F456782

General Info

Members Datasets Scaffolds Average Seq Length
508 292 1016 71

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100539794|Ga0070705_1005397942
Length 82
Sequence MNNNYKYEIVIYWSEEDEAFIAEVPELPGCAADGSTHVEALANVDVIIREWIETANELGRAIPEPKGRLMYAPTSSMFYVPR

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 2124908018 Switchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
145 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
152 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
258 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
259 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
260 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
261 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
262 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
263 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
286 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.79
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 1.97
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 36.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100539794 3300005440 Unclassified 892
2 SwRhBV22_Contig_3417 2124908018 Unclassified 526
3 rootH1_10228571 3300003323 Bacteria 3071
4 JGI26145J50221_1022814 3300003371 Bacteria 612
5 Ga0065715_10175896 3300005293 Bacteria 1512
6 Ga0065707_10493297 3300005295 Bacteria 763
7 Ga0070658_10827063 3300005327 Unclassified 805
8 Ga0070658_11995507 3300005327 Unclassified 501
9 Ga0070683_100000018 3300005329 Bacteria 193063
10 Ga0070683_100007679 3300005329 Bacteria 9126
11 Ga0070683_100091229 3300005329 Bacteria 2861
12 Ga0070690_100124878 3300005330 Unclassified 1731
13 Ga0070690_100694296 3300005330 Bacteria 781
14 Ga0070690_101337574 3300005330 Unclassified 575
15 Ga0070680_100387137 3300005336 Bacteria 1191
16 Ga0070680_100509084 3300005336 Unclassified 1030
17 Ga0070680_101826686 3300005336 Bacteria 527
18 Ga0068868_100806793 3300005338 Viruses 847
19 Ga0070660_100997275 3300005339 Unclassified 708
20 Ga0070689_100000538 3300005340 Bacteria 22562
21 Ga0070689_100998023 3300005340 Unclassified 745
22 Ga0070689_101153490 3300005340 Unclassified 694
23 Ga0070687_100039722 3300005343 Unclassified 2366
24 Ga0070687_100650471 3300005343 Unclassified 730
25 Ga0070668_101451471 3300005347 Unclassified 626
26 Ga0070675_100082376 3300005354 Bacteria 2684
27 Ga0070671_100234950 3300005355 Bacteria 1556
28 Ga0070673_100203978 3300005364 Bacteria 1704
29 Ga0070673_102092222 3300005364 Unclassified 538
30 Ga0070688_100119328 3300005365 Bacteria 1764
31 Ga0070659_100687057 3300005366 Unclassified 884
32 Ga0070667_101346898 3300005367 Bacteria 669
33 Ga0070667_101578026 3300005367 Unclassified 617
34 Ga0070703_10000221 3300005406 Bacteria 27478
35 Ga0070705_100000331 3300005440 Bacteria 27964
36 Ga0070700_100000018 3300005441 Bacteria 137176
37 Ga0070708_100040435 3300005445 Bacteria 4083
38 Ga0070708_100196179 3300005445 Unclassified 1889
39 Ga0070708_100417018 3300005445 Bacteria 1266
40 Ga0070708_100817432 3300005445 Bacteria 876
41 Ga0070708_102164592 3300005445 Unclassified 514
42 Ga0070663_102075491 3300005455 Unclassified 512
43 Ga0070663_102140489 3300005455 Bacteria 504
44 Ga0070681_11413296 3300005458 Unclassified 620
45 Ga0068867_100811701 3300005459 Bacteria 835
46 Ga0068867_101310049 3300005459 Bacteria 669
47 Ga0070706_100002126 3300005467 Bacteria 20184
48 Ga0070707_100000312 3300005468 Bacteria 47797
49 Ga0070707_101109802 3300005468 Bacteria 757
50 Ga0070707_102324304 3300005468 Bacteria 503
51 Ga0070699_100100956 3300005518 Bacteria 2529
52 Ga0070699_100205577 3300005518 Bacteria 1752
53 Ga0070699_100274316 3300005518 Unclassified 1510
54 Ga0070699_101811126 3300005518 Unclassified 559
55 Ga0070679_100354942 3300005530 Unclassified 1414
56 Ga0070684_100000743 3300005535 Bacteria 22555
57 Ga0070684_101857095 3300005535 Unclassified 568
58 Ga0068853_100003218 3300005539 Bacteria 12483
59 Ga0068853_100011605 3300005539 Bacteria 7161
60 Ga0070672_101016321 3300005543 Unclassified 735
61 Ga0070695_100285440 3300005545 Bacteria 1214
62 Ga0070693_100264344 3300005547 Unclassified 1146
63 Ga0070665_100088962 3300005548 Bacteria 3094
64 Ga0068855_101526016 3300005563 Bacteria 685
65 Ga0070664_100660025 3300005564 Unclassified 972
66 Ga0070664_101092772 3300005564 Bacteria 751
67 Ga0070664_101985227 3300005564 Bacteria 552
68 Ga0068856_101564001 3300005614 Bacteria 673
69 Ga0070702_101591010 3300005615 Unclassified 540
70 Ga0068859_101323294 3300005617 Bacteria 794
71 Ga0068859_101711629 3300005617 Unclassified 694
72 Ga0068859_102947070 3300005617 Unclassified 521
73 Ga0068864_100280766 3300005618 Bacteria 1554
74 Ga0068864_100386775 3300005618 Unclassified 1327
75 Ga0068864_102393367 3300005618 Unclassified 534
76 Ga0068861_102701206 3300005719 Unclassified 501
77 Ga0068870_10616075 3300005840 Unclassified 739
78 Ga0068863_101995674 3300005841 Unclassified 590
79 Ga0068863_102432836 3300005841 Unclassified 533
80 Ga0068858_100000015 3300005842 Bacteria 214504
81 Ga0068858_101740300 3300005842 Unclassified 616
82 Ga0068858_101925757 3300005842 Bacteria 584
83 Ga0068860_100725083 3300005843 Bacteria 1005
84 Ga0068860_100920850 3300005843 Bacteria 891
85 Ga0068862_100000729 3300005844 Bacteria 33267
86 Ga0068862_100122854 3300005844 Bacteria 2290
87 Ga0081455_10028250 3300005937 Bacteria 5127
88 Ga0081538_10095195 3300005981 Bacteria 1522
