Ga0157374_10007942
697 Ga0157378_10002404
698 Ga0157378_10021567
699 Ga0163162_10071198
700 Ga0163162_10354110
701 Ga0163162_10364639
702 Ga0163162_10676146
703 Ga0163162_11680404
704 Ga0157372_10000917
705 Ga0157372_10316922
706 Ga0157372_11508368
707 Ga0157375_10000573
708 Ga0157375_10213928
709 Ga0157375_11042908
710 Ga0163163_10146429
711 Ga0157380_10001337
712 Ga0157377_10020243
713 Ga0157377_10739704
714 Ga0157379_10070948
715 Ga0157379_10897774
716 Ga0163161_10009207
717 Ga0213874_10152899
718 Ga0213875_10043805
719 Ga0209051_1000033
720 Ga0207692_10005720
721 Ga0207642_10000191
722 Ga0207710_10000350
723 Ga0207710_10114174
724 Ga0207688_10003159
725 Ga0207688_10018131
726 Ga0207680_10108401
727 Ga0207647_10018984
728 Ga0207685_10557688
729 Ga0207699_10316062
730 Ga0207645_10027579
731 Ga0207654_10109669
732 Ga0207671_10009509
733 Ga0207671_10012463
734 Ga0207671_10284010
735 Ga0207693_10000197
736 Ga0207693_10000771
737 Ga0207663_10001796
738 Ga0207663_10681348
739 Ga0207660_10398870
740 Ga0207662_10078524
741 Ga0207657_10589267
742 Ga0207657_10815887
743 Ga0207681_10016662
744 Ga0207681_10418358
745 Ga0207694_10213606
746 Ga0207650_11459225
747 Ga0207659_10639893
748 Ga0207687_10031639
749 Ga0207687_10052833
750 Ga0207700_10060412
751 Ga0207664_10202157
752 Ga0207644_10043133
753 Ga0207690_10052314
754 Ga0207690_10060667
755 Ga0207690_10451831
756 Ga0207706_10013062
757 Ga0207706_10082911
758 Ga0207706_10257455
759 Ga0207686_10015647
760 Ga0207686_10107347
761 Ga0207709_10087674
762 Ga0207670_10489567
763 Ga0207669_10004626
764 Ga0207669_10072386
765 Ga0207669_10188523
766 Ga0207704_10000448
767 Ga0207704_10347074
768 Ga0207665_10002506
769 Ga0207665_10008287
770 Ga0207665_10272169
771 Ga0207691_10871353
772 Ga0207711_10048064
773 Ga0207689_10009089
774 Ga0207689_10069905
775 Ga0207651_10236280
776 Ga0207712_10010767
777 Ga0207668_10000838
778 Ga0207668_10001862
779 Ga0207668_10274731
780 Ga0207640_10098742
781 Ga0207640_10100082
782 Ga0207640_11247068
783 Ga0207658_10001213
784 Ga0207658_10002007
785 Ga0207658_10071799
786 Ga0207658_10109951
787 Ga0207658_10235327
788 Ga0207658_10675088
789 Ga0207658_11514769
790 Ga0207677_10019286
791 Ga0207677_10594702
792 Ga0207677_10790527
793 Ga0207703_10015904
794 Ga0207703_10089322
795 Ga0207703_10180753
796 Ga0207639_10058617
797 Ga0207639_10074378
798 Ga0207678_10059055
799 Ga0207708_10001480
800 Ga0207702_10248896
801 Ga0207702_10370856
802 Ga0207641_10192423
803 Ga0207648_10001458
804 Ga0207648_10037813
805 Ga0207648_11688872
806 Ga0207676_10084097
807 Ga0207676_10344490
808 Ga0207676_10462783
809 Ga0207675_100063273
810 Ga0207675_100213826
811 Ga0207675_100260165
812 Ga0207675_100376170
813 Ga0207675_100391813
814 Ga0207683_10000996
815 Ga0207683_10433097
816 Ga0207683_10563504
817 Ga0207683_10768056
