F456783

General Info

Members Datasets Scaffolds Average Seq Length
508 194 506 307

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100035069|Ga0070708_1000350693
Length 310
Sequence MATIAATLTITPAHPAFAAEVSGVDLTRRLDDATFERIAVAFDDYSVLVFRGQALSDEQQMAFSERWGPLETTVRTLGGEDRLGAHIVDLSNTDPDGKLMGWEDRRMLYQSGNQLWHSDSSFKPVPAHSSALSARVIPPEGGETEFASMRVAYEHLAEDIRLDENVRRDLDRLIVVHSFGFSRSMIDPGIGTEIGRDYPPVRHALVRANPRNGRRSLYIGSHAWFIEGLGLDESRILIARLLEQTTRADRVYRHRWQVGDLVMWDNRCVLHRGRPWDSARYKRVMHRTTVAGDGATADPAFLHELTATRS

Samples

Sample ID Description Type Environment
1 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.2
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.98
Rhizosphere 98.62
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10008554 3300005328 Bacteria 5518
2 Ga0070690_100143938 3300005330 Bacteria 1620
3 Ga0070690_100222469 3300005330 Bacteria 1323
4 Ga0070670_100003552 3300005331 Bacteria 12969
5 Ga0070670_100091510 3300005331 Bacteria 2615
6 Ga0070677_10113234 3300005333 Bacteria 1214
7 Ga0068869_100000441 3300005334 Bacteria 22683
8 Ga0068869_100005949 3300005334 Bacteria 7711
9 Ga0068869_100083013 3300005334 Bacteria 2396
10 Ga0070666_10129598 3300005335 Bacteria 1752
11 Ga0070680_100001037 3300005336 Bacteria 19918
12 Ga0070680_100003438 3300005336 Bacteria 11825
13 Ga0070682_100000431 3300005337 Bacteria 27098
14 Ga0070682_100000441 3300005337 Bacteria 26724
15 Ga0068868_100011295 3300005338 Bacteria 6502
16 Ga0070660_100000167 3300005339 Bacteria 43059
17 Ga0070660_100002407 3300005339 Bacteria 12855
18 Ga0070689_100010334 3300005340 Bacteria 6654
19 Ga0070689_100010529 3300005340 Bacteria 6591
20 Ga0070691_10010735 3300005341 Bacteria 4180
21 Ga0070691_10033127 3300005341 Bacteria 2430
22 Ga0070691_10080439 3300005341 Unclassified 1595
23 Ga0070687_100018536 3300005343 Bacteria 3222
24 Ga0070661_100019188 3300005344 Bacteria 4870
25 Ga0070692_10000218 3300005345 Bacteria 15694
26 Ga0070692_10003682 3300005345 Bacteria 6274
27 Ga0070692_10070619 3300005345 Bacteria 1860
28 Ga0070669_100011936 3300005353 Bacteria 6164
29 Ga0070669_100207673 3300005353 Bacteria 1543
30 Ga0070669_100538489 3300005353 Bacteria 972
31 Ga0070673_100007386 3300005364 Bacteria 7243
32 Ga0070659_100000748 3300005366 Bacteria 23646
33 Ga0070659_100001067 3300005366 Bacteria 20046
34 Ga0070703_10002309 3300005406 Bacteria 5512
35 Ga0070709_10061206 3300005434 Bacteria 2396
36 Ga0070701_10041255 3300005438 Bacteria 2351
37 Ga0070701_10134015 3300005438 Bacteria 1410
38 Ga0070705_100000739 3300005440 Bacteria 18584
39 Ga0070705_100001807 3300005440 Bacteria 11042
40 Ga0070705_100017019 3300005440 Bacteria 3787
41 Ga0070705_100066520 3300005440 Bacteria 2161
42 Ga0070705_100214645 3300005440 Bacteria 1329
43 Ga0070705_100228853 3300005440 Bacteria 1292
44 Ga0070700_100025850 3300005441 Bacteria 3461
45 Ga0070694_100000520 3300005444 Bacteria 21250
46 Ga0070694_100000546 3300005444 Bacteria 20714
47 Ga0070694_100003863 3300005444 Bacteria 8952
48 Ga0070694_100013182 3300005444 Bacteria 5160
49 Ga0070708_100016456 3300005445 Bacteria 6136
50 Ga0070708_100018070 3300005445 Bacteria 5897