89 Ga0081539_10008319 3300005985 Bacteria 9075
90 Ga0070716_101254130 3300006173 Unclassified 597
91 Ga0070712_101687814 3300006175 Unclassified 554
92 Ga0075427_10008184 3300006194 Bacteria 1547
93 Ga0097621_100124297 3300006237 Bacteria 2191
94 Ga0068871_100068015 3300006358 Bacteria 2924
95 Ga0068871_100487813 3300006358 Bacteria 1109
96 Ga0068871_101641236 3300006358 Unclassified 609
97 Ga0075428_100022154 3300006844 Bacteria 7034
98 Ga0075428_100031147 3300006844 Bacteria 5898
99 Ga0075428_100834224 3300006844 Bacteria 979
100 Ga0075428_101803557 3300006844 Bacteria 637
101 Ga0075430_100163905 3300006846 Bacteria 1850
102 Ga0075431_100715776 3300006847 Unclassified 978
103 Ga0075431_101575137 3300006847 Bacteria 615
104 Ga0075431_102009571 3300006847 Unclassified 533
105 Ga0075433_10025182 3300006852 Bacteria 5030
106 Ga0075433_11363869 3300006852 Unclassified 614
107 Ga0075434_100782561 3300006871 Bacteria 971
108 Ga0075434_101232450 3300006871 Unclassified 760
109 Ga0075429_100427252 3300006880 Bacteria 1160
110 Ga0068865_100380954 3300006881 Unclassified 1150
111 Ga0068865_100417561 3300006881 Unclassified 1102
112 Ga0068865_100517604 3300006881 Bacteria 997
113 Ga0068865_100629798 3300006881 Bacteria 909
114 Ga0075436_100005910 3300006914 Bacteria 8409
115 Ga0075436_100461737 3300006914 Unclassified 926
116 Ga0097620_101323044 3300006931 Bacteria 794
117 Ga0097620_101711609 3300006931 Unclassified 694
118 Ga0097620_102021530 3300006931 Unclassified 636
119 Ga0097620_102947043 3300006931 Unclassified 521
120 Ga0075435_100000066 3300007076 Bacteria 54297
121 Ga0075435_101896698 3300007076 Unclassified 523
122 Ga0099794_10003616 3300007265 Bacteria 5932
123 Ga0099794_10003985 3300007265 Bacteria 5733
124 Ga0099794_10101535 3300007265 Bacteria 1436
125 Ga0099795_10075869 3300007788 Unclassified 1277
126 Ga0105240_10007940 3300009093 Bacteria 15310
127 Ga0105240_10063677 3300009093 Bacteria 4585
128 Ga0105240_10469932 3300009093 Bacteria 1404
129 Ga0105240_10748062 3300009093 Unclassified 1063
130 Ga0105240_10864216 3300009093 Unclassified 975
131 Ga0111539_10042551 3300009094 Bacteria 5453
132 Ga0111539_10168195 3300009094 Bacteria 2562
133 Ga0111539_10187887 3300009094 Bacteria 2412
134 Ga0111539_10779367 3300009094 Unclassified 1113
135 Ga0111539_10960903 3300009094 Bacteria 993
136 Ga0111539_10978424 3300009094 Bacteria 984
137 Ga0111539_13478322 3300009094 Unclassified 506
138 Ga0105245_10001031 3300009098 Bacteria 25294
139 Ga0105245_10617079 3300009098 Bacteria 1112
140 Ga0114129_10217716 3300009147 Bacteria 2578
141 Ga0114129_10823454 3300009147 Bacteria 1182
142 Ga0114129_10955444 3300009147 Bacteria 1082
143 Ga0114129_12312153 3300009147 Unclassified 645
144 Ga0105243_12923296 3300009148 Unclassified 518
145 Ga0105241_11226044 3300009174 Bacteria 711
146 Ga0105242_11911895 3300009176 Unclassified 634
147 Ga0105242_11947917 3300009176 Bacteria 629
148 Ga0105242_13127695 3300009176 Bacteria 513
149 Ga0105248_10160539 3300009177 Bacteria 2536
150 Ga0105248_10557082 3300009177 Bacteria 1293
151 Ga0105248_10958527 3300009177 Bacteria 966
152 Ga0105248_12086803 3300009177 Unclassified 644
153 Ga0105248_12461633 3300009177 Unclassified 593
154 Ga0105237_10994376 3300009545 Bacteria 846
155 Ga0105237_11631999 3300009545 Bacteria 652
156 Ga0105238_10009790 3300009551 Bacteria 9595
157 Ga0105238_10486058 3300009551 Bacteria 1234
158 Ga0105238_11251283 3300009551 Unclassified 767
159 Ga0105249_10653614 3300009553 Bacteria 1109
160 Ga0105249_10958293 3300009553 Unclassified 924
161 Ga0105249_11324606 3300009553 Bacteria 792
162 Ga0105249_12535469 3300009553 Unclassified 585
163 Ga0105239_10742183 3300010375 Bacteria 1123
164 Ga0105239_11353051 3300010375 Unclassified 822
165 Ga0105246_10275150 3300011119 Unclassified 1348
166 Ga0157370_10343694 3300013104 Bacteria 1375
167 Ga0157370_10417603 3300013104 Bacteria 1234
168 Ga0157370_11080341 3300013104 Unclassified 725
169 Ga0157370_11850949 3300013104 Unclassified 541
170 Ga0157369_10645786 3300013105 Bacteria 1091
171 Ga0157369_10949296 3300013105 Unclassified 881
172 Ga0157374_11702381 3300013296 Unclassified 655
173 Ga0157374_11773090 3300013296 Bacteria 642
174 Ga0157374_11795176 3300013296 Unclassified 639
175 Ga0157378_10019170 3300013297 Bacteria 6012
176 Ga0157378_10097012 3300013297 Bacteria 2686
177 Ga0157378_11124959 3300013297 Bacteria 823
178 Ga0163162_10448274 3300013306 Unclassified 1422
179 Ga0163162_11540282 3300013306 Viruses 758
180 Ga0157372_10173866 3300013307 Bacteria 2492
181 Ga0157372_10469496 3300013307 Bacteria 1467
182 Ga0157372_11045722 3300013307 Unclassified 945
183 Ga0157372_11119172 3300013307 Unclassified 911
184 Ga0157372_11882912 3300013307 Bacteria 688
185 Ga0157372_12425767 3300013307 Unclassified 602
186 Ga0157375_10000020 3300013308 Bacteria 251840
187 Ga0157375_11165465 3300013308 Bacteria 903
188 Ga0157375_11393298 3300013308 Bacteria 826
189 Ga0157375_11578392 3300013308 Bacteria 776
190 Ga0157375_12942033 3300013308 Bacteria 569
191 Ga0163163_10078783 3300014325 Bacteria 3292
192 Ga0163163_11666549 3300014325 Unclassified 698
193 Ga0163163_12537613 3300014325 Unclassified 570
194 Ga0157380_10004002 3300014326 Bacteria 10174
195 Ga0157380_10017682 3300014326 Bacteria 5280
196 Ga0157380_10403885 3300014326 Bacteria 1297
197 Ga0157380_12020534 3300014326 Unclassified 638