818 Ga0207698_10026087
819 Ga0207698_10131720
820 Ga0268266_10022186
821 Ga0268266_10417580
822 Ga0268266_10521734
823 Ga0268265_10008991
824 Ga0268264_10068754
825 Ga0268264_10408112
826 Ga0265327_10005208
827 Ga0307410_10295331
828 Ga0307406_11029208
829 Ga0307409_100082903
830 Ga0307416_100368465
831 Ga0307411_10603242
832 Ga0307415_100408280
833 Ga0373961_0046243
834 Ga0373962_0169569
835 Ga0373931_0013996
836 Ga0373931_0121866
837 Ga0436364_0043290
838 Ga0436365_0328142
839 Ga0436365_0678783
840 Ga0436363_0132291
841 Ga0436363_0674883
842 Ga0436363_1195077
843 Ga0436363_1659400
844 Ga0439461_0006924
845 Ga0439461_0058129
846 Ga0439466_0019022
847 Ga0439466_0071055
848 Ga0439465_0018953
849 Ga0439465_0062290
850 Ga0439442_005512
851 Ga0439448_0149259
852 Ga0439459_0005617
853 Ga0439460_0124021
854 Ga0466972_0013402
855 Ga0466972_0016283
856 Ga0466972_0029543
857 Ga0466972_0042393
858 Ga0466972_0088801
859 Ga0466972_0162995
860 Ga0466965_0005462
861 Ga0466965_0018385
862 Ga0466965_0022542
863 Ga0466966_0462602
864 Ga0466961_0136726
865 Ga0466971_0137269
866 Ga0466968_0014027
867 Ga0466968_0026654
868 Ga0466970_0082898
869 Ga0466970_0136593
870 Ga0466970_0175638
871 Ga0466957_0006105
872 Ga0466957_0073041
873 Ga0466960_0000170
874 Ga0466960_0034568
875 Ga0466959_0088750
876 Ga0466959_0316354
877 Ga0466958_0566973
878 Ga0466967_0024083
879 Ga0466967_0322684
880 Ga0466967_0488815
881 Ga0466967_0693131
882 Ga0466967_1372485
883 Ga0495672_0122675
884 Ga0495626_0062922
885 Ga0495626_0233254
886 Ga0496100_0000029
887 Ga0496100_0000780
888 Ga0496100_0001560
889 Ga0496100_0002719
890 Ga0496100_0217054
891 Ga0496100_0354266
892 Ga0496101_0000015
893 Ga0496101_0000031
894 Ga0496101_0000717
895 Ga0496101_0015234
896 Ga0496101_0051263
897 Ga0496101_0359762
898 Ga0496102_0000065
899 Ga0496102_0002030
900 Ga0496102_0005978
901 Ga0496102_0016754
902 Ga0496102_0028265
903 Ga0496102_0055426
904 Ga0496102_0126813
905 Ga0496102_0206799
906 Ga0496102_0332152
907 Ga0496102_0756219
908 Ga0496103_0000048
909 Ga0496103_0003067
910 Ga0496103_0005902
911 Ga0496103_0086929
912 Ga0496103_0163170
913 Ga0496103_0215673
914 Ga0496104_0001343
915 Ga0496104_0015016
916 Ga0496105_0006560
917 Ga0496105_0068811
918 Ga0496106_0000396
919 Ga0496106_0001046
920 Ga0496106_0018223
921 Ga0496106_0029597
922 Ga0496106_0131472
923 Ga0496106_0415066
924 Ga0496107_0000330
925 Ga0496107_0015942
926 Ga0496107_0510722
927 Ga0496107_0687917
928 Ga0496107_0857246
929 Ga0496108_0001084
930 Ga0496108_0003464
931 Ga0496108_0183044
932 Ga0496108_0567034
933 Ga0496109_0000134
934 Ga0496109_0004328
935 Ga0496109_0098560
936 Ga0496109_0191298
937 Ga0496109_0241209
938 Ga0496109_0277222
939 Ga0496109_2057016
940 Ga0496110_0162051
941 Ga0496110_0927615
942 Ga0496111_0057283
943 Ga0496111_0876370