51 Ga0070708_100035069 3300005445 Bacteria 4369
52 Ga0070708_100048210 3300005445 Bacteria 3765
53 Ga0070708_100187734 3300005445 Bacteria 1933
54 Ga0070708_100189544 3300005445 Bacteria 1923
55 Ga0070708_100254680 3300005445 Bacteria 1649
56 Ga0070663_100000680 3300005455 Bacteria 18271
57 Ga0070663_100002687 3300005455 Bacteria 10064
58 Ga0070662_100007954 3300005457 Bacteria 6897
59 Ga0070662_100117784 3300005457 Bacteria 2032
60 Ga0070681_10017635 3300005458 Bacteria 7134
61 Ga0070681_10165867 3300005458 Bacteria 2131
62 Ga0068867_100002988 3300005459 Bacteria 11916
63 Ga0068867_100017279 3300005459 Bacteria 5123
64 Ga0068867_100285991 3300005459 Bacteria 1354
65 Ga0070706_100010899 3300005467 Bacteria 8437
66 Ga0070706_100026249 3300005467 Bacteria 5361
67 Ga0070706_100103787 3300005467 Bacteria 2643
68 Ga0070706_100167071 3300005467 Bacteria 2054
69 Ga0070707_100000971 3300005468 Bacteria 28355
70 Ga0070707_100032917 3300005468 Bacteria 4940
71 Ga0070707_100069183 3300005468 Bacteria 3398
72 Ga0070707_100093947 3300005468 Bacteria 2904
73 Ga0070707_100241843 3300005468 Bacteria 1757
74 Ga0070707_100243720 3300005468 Bacteria 1749
75 Ga0070707_100256603 3300005468 Bacteria 1701
76 Ga0070707_100311678 3300005468 Bacteria 1529
77 Ga0070698_100005995 3300005471 Bacteria 13251
78 Ga0070698_100044378 3300005471 Bacteria 4553
79 Ga0070698_100092817 3300005471 Bacteria 2999
80 Ga0070698_100364277 3300005471 Bacteria 1377
81 Ga0070699_100002124 3300005518 Bacteria 17975
82 Ga0070699_100004855 3300005518 Bacteria 11867
83 Ga0070699_100021259 3300005518 Bacteria 5596
84 Ga0070699_100027881 3300005518 Bacteria 4871
85 Ga0070699_100044628 3300005518 Bacteria 3837
86 Ga0070699_100175419 3300005518 Bacteria 1900
87 Ga0070699_100179459 3300005518 Bacteria 1879
88 Ga0070679_100001116 3300005530 Bacteria 23414
89 Ga0070679_100006668 3300005530 Bacteria 10764
90 Ga0070697_100001063 3300005536 Bacteria 20764
91 Ga0070697_100005384 3300005536 Bacteria 9849
92 Ga0070697_100023648 3300005536 Bacteria 4888
93 Ga0070697_100040278 3300005536 Bacteria 3779
94 Ga0070697_100053626 3300005536 Bacteria 3277
95 Ga0070697_100100317 3300005536 Bacteria 2404
96 Ga0070697_100113519 3300005536 Bacteria 2260
97 Ga0070697_100137676 3300005536 Bacteria 2051
98 Ga0070697_100197897 3300005536 Bacteria 1707
99 Ga0070697_100265060 3300005536 Bacteria 1471
100 Ga0068853_100000697 3300005539 Bacteria 23226
101 Ga0068853_100000940 3300005539 Bacteria 20409
102 Ga0070672_100006026 3300005543 Bacteria 8101
103 Ga0070695_100001716 3300005545 Bacteria 12333
104 Ga0070695_100010563 3300005545 Bacteria 5516
105 Ga0070695_100011637 3300005545 Bacteria 5265
106 Ga0070695_100022153 3300005545 Bacteria 3894
107 Ga0070695_100278110 3300005545 Bacteria 1229
108 Ga0070696_100000619 3300005546 Bacteria 22828
109 Ga0070696_100013708 3300005546 Bacteria 5443
110 Ga0070696_100029101 3300005546 Bacteria 3772
111 Ga0070696_100038946 3300005546 Bacteria 3282
112 Ga0070696_100076384 3300005546 Bacteria 2365
113 Ga0070696_100084321 3300005546 Bacteria 2254
114 Ga0070693_100000017 3300005547 Bacteria 62990
115 Ga0070693_100000058 3300005547 Bacteria 43221