198 Ga0157376_10301756 3300014969 Viruses 1516
199 Ga0157376_10924462 3300014969 Bacteria 891
200 Ga0157376_11087656 3300014969 Bacteria 825
201 Ga0157376_12103618 3300014969 Bacteria 603
202 Ga0182007_10326865 3300015262 Unclassified 570
203 Ga0213876_10232930 3300021384 Unclassified 979
204 Ga0213875_10103948 3300021388 Bacteria 1326
205 Ga0207653_10000226 3300025885 Bacteria 37617
206 Ga0207692_10430447 3300025898 Bacteria 827
207 Ga0207680_11090391 3300025903 Unclassified 571
208 Ga0207645_10412026 3300025907 Bacteria 910
209 Ga0207684_10000752 3300025910 Bacteria 37804
210 Ga0207684_10962424 3300025910 Unclassified 715
211 Ga0207707_10311662 3300025912 Unclassified 1360
212 Ga0207707_10317019 3300025912 Bacteria 1347
213 Ga0207695_10044133 3300025913 Bacteria 4744
214 Ga0207695_10064967 3300025913 Bacteria 3753
215 Ga0207695_11266427 3300025913 Bacteria 618
216 Ga0207663_10129210 3300025916 Bacteria 1743
217 Ga0207663_11648975 3300025916 Unclassified 516
218 Ga0207660_10530653 3300025917 Bacteria 956
219 Ga0207660_10975361 3300025917 Unclassified 691
220 Ga0207660_11435711 3300025917 Bacteria 559
221 Ga0207657_11313606 3300025919 Unclassified 546
222 Ga0207646_10000582 3300025922 Bacteria 47813
223 Ga0207646_11848444 3300025922 Unclassified 516
224 Ga0207694_10020783 3300025924 Bacteria 4969
225 Ga0207694_10022404 3300025924 Bacteria 4791
226 Ga0207694_10947228 3300025924 Unclassified 728
227 Ga0207659_10564410 3300025926 Bacteria 968
228 Ga0207687_10001459 3300025927 Bacteria 16226
229 Ga0207644_10095472 3300025931 Bacteria 2224
230 Ga0207706_10923992 3300025933 Unclassified 736
231 Ga0207670_10001313 3300025936 Bacteria 13122
232 Ga0207670_10883834 3300025936 Unclassified 748
233 Ga0207669_10058763 3300025937 Bacteria 2348
234 Ga0207704_10486896 3300025938 Bacteria 991
235 Ga0207691_10964128 3300025940 Unclassified 712
236 Ga0207691_11308594 3300025940 Unclassified 598
237 Ga0207711_10110694 3300025941 Bacteria 2442
238 Ga0207711_10137806 3300025941 Unclassified 2193
239 Ga0207711_10733667 3300025941 Bacteria 921
240 Ga0207661_10000025 3300025944 Bacteria 195900
241 Ga0207661_10092908 3300025944 Bacteria 2516
242 Ga0207661_10209818 3300025944 Bacteria 1716
243 Ga0207679_10620671 3300025945 Unclassified 976
244 Ga0207679_10915901 3300025945 Unclassified 802
245 Ga0207679_11189363 3300025945 Unclassified 700
246 Ga0207679_11726990 3300025945 Bacteria 572
247 Ga0207651_10035842 3300025960 Bacteria 3232
248 Ga0207651_10399830 3300025960 Bacteria 1168
249 Ga0207651_11656754 3300025960 Unclassified 576
250 Ga0207712_10147435 3300025961 Unclassified 1813
251 Ga0207712_10663296 3300025961 Bacteria 907
252 Ga0207712_11440222 3300025961 Unclassified 617
253 Ga0207668_11156773 3300025972 Bacteria 695
254 Ga0207703_10000022 3300026035 Bacteria 245723
255 Ga0207703_10435932 3300026035 Bacteria 1222
256 Ga0207703_11281748 3300026035 Unclassified 705
257 Ga0207639_10000045 3300026041 Bacteria 136152
258 Ga0207639_10289881 3300026041 Bacteria 1443
259 Ga0207678_11108178 3300026067 Bacteria 701
260 Ga0207702_11834982 3300026078 Bacteria 598
261 Ga0207641_12581824 3300026088 Bacteria 506
262 Ga0207648_12183870 3300026089 Unclassified 514
263 Ga0207676_10261858 3300026095 Bacteria 1562
264 Ga0207676_10412221 3300026095 Unclassified 1265
265 Ga0207676_11532473 3300026095 Unclassified 664
266 Ga0207676_12065460 3300026095 Unclassified 568
267 Ga0207675_100430880 3300026118 Unclassified 1304
268 Ga0207675_101128681 3300026118 Bacteria 804
269 Ga0209967_1009546 3300027364 Bacteria 1346
270 Ga0209984_1024184 3300027424 Bacteria 841
271 Ga0210000_1011672 3300027462 Bacteria 1302
272 Ga0209995_1012327 3300027471 Bacteria 1394
273 Ga0209968_1045277 3300027526 Bacteria 757
274 Ga0209999_1001105 3300027543 Bacteria 4603
275 Ga0209982_1003819 3300027552 Bacteria 2153
276 Ga0209970_1001384 3300027614 Bacteria 4233
277 Ga0210002_1002779 3300027617 Bacteria 2541
278 Ga0210002_1054615 3300027617 Bacteria 692
279 Ga0209588_1003826 3300027671 Bacteria 4198
280 Ga0209588_1014673 3300027671 Bacteria 2402
281 Ga0209588_1086857 3300027671 Unclassified 1009
282 Ga0209971_1003467 3300027682 Bacteria 3742
283 Ga0209966_1013834 3300027695 Bacteria 1499
284 Ga0209974_10002785 3300027876 Bacteria 6341
285 Ga0207428_10022995 3300027907 Bacteria 5249
286 Ga0207428_10152798 3300027907 Unclassified 1756
287 Ga0207428_10170746 3300027907 Bacteria 1647
288 Ga0265354_1001285 3300028016 Bacteria 3722
289 Ga0265357_1004478 3300028023 Bacteria 1262
290 Ga0268266_10128508 3300028379 Bacteria 2264
291 Ga0268265_10016896 3300028380 Bacteria 5023
292 Ga0268265_10090960 3300028380 Bacteria 2439
293 Ga0268264_10102217 3300028381 Bacteria 2494
294 Ga0265323_10012058 3300028653 Unclassified 3472
295 Ga0265338_10247681 3300028800 Unclassified 1316
296 Ga0265338_10700143 3300028800 Bacteria 699
297 Ga0265324_10232305 3300029957 Unclassified 626
298 Ga0265762_1026702 3300030760 Bacteria 1081
299 Ga0265765_1003303 3300030879 Bacteria 1612
300 Ga0265760_10001841 3300031090 Bacteria 6229
301 Ga0265320_10545495 3300031240 Unclassified 513
302 Ga0265325_10017232 3300031241 Bacteria 4016
303 Ga0265325_10116877 3300031241 Unclassified 1290
304 Ga0265325_10498334 3300031241 Unclassified 528
305 Ga0265316_10159522 3300031344 Bacteria 1687
306 Ga0265316_10999782 3300031344 Bacteria 582
307 Ga0307513_10830675 3300031456 Bacteria 630
308 Ga0307408_100550426 3300031548 Bacteria 1018