944 Ga0496112_0027671
945 Ga0496112_0034944
946 Ga0496112_0256411
947 Ga0496112_1138798
948 Ga0496113_0453149
949 Ga0496114_0001231
950 Ga0496114_0004867
951 Ga0496114_0006256
952 Ga0496114_0151301
953 Ga0496115_0002005
954 Ga0496115_0003450
955 Ga0496115_0018149
956 Ga0496116_0000125
957 Ga0496116_0019255
958 Ga0496117_0000111
959 Ga0496117_0063747
960 Ga0496118_0000083
961 Ga0496118_0076671
962 Ga0496118_0597146
963 Ga0496119_0003439
964 Ga0496119_0044961
965 Ga0496120_0034219
966 Ga0496120_0083249
967 Ga0496121_0000004
968 Ga0496121_0000728
969 Ga0496122_0000138
970 Ga0496123_0007235
971 Ga0496124_0000012
972 Ga0496125_0000003
973 Ga0496126_0000001
974 Ga0496126_0000220
975 Ga0501032_0012850
976 Ga0501033_0112936
977 Ga0501034_0398218
978 Ga0501034_0512153
979 Ga0501036_0001872
980 Ga0501037_0000401
981 Ga0501038_0007683
982 Ga0501039_0003187
983 Ga0501043_0001795
984 Ga0501070_0012220
985 Ga0501073_0152706
986 Ga0501080_1632875
987 Ga0501035_0900134
988 Ga0501044_0005938
989 Ga0501044_0198977
990 nmdc:mga03683_1900_c1
991 nmdc:mga03n38_43469_c1
992 nmdc:mga03n38_60501_c1
993 nmdc:mga03n38_78638_c1
994 nmdc:mga00v17_362393_c1
995 nmdc:mga00v17_386393_c1
996 nmdc:mga00v17_709_c1
997 nmdc:mga00v17_99628_c1
998 nmdc:mga0yw44_70180_c1
999 nmdc:mga06z11_20821_c1
1000 nmdc:mga07m45_29176_c1
1001 nmdc:mga09592_195442_c1
1002 nmdc:mga0qj67_102738_c1
1003 nmdc:mga0sz30_29439_c1
1004 nmdc:mga0sz30_338_c1
1005 nmdc:mga0sz30_60468_c1
1006 Ga0500610_0030694
1007 Ga0500635_0012370
1008 Ga0500556_0002212
1009 Ga0500562_001188
1010 Ga0500593_222152
1011 Ga0500652_307546
1012 Ga0500577_0119976
1013 Ga0500616_0034831
1014 2738667360
1015 2739146203
1016 2939585137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5545 27 144
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5414 27 144
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5337 36 144
1u89-assembly1.cif.gz_A solution structure of vbs2 fragment of talin 0.5227 33 148
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.5212 33 145
ID Description Score Start End Superfamily
af_Q2FWC2_1_116_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8398 36 140 1.20.120.550
af_Q2FWC2_1_116_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7613 36 140 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7608 33 148 1.10.10.1740
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7252 33 140 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6866 33 148 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A7I7S508-F1-model_v4 DoxX family protein 0.9992 1 147 GO:0016020
AF-A0A2X1T9A4-F1-model_v4 deleted 0.9948 1 147
AF-A0A2A7MX26-F1-model_v4 DoxX family protein 0.9892 1 149 GO:0016020
AF-A0A7I7S508-F1-model_v4 DoxX family protein 0.9858 1 147 GO:0016020
AF-X8FJS0-F1-model_v4 deleted 0.9853 1 149

Map