116 Ga0070693_100183798 3300005547 Bacteria 1348
117 Ga0070704_100001317 3300005549 Bacteria 13139
118 Ga0070704_100006116 3300005549 Bacteria 7066
119 Ga0070704_100017013 3300005549 Bacteria 4612
120 Ga0070704_100024239 3300005549 Bacteria 3979
121 Ga0070704_100321035 3300005549 Bacteria 1297
122 Ga0068855_100002413 3300005563 Bacteria 23055
123 Ga0068855_100006700 3300005563 Bacteria 13976
124 Ga0070664_100002214 3300005564 Bacteria 15628
125 Ga0070664_100260801 3300005564 Bacteria 1559
126 Ga0068857_100087444 3300005577 Bacteria 2787
127 Ga0068854_100005389 3300005578 Bacteria 8074
128 Ga0068854_100034465 3300005578 Bacteria 3536
129 Ga0068856_100000929 3300005614 Bacteria 31390
130 Ga0068856_100003454 3300005614 Bacteria 15973
131 Ga0070702_100003973 3300005615 Bacteria 6707
132 Ga0070702_100318923 3300005615 Bacteria 1082
133 Ga0068852_100161235 3300005616 Bacteria 2094
134 Ga0068859_100001234 3300005617 Bacteria 26131
135 Ga0068859_100006591 3300005617 Bacteria 11785
136 Ga0068859_100247860 3300005617 Bacteria 1871
137 Ga0068864_100028108 3300005618 Bacteria 4752
138 Ga0068864_100035528 3300005618 Bacteria 4242
139 Ga0068861_100003185 3300005719 Bacteria 10857
140 Ga0068861_100007264 3300005719 Bacteria 7592
141 Ga0068861_100277330 3300005719 Bacteria 1442
142 Ga0068870_10000518 3300005840 Bacteria 14581
143 Ga0068870_10001484 3300005840 Bacteria 9499
144 Ga0068863_100044864 3300005841 Bacteria 4195
145 Ga0068863_100182269 3300005841 Bacteria 2016
146 Ga0068858_100317006 3300005842 Bacteria 1490
147 Ga0068860_100025685 3300005843 Bacteria 5681
148 Ga0068860_100027381 3300005843 Bacteria 5491
149 Ga0068862_100002103 3300005844 Bacteria 17946
150 Ga0068862_100028306 3300005844 Bacteria 4717
151 Ga0068862_100242256 3300005844 Bacteria 1640
152 Ga0081455_10001120 3300005937 Bacteria 33487
153 Ga0070716_100000651 3300006173 Bacteria 14747
154 Ga0070716_100006404 3300006173 Bacteria 5748
155 Ga0075428_100000435 3300006844 Bacteria 41534
156 Ga0075428_100039962 3300006844 Bacteria 5163
157 Ga0075428_100055095 3300006844 Bacteria 4358
158 Ga0075428_100149548 3300006844 Bacteria 2537
159 Ga0075430_100001040 3300006846 Bacteria 21918
160 Ga0075430_100001778 3300006846 Bacteria 17614
161 Ga0075430_100010088 3300006846 Bacteria 7993
162 Ga0075430_100011001 3300006846 Bacteria 7665
163 Ga0075431_100000876 3300006847 Bacteria 26465
164 Ga0075431_100002879 3300006847 Bacteria 16650
165 Ga0075431_100005232 3300006847 Bacteria 12772
166 Ga0075431_100024616 3300006847 Bacteria 6171
167 Ga0075431_100036183 3300006847 Bacteria 5085
168 Ga0075431_100042700 3300006847 Bacteria 4678
169 Ga0075431_100118578 3300006847 Bacteria 2731
170 Ga0075431_100162349 3300006847 Bacteria 2297
171 Ga0075431_100416224 3300006847 Bacteria 1343
172 Ga0075433_10002881 3300006852 Bacteria 13187
173 Ga0075433_10016321 3300006852 Bacteria 6115
174 Ga0075433_10026037 3300006852 Bacteria 4948
175 Ga0075433_10037138 3300006852 Bacteria 4200
176 Ga0075433_10191800 3300006852 Bacteria 1818
177 Ga0075434_100002983 3300006871 Bacteria 15057
178 Ga0075434_100004846 3300006871 Bacteria 12198
179 Ga0075434_100007646 3300006871 Bacteria 9995