309 Ga0265313_10104582 3300031595 Unclassified 1252
310 Ga0265314_10004640 3300031711 Bacteria 12639
311 Ga0307405_10237114 3300031731 Unclassified 1349
312 Ga0307405_10480265 3300031731 Bacteria 992
313 Ga0316577_10736435 3300031733 Bacteria 560
314 Ga0307413_10004514 3300031824 Bacteria 6068
315 Ga0307413_11864595 3300031824 Unclassified 539
316 Ga0307413_12148024 3300031824 Unclassified 506
317 Ga0307410_10181432 3300031852 Bacteria 1594
318 Ga0307410_10249220 3300031852 Bacteria 1380
319 Ga0307406_10163346 3300031901 Bacteria 1604
320 Ga0307407_10121874 3300031903 Unclassified 1654
321 Ga0307407_10810090 3300031903 Bacteria 713
322 Ga0307412_10108388 3300031911 Unclassified 1978
323 Ga0307409_100002516 3300031995 Bacteria 9607
324 Ga0307416_100009885 3300032002 Bacteria 6274
325 Ga0307414_10012534 3300032004 Bacteria 5017
326 Ga0307414_10980071 3300032004 Unclassified 778
327 Ga0307414_11352861 3300032004 Unclassified 661
328 Ga0307411_10055477 3300032005 Bacteria 2607
329 Ga0307411_10109285 3300032005 Bacteria 1975
330 Ga0307415_100039761 3300032126 Bacteria 3112
331 Ga0307415_100655300 3300032126 Bacteria 942
332 Ga0307415_101192940 3300032126 Bacteria 717
333 Ga0307415_101467583 3300032126 Bacteria 651
334 Ga0316593_10013500 3300032168 Bacteria 2419
335 Ga0373934_0026182 3300035086 Bacteria 2262
336 Ga0373934_0066416 3300035086 Bacteria 1440
337 Ga0373934_0225201 3300035086 Unclassified 774
338 Ga0373923_0060220 3300035111 Bacteria 1611
339 Ga0373923_0069475 3300035111 Bacteria 1510
340 Ga0373923_0407906 3300035111 Unclassified 655
341 Ga0373936_0434061 3300035113 Unclassified 606
342 Ga0373953_0385801 3300035117 Bacteria 616
343 Ga0373954_0005431 3300035118 Bacteria 5513
344 Ga0373954_0008862 3300035118 Bacteria 4426
345 Ga0373954_0041907 3300035118 Bacteria 2135
346 Ga0373943_0953403 3300035170 Unclassified 514
347 Ga0373946_0051401 3300035171 Bacteria 1725
348 Ga0373946_0483290 3300035171 Bacteria 634
349 Ga0373955_0115224 3300035172 Unclassified 1557
350 Ga0373955_0210639 3300035172 Unclassified 1159
351 Ga0373955_0619468 3300035172 Unclassified 663
352 Ga0373935_0184895 3300035692 Bacteria 1432
353 Ga0373935_1445377 3300035692 Unclassified 514
354 Ga0373935_1473364 3300035692 Bacteria 509
355 Ga0373927_0703387 3300035695 Unclassified 668
356 Ga0373927_1125058 3300035695 Unclassified 518
357 Ga0373933_0272196 3300035724 Bacteria 1093
358 Ga0373933_0313620 3300035724 Bacteria 1016
359 Ga0373947_0586129 3300035725 Bacteria 760
360 Ga0373937_0025935 3300036401 Bacteria 5294
361 Ga0373937_0029919 3300036401 Bacteria 4933
362 Ga0373937_0057835 3300036401 Unclassified 3562
363 Ga0316582_0645203 3300036647 Unclassified 728
364 Ga0316584_0353209 3300036712 Bacteria 1055
365 Ga0436364_1375850 3300037853 Bacteria 1101
366 Ga0436364_1438454 3300037853 Unclassified 787
367 Ga0436364_1481622 3300037853 Bacteria 2090
368 Ga0237819_03351 3300038705 Bacteria 2872
369 Ga0436365_1727705 3300039437 Bacteria 2607
370 Ga0436363_1049780 3300039450 Bacteria 1008
371 Ga0451802_0964211 3300041460 Bacteria 793
372 Ga0451807_1645479 3300041486 Bacteria 1849
373 Ga0439441_022458 3300042001 Bacteria 1173
374 Ga0439449_0039446 3300042007 Bacteria 1756
375 Ga0439464_0204326 3300042439 Unclassified 631
376 Ga0439460_0163156 3300042461 Unclassified 748
377 Ga0451577_0447807 3300042876 Bacteria 1173
378 Ga0451577_1080899 3300042876 Unclassified 718
379 Ga0466969_0112199 3300044656 Bacteria 1275
380 Ga0466961_0001842 3300044693 Bacteria 13163
381 Ga0453684_0314780 3300044712 Bacteria 1775
382 Ga0453684_1134875 3300044712 Unclassified 824
383 Ga0466970_0453387 3300044765 Bacteria 735
384 Ga0466957_0008040 3300044842 Bacteria 5982
385 Ga0466959_0000003 3300045049 Bacteria 285164
386 Ga0466959_0367907 3300045049 Bacteria 979
387 Ga0451576_0280875 3300045051 Bacteria 1741
388 Ga0466958_0047741 3300045836 Unclassified 2585
389 Ga0495651_0019103 3300046462 Bacteria 5312
390 Ga0495651_0314046 3300046462 Bacteria 1047
391 Ga0495653_0898374 3300046463 Unclassified 528
392 Ga0495580_0176627 3300046472 Unclassified 1475
393 Ga0495582_0776079 3300046473 Unclassified 555
394 Ga0495582_0894692 3300046473 Unclassified 513
395 Ga0495664_0086753 3300046477 Bacteria 1880
396 Ga0495594_0141732 3300046499 Bacteria 1363
397 Ga0495628_0099647 3300046516 Bacteria 2244
398 Ga0495630_0117571 3300046517 Bacteria 2016
399 Ga0495652_0820315 3300046529 Unclassified 618
400 Ga0495665_0313536 3300046531 Unclassified 802
401 Ga0495640_0313669 3300046533 Unclassified 972
402 Ga0495586_0316288 3300046535 Unclassified 895
403 Ga0495645_0103631 3300046543 Unclassified 2021
404 Ga0495645_0620848 3300046543 Unclassified 663
405 Ga0495645_0691695 3300046543 Bacteria 620
406 Ga0495667_0063276 3300046559 Bacteria 2422
407 Ga0495667_0822198 3300046559 Unclassified 572
408 Ga0495634_0014182 3300046642 Bacteria 5750
409 Ga0495634_0090555 3300046642 Bacteria 1987
410 Ga0495635_0432248 3300046663 Unclassified 872
411 Ga0495599_0030507 3300046678 Bacteria 3383
412 Ga0495599_0266803 3300046678 Unclassified 1039
413 Ga0495599_0343196 3300046678 Bacteria 896
414 Ga0495658_0885444 3300046683 Unclassified 571
415 Ga0495669_0140428 3300046684 Unclassified 1140
416 Ga0495613_0388596 3300046689 Bacteria 953
417 Ga0495624_0019047 3300046690 Bacteria 4585
418 Ga0495624_0856805 3300046690 Bacteria 536
419 Ga0495600_0367979 3300046809 Bacteria 898
420 Ga0495604_0061220 3300047317 Bacteria 2880
421 Ga0495604_0537273 3300047317 Bacteria 755
422 Ga0495674_0014049 3300047319 Bacteria 7506
423 Ga0495674_1070446 3300047319 Bacteria 615
424 Ga0495680_0778782 3300047322 Unclassified 626
425 Ga0495675_0158099 3300047444 Bacteria 1397
426 Ga0495684_0011773 3300047471 Bacteria 6749
427 Ga0495684_0117650 3300047471 Bacteria 2003
428 Ga0495684_0722561 3300047471 Bacteria 658
429 Ga0495684_0854125 3300047471 Unclassified 590
430 Ga0495602_0878151 3300048088 Unclassified 598
431 Ga0496101_0558680 3300048904 Bacteria 905
432 Ga0496104_0233268 3300048907 Bacteria 1752
433 Ga0496104_1034307 3300048907 Unclassified 725
434 Ga0496105_0372563 3300048908 Bacteria 1137
435 Ga0496108_0000219 3300048911 Bacteria 51931
436 Ga0496108_0902493 3300048911 Bacteria 758
437 Ga0496109_0125425 3300048912 Bacteria 2394
438 Ga0496115_0051892 3300048918 Unclassified 3289
439 Ga0501031_0361510 3300049568 Unclassified 939
440 Ga0501034_0250707 3300049571 Bacteria 1715
441 Ga0501039_0030615 3300049575 Unclassified 4150
442 Ga0501039_1064494 3300049575 Unclassified 627
443 Ga0501040_1029074 3300049576 Unclassified 597
444 Ga0501041_0058869 3300049577 Bacteria 2351
445 Ga0501041_0733405 3300049577 Bacteria 633
446 Ga0501047_0033247 3300049581 Bacteria 4978
447 Ga0501048_0216598 3300049582 Unclassified 1358
448 Ga0501067_0099781 3300049583 Bacteria 1612
449 Ga0501068_0718706 3300049584 Unclassified 653
450 Ga0501071_0123746 3300049587 Bacteria 1918
451 Ga0501072_1198736 3300049588 Unclassified 590
452 Ga0501075_0145341 3300049591 Unclassified 1807
453 Ga0501075_0234262 3300049591 Unclassified 1400
454 Ga0501076_0072641 3300049592 Unclassified 2754
455 Ga0501077_0018527 3300049593 Bacteria 4403
456 Ga0501216_061950 3300049660 Bacteria 756
457 Ga0501230_051662 3300049667 Bacteria 817
458 Ga0501233_250437 3300049668 Bacteria 532
459 Ga0501250_095725 3300049680 Unclassified 523
460 Ga0501257_066086 3300049686 Bacteria 919
461 Ga0501261_009679 3300049690 Bacteria 1260
462 Ga0501221_134693 3300049704 Bacteria 642
463 Ga0501079_0157280 3300049741 Bacteria 1771
464 Ga0501080_0002906 3300049742 Bacteria 15073
465 Ga0501080_1020872 3300049742 Bacteria 717
466 Ga0501081_0500409 3300049743 Bacteria 905
467 Ga0501283_033305 3300049779 Bacteria 872
468 Ga0501035_0475881 3300049822 Bacteria 1031
469 Ga0501044_0024244 3300049823 Bacteria 6446
470 Ga0501045_0650900 3300049824 Unclassified 779
471 Ga0501204_017847 3300049850 Bacteria 902
472 nmdc:mga05p37_149_c1 3300050507 Bacteria 65984
473 nmdc:mga05p37_18673_c2 3300050507 Bacteria 6741
474 nmdc:mga05p37_445605_c1 3300050507 Bacteria 1500
475 nmdc:mga05p37_449160_c1 3300050507 Unclassified 1493
476 nmdc:mga05p37_567199_c1 3300050507 Bacteria 1288
477 nmdc:mga09592_1242326_c1 3300050508 Bacteria 614
478 nmdc:mga0qj67_710221_c1 3300050509 Unclassified 799
479 nmdc:mga06r32_1642618_c1 3300050510 Bacteria 580
480 nmdc:mga06r32_510724_c1 3300050510 Unclassified 1178
481 nmdc:mga08y16_169836_c1 3300050511 Unclassified 2265
482 nmdc:mga08y16_301000_c1 3300050511 Bacteria 1653
483 nmdc:mga08y16_367497_c1 3300050511 Bacteria 1476
484 nmdc:mga08y16_44437_c1 3300050511 Bacteria 4654
485 nmdc:mga08y16_595500_c1 3300050511 Unclassified 1115
486 nmdc:mga0n895_126539_c1 3300050512 Bacteria 2579
487 nmdc:mga0rr50_1703264_c1 3300050513 Bacteria 531
488 nmdc:mga08x19_1334177_c1 3300050514 Unclassified 508
489 nmdc:mga08x19_137294_c1 3300050514 Bacteria 1649
490 nmdc:mga08x19_175386_c1 3300050514 Bacteria 1462
491 nmdc:mga08x19_478_c1 3300050514 Bacteria 26932
492 nmdc:mga0a205_1563_c1 3300050515 Bacteria 4314
493 nmdc:mga0a205_414206_c1 3300050515 Unclassified 1210
494 Ga0495601_0810857 3300053077 Unclassified 594
495 Ga0495655_0003952 3300053083 Unclassified 2493
496 Ga0495655_0157989 3300053083 Bacteria 717
497 Ga0495595_0188310 3300053084 Unclassified 1025
498 Ga0495619_0116885 3300053085 Bacteria 1826
499 Ga0495619_0188922 3300053085 Bacteria 1426
500 Ga0500556_0311310 3300053104 Bacteria 614
501 Ga0500628_002066 3300053129 Bacteria 3369
502 Ga0500616_0142981 3300053153 Unclassified 1115
503 Ga0501084_0440778 3300054114 Bacteria 1101
504 Ga0501082_0000378 3300060353 Bacteria 39468
505 Ga0466962_0244704 3300061719 Bacteria 881
506 Ga0530510_0393868 3300061734 Bacteria 1043
507 Ga0530510_1096477 3300061734 Unclassified 610
508 2884637119 2884634485 Bacteria 3928637
509 Ga0070705_100539794
510 SwRhBV22_Contig_3417
511 rootH1_10228571
512 JGI26145J50221_1022814
513 Ga0065715_10175896
514 Ga0065707_10493297
515 Ga0070658_10827063
516 Ga0070658_11995507
517 Ga0070683_100000018
518 Ga0070683_100007679
519 Ga0070683_100091229
520 Ga0070690_100124878
521 Ga0070690_100694296
522 Ga0070690_101337574
523 Ga0070680_100387137
524 Ga0070680_100509084
525 Ga0070680_101826686
526 Ga0068868_100806793
527 Ga0070660_100997275
528 Ga0070689_100000538
529 Ga0070689_100998023
530 Ga0070689_101153490
531 Ga0070687_100039722
532 Ga0070687_100650471
533 Ga0070668_101451471
534 Ga0070675_100082376
535 Ga0070671_100234950
536 Ga0070673_100203978
537 Ga0070673_102092222
538 Ga0070688_100119328
539 Ga0070659_100687057
540 Ga0070667_101346898
541 Ga0070667_101578026
542 Ga0070703_10000221
543 Ga0070705_100000331
544 Ga0070700_100000018
545 Ga0070708_100040435
546 Ga0070708_100196179
547 Ga0070708_100417018
548 Ga0070708_100817432
549 Ga0070708_102164592
550 Ga0070663_102075491
551 Ga0070663_102140489
552 Ga0070681_11413296
553 Ga0068867_100811701
554 Ga0068867_101310049
555 Ga0070706_100002126
556 Ga0070707_100000312
557 Ga0070707_101109802
558 Ga0070707_102324304
559 Ga0070699_100100956
560 Ga0070699_100205577
561 Ga0070699_100274316
562 Ga0070699_101811126
563 Ga0070679_100354942
564 Ga0070684_100000743
565 Ga0070684_101857095
566 Ga0068853_100003218
567 Ga0068853_100011605
568 Ga0070672_101016321
569 Ga0070695_100285440
570 Ga0070693_100264344
571 Ga0070665_100088962
572 Ga0068855_101526016
573 Ga0070664_100660025
574 Ga0070664_101092772
575 Ga0070664_101985227
576 Ga0068856_101564001
577 Ga0070702_101591010
578 Ga0068859_101323294
579 Ga0068859_101711629
580 Ga0068859_102947070
581 Ga0068864_100280766
582 Ga0068864_100386775
583 Ga0068864_102393367
584 Ga0068861_102701206
585 Ga0068870_10616075
586 Ga0068863_101995674
587 Ga0068863_102432836
588 Ga0068858_100000015
589 Ga0068858_101740300
590 Ga0068858_101925757
591 Ga0068860_100725083
592 Ga0068860_100920850
593 Ga0068862_100000729
594 Ga0068862_100122854
595 Ga0081455_10028250
596 Ga0081538_10095195
597 Ga0081539_10008319
598 Ga0070716_101254130
599 Ga0070712_101687814
600 Ga0075427_10008184
601 Ga0097621_100124297
602 Ga0068871_100068015
603 Ga0068871_100487813
604 Ga0068871_101641236
605 Ga0075428_100022154
606 Ga0075428_100031147
607 Ga0075428_100834224
608 Ga0075428_101803557
609 Ga0075430_100163905
610 Ga0075431_100715776
611 Ga0075431_101575137
612 Ga0075431_102009571
613 Ga0075433_10025182
614 Ga0075433_11363869
615 Ga0075434_100782561
616 Ga0075434_101232450
617 Ga0075429_100427252
618 Ga0068865_100380954
619 Ga0068865_100417561
620 Ga0068865_100517604
621 Ga0068865_100629798
622 Ga0075436_100005910
623 Ga0075436_100461737
624 Ga0097620_101323044
625 Ga0097620_101711609
626 Ga0097620_102021530
627 Ga0097620_102947043
628 Ga0075435_100000066
629 Ga0075435_101896698
630 Ga0099794_10003616
631 Ga0099794_10003985
632 Ga0099794_10101535
633 Ga0099795_10075869
634 Ga0105240_10007940
635 Ga0105240_10063677
636 Ga0105240_10469932
637 Ga0105240_10748062
638 Ga0105240_10864216
639 Ga0111539_10042551
640 Ga0111539_10168195
641 Ga0111539_10187887
642 Ga0111539_10779367
643 Ga0111539_10960903
644 Ga0111539_10978424
645 Ga0111539_13478322
646 Ga0105245_10001031
647 Ga0105245_10617079
648 Ga0114129_10217716
649 Ga0114129_10823454
650 Ga0114129_10955444
651 Ga0114129_12312153
652 Ga0105243_12923296
653 Ga0105241_11226044
654 Ga0105242_11911895
655 Ga0105242_11947917
656 Ga0105242_13127695
657 Ga0105248_10160539
658 Ga0105248_10557082
659 Ga0105248_10958527
660 Ga0105248_12086803
661 Ga0105248_12461633
662 Ga0105237_10994376
663 Ga0105237_11631999
664 Ga0105238_10009790
665 Ga0105238_10486058
666 Ga0105238_11251283
667 Ga0105249_10653614
668 Ga0105249_10958293
669 Ga0105249_11324606
670 Ga0105249_12535469
671 Ga0105239_10742183
672 Ga0105239_11353051
673 Ga0105246_10275150
674 Ga0157370_10343694
675 Ga0157370_10417603
676 Ga0157370_11080341
677 Ga0157370_11850949
678 Ga0157369_10645786
679 Ga0157369_10949296
680 Ga0157374_11702381
681 Ga0157374_11773090
682 Ga0157374_11795176
683 Ga0157378_10019170
684 Ga0157378_10097012
685 Ga0157378_11124959
686 Ga0163162_10448274
687 Ga0163162_11540282
688 Ga0157372_10173866
689 Ga0157372_10469496
690 Ga0157372_11045722
691 Ga0157372_11119172
692 Ga0157372_11882912
693 Ga0157372_12425767
694 Ga0157375_10000020
695 Ga0157375_11165465
696 Ga0157375_11393298
697 Ga0157375_11578392
698 Ga0157375_12942033
699 Ga0163163_10078783
700 Ga0163163_11666549
701 Ga0163163_12537613
702 Ga0157380_10004002
703 Ga0157380_10017682
704 Ga0157380_10403885
705 Ga0157380_12020534
706 Ga0157376_10301756
707 Ga0157376_10924462
708 Ga0157376_11087656
709 Ga0157376_12103618
710 Ga0182007_10326865
711 Ga0213876_10232930
712 Ga0213875_10103948
713 Ga0207653_10000226
714 Ga0207692_10430447
715 Ga0207680_11090391
716 Ga0207645_10412026
717 Ga0207684_10000752
718 Ga0207684_10962424
719 Ga0207707_10311662
720 Ga0207707_10317019
721 Ga0207695_10044133
722 Ga0207695_10064967
723 Ga0207695_11266427
724 Ga0207663_10129210
725 Ga0207663_11648975
726 Ga0207660_10530653
727 Ga0207660_10975361
728 Ga0207660_11435711
729 Ga0207657_11313606
730 Ga0207646_10000582
731 Ga0207646_11848444
732 Ga0207694_10020783
733 Ga0207694_10022404
734 Ga0207694_10947228
735 Ga0207659_10564410
736 Ga0207687_10001459
737 Ga0207644_10095472
738 Ga0207706_10923992
739 Ga0207670_10001313
740 Ga0207670_10883834
741 Ga0207669_10058763
742 Ga0207704_10486896
743 Ga0207691_10964128
744 Ga0207691_11308594
745 Ga0207711_10110694
746 Ga0207711_10137806
747 Ga0207711_10733667
748 Ga0207661_10000025
749 Ga0207661_10092908
750 Ga0207661_10209818
751 Ga0207679_10620671
752 Ga0207679_10915901
753 Ga0207679_11189363
754 Ga0207679_11726990
755 Ga0207651_10035842
756 Ga0207651_10399830
757 Ga0207651_11656754
758 Ga0207712_10147435
759 Ga0207712_10663296
760 Ga0207712_11440222
761 Ga0207668_11156773
762 Ga0207703_10000022
763 Ga0207703_10435932
764 Ga0207703_11281748
765 Ga0207639_10000045
766 Ga0207639_10289881
767 Ga0207678_11108178
768 Ga0207702_11834982
769 Ga0207641_12581824
770 Ga0207648_12183870
771 Ga0207676_10261858
772 Ga0207676_10412221
773 Ga0207676_11532473
774 Ga0207676_12065460
775 Ga0207675_100430880
776 Ga0207675_101128681
777 Ga0209967_1009546
778 Ga0209984_1024184
779 Ga0210000_1011672
780 Ga0209995_1012327
781 Ga0209968_1045277
782 Ga0209999_1001105
783 Ga0209982_1003819
784 Ga0209970_1001384
785 Ga0210002_1002779
786 Ga0210002_1054615
787 Ga0209588_1003826
788 Ga0209588_1014673
789 Ga0209588_1086857
790 Ga0209971_1003467
791 Ga0209966_1013834
792 Ga0209974_10002785
793 Ga0207428_10022995
794 Ga0207428_10152798
795 Ga0207428_10170746
796 Ga0265354_1001285
797 Ga0265357_1004478
798 Ga0268266_10128508
799 Ga0268265_10016896
800 Ga0268265_10090960
801 Ga0268264_10102217
802 Ga0265323_10012058
803 Ga0265338_10247681
804 Ga0265338_10700143
805 Ga0265324_10232305
806 Ga0265762_1026702
807 Ga0265765_1003303
808 Ga0265760_10001841
809 Ga0265320_10545495
810 Ga0265325_10017232
811 Ga0265325_10116877
812 Ga0265325_10498334
813 Ga0265316_10159522
814 Ga0265316_10999782
815 Ga0307513_10830675
816 Ga0307408_100550426
817 Ga0265313_10104582
818 Ga0265314_10004640
819 Ga0307405_10237114
820 Ga0307405_10480265
821 Ga0316577_10736435
822 Ga0307413_10004514
823 Ga0307413_11864595
824 Ga0307413_12148024
825 Ga0307410_10181432
826 Ga0307410_10249220
827 Ga0307406_10163346
828 Ga0307407_10121874
829 Ga0307407_10810090
830 Ga0307412_10108388
831 Ga0307409_100002516
832 Ga0307416_100009885
833 Ga0307414_10012534
834 Ga0307414_10980071
835 Ga0307414_11352861
836 Ga0307411_10055477
837 Ga0307411_10109285
838 Ga0307415_100039761
839 Ga0307415_100655300
840 Ga0307415_101192940
841 Ga0307415_101467583
842 Ga0316593_10013500
843 Ga0373934_0026182
844 Ga0373934_0066416
845 Ga0373934_0225201
846 Ga0373923_0060220
847 Ga0373923_0069475
848 Ga0373923_0407906
849 Ga0373936_0434061
850 Ga0373953_0385801
851 Ga0373954_0005431
852 Ga0373954_0008862
853 Ga0373954_0041907
854 Ga0373943_0953403
855 Ga0373946_0051401
856 Ga0373946_0483290
857 Ga0373955_0115224
858 Ga0373955_0210639
859 Ga0373955_0619468
860 Ga0373935_0184895
861 Ga0373935_1445377
862 Ga0373935_1473364
863 Ga0373927_0703387
864 Ga0373927_1125058
865 Ga0373933_0272196
866 Ga0373933_0313620
867 Ga0373947_0586129
868 Ga0373937_0025935
869 Ga0373937_0029919
870 Ga0373937_0057835
871 Ga0316582_0645203
872 Ga0316584_0353209
873 Ga0436364_1375850
874 Ga0436364_1438454
875 Ga0436364_1481622
876 Ga0237819_03351
877 Ga0436365_1727705
878 Ga0436363_1049780
879 Ga0451802_0964211
880 Ga0451807_1645479
881 Ga0439441_022458
882 Ga0439449_0039446
883 Ga0439464_0204326
884 Ga0439460_0163156
885 Ga0451577_0447807
886 Ga0451577_1080899
887 Ga0466969_0112199
888 Ga0466961_0001842
889 Ga0453684_0314780
890 Ga0453684_1134875
891 Ga0466970_0453387
892 Ga0466957_0008040
893 Ga0466959_0000003
894 Ga0466959_0367907
895 Ga0451576_0280875
896 Ga0466958_0047741
897 Ga0495651_0019103
898 Ga0495651_0314046
899 Ga0495653_0898374
900 Ga0495580_0176627
901 Ga0495582_0776079
902 Ga0495582_0894692
903 Ga0495664_0086753
904 Ga0495594_0141732
905 Ga0495628_0099647
906 Ga0495630_0117571
907 Ga0495652_0820315
908 Ga0495665_0313536
909 Ga0495640_0313669
910 Ga0495586_0316288
911 Ga0495645_0103631
912 Ga0495645_0620848
913 Ga0495645_0691695
914 Ga0495667_0063276
915 Ga0495667_0822198
916 Ga0495634_0014182
917 Ga0495634_0090555
918 Ga0495635_0432248
919 Ga0495599_0030507
920 Ga0495599_0266803
921 Ga0495599_0343196
922 Ga0495658_0885444
923 Ga0495669_0140428
924 Ga0495613_0388596
925 Ga0495624_0019047
926 Ga0495624_0856805
927 Ga0495600_0367979
928 Ga0495604_0061220
929 Ga0495604_0537273
930 Ga0495674_0014049
931 Ga0495674_1070446
932 Ga0495680_0778782
933 Ga0495675_0158099
934 Ga0495684_0011773
935 Ga0495684_0117650
936 Ga0495684_0722561
937 Ga0495684_0854125
938 Ga0495602_0878151
939 Ga0496101_0558680
940 Ga0496104_0233268
941 Ga0496104_1034307
942 Ga0496105_0372563
943 Ga0496108_0000219
944 Ga0496108_0902493
945 Ga0496109_0125425
946 Ga0496115_0051892
947 Ga0501031_0361510
948 Ga0501034_0250707
949 Ga0501039_0030615
950 Ga0501039_1064494
951 Ga0501040_1029074
952 Ga0501041_0058869
953 Ga0501041_0733405
954 Ga0501047_0033247
955 Ga0501048_0216598
956 Ga0501067_0099781
957 Ga0501068_0718706
958 Ga0501071_0123746
959 Ga0501072_1198736
960 Ga0501075_0145341
961 Ga0501075_0234262
962 Ga0501076_0072641
963 Ga0501077_0018527
964 Ga0501216_061950
965 Ga0501230_051662
966 Ga0501233_250437
967 Ga0501250_095725
968 Ga0501257_066086
969 Ga0501261_009679
970 Ga0501221_134693
971 Ga0501079_0157280
972 Ga0501080_0002906
973 Ga0501080_1020872
974 Ga0501081_0500409
975 Ga0501283_033305
976 Ga0501035_0475881
977 Ga0501044_0024244
978 Ga0501045_0650900
979 Ga0501204_017847
980 nmdc:mga05p37_149_c1
981 nmdc:mga05p37_18673_c2
982 nmdc:mga05p37_445605_c1
983 nmdc:mga05p37_449160_c1
984 nmdc:mga05p37_567199_c1
985 nmdc:mga09592_1242326_c1
986 nmdc:mga0qj67_710221_c1
987 nmdc:mga06r32_1642618_c1
988 nmdc:mga06r32_510724_c1
989 nmdc:mga08y16_169836_c1
990 nmdc:mga08y16_301000_c1
991 nmdc:mga08y16_367497_c1
992 nmdc:mga08y16_44437_c1
993 nmdc:mga08y16_595500_c1
994 nmdc:mga0n895_126539_c1
995 nmdc:mga0rr50_1703264_c1
996 nmdc:mga08x19_1334177_c1
997 nmdc:mga08x19_137294_c1
998 nmdc:mga08x19_175386_c1
999 nmdc:mga08x19_478_c1
1000 nmdc:mga0a205_1563_c1
1001 nmdc:mga0a205_414206_c1
1002 Ga0495601_0810857
1003 Ga0495655_0003952
1004 Ga0495655_0157989
1005 Ga0495595_0188310
1006 Ga0495619_0116885
1007 Ga0495619_0188922
1008 Ga0500556_0311310
1009 Ga0500628_002066
1010 Ga0500616_0142981
1011 Ga0501084_0440778
1012 Ga0501082_0000378
1013 Ga0466962_0244704
1014 Ga0530510_0393868
1015 Ga0530510_1096477
1016 2884637119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15919

HicB_lk_antitox

HicB_like antitoxin of bacterial toxin-antitoxin system

7

74

0.94

PF21748

UPF0150

UPF0150-like

6

63

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g1c-assembly1.cif.gz_V crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.9036 9 62
6g1c-assembly1.cif.gz_C crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.8982 7 62
6hpc-assembly1.cif.gz_A crystal structure of the hicb antitoxin from e. coli 0.8913 7 71
6g1n-assembly1.cif.gz_B crystal structure of the burkholderia pseudomallei antitoxin hicb 0.8765 7 62
1wv8-assembly1.cif.gz_A-2 crystal structure of hypothetical protein ttha1013 from an extremely thermophilic bacterium thermus thermophilus hb8 0.8684 7 54
ID Description Score Start End Superfamily
af_P67697_1_89_3.30.160.250 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9166 7 71 3.30.160.250
2dsyD00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8643 9 69 3.30.160.250
1wv8A00 Alpha Beta;2-Layer Sandwich;TTHA1013/TTHA0281-like;TTHA1013-like 0.8544 7 54 3.30.2390.10
af_Q54G57_1723_1817_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8529 34 59 1.10.10.10
af_Q5N890_523_594_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8438 6 56 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A829ZPV6-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 0.9997 6 63
AF-A0A2W6CIS9-F1-model_v4 Type II toxin-antitoxin system HicB family antitoxin 0.9979 9 63
AF-B1WUY6-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 0.9962 6 59
AF-A0A7W1RA88-F1-model_v4 Type II toxin-antitoxin system HicB family antitoxin 0.9951 6 66
AF-A0A6L7YR03-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 0.9942 6 65

Map