180 Ga0075434_100055550 3300006871 Bacteria 3935
181 Ga0075434_100174030 3300006871 Bacteria 2172
182 Ga0075434_100555982 3300006871 Bacteria 1167
183 Ga0075429_100000189 3300006880 Bacteria 40717
184 Ga0075429_100093279 3300006880 Bacteria 2626
185 Ga0075429_100095804 3300006880 Bacteria 2588
186 Ga0075429_100111801 3300006880 Bacteria 2387
187 Ga0075429_100401753 3300006880 Bacteria 1200
188 Ga0075436_100003897 3300006914 Bacteria 10227
189 Ga0075436_100317213 3300006914 Bacteria 1119
190 Ga0097620_100001234 3300006931 Bacteria 26131
191 Ga0097620_100006591 3300006931 Bacteria 11785
192 Ga0097620_100247892 3300006931 Bacteria 1871
193 Ga0075435_100011106 3300007076 Bacteria 6606
194 Ga0075435_100011673 3300007076 Bacteria 6476
195 Ga0075435_100072862 3300007076 Bacteria 2807
196 Ga0075435_100242101 3300007076 Bacteria 1534
197 Ga0075435_100350961 3300007076 Bacteria 1264
198 Ga0099794_10002225 3300007265 Bacteria 7087
199 Ga0099794_10022947 3300007265 Bacteria 2849
200 Ga0099794_10051219 3300007265 Bacteria 1988
201 Ga0099794_10175639 3300007265 Bacteria 1092
202 Ga0111539_10000715 3300009094 Bacteria 43156
203 Ga0111539_10004715 3300009094 Bacteria 17823
204 Ga0111539_10677404 3300009094 Bacteria 1201
205 Ga0114129_10000839 3300009147 Bacteria 39797
206 Ga0114129_10003334 3300009147 Bacteria 22561
207 Ga0114129_10085057 3300009147 Bacteria 4389
208 Ga0114129_10085342 3300009147 Bacteria 4380
209 Ga0114129_10099619 3300009147 Unclassified 4022
210 Ga0114129_10189090 3300009147 Unclassified 2797
211 Ga0114129_10189192 3300009147 Bacteria 2796
212 Ga0114129_10334276 3300009147 Bacteria 2011
213 Ga0114129_10541997 3300009147 Bacteria 1514
214 Ga0114129_10586189 3300009147 Bacteria 1446
215 Ga0114129_10833391 3300009147 Bacteria 1174
216 Ga0105243_10052990 3300009148 Unclassified 3216
217 Ga0105241_10000582 3300009174 Bacteria 27518
218 Ga0105241_10006360 3300009174 Bacteria 8705
219 Ga0105242_10032796 3300009176 Bacteria 4155
220 Ga0105249_10420668 3300009553 Bacteria 1370
221 Ga0105249_10551684 3300009553 Bacteria 1203
222 Ga0105239_10097799 3300010375 Bacteria 3244
223 Ga0105239_10230837 3300010375 Bacteria 2076
224 Ga0105246_10057835 3300011119 Bacteria 2685
225 Ga0157373_10000229 3300013100 Bacteria 45851
226 Ga0157373_10001566 3300013100 Bacteria 17443
227 Ga0157371_10099595 3300013102 Bacteria 2061
228 Ga0157369_10009446 3300013105 Bacteria 11148
229 Ga0157378_10052922 3300013297 Bacteria 3613
230 Ga0157378_10172215 3300013297 Bacteria 2031
231 Ga0157372_10000144 3300013307 Bacteria 78166
232 Ga0157372_10001358 3300013307 Bacteria 26478
233 Ga0157375_10238878 3300013308 Bacteria 1976
234 Ga0182008_10114656 3300014497 Bacteria 1336
235 Ga0182007_10008367 3300015262 Bacteria 4257
236 Ga0206353_11287094 3300020082 Bacteria 1865
237 Ga0207653_10002270 3300025885 Bacteria 6124
238 Ga0207653_10003710 3300025885 Bacteria 4802
239 Ga0207688_10014419 3300025901 Bacteria 4297
240 Ga0207688_10106494 3300025901 Bacteria 1624
241 Ga0207685_10052401 3300025905 Bacteria 1581
242 Ga0207645_10000560 3300025907 Bacteria 30825
243 Ga0207645_10002372 3300025907 Bacteria 14853
244 Ga0207643_10001850 3300025908 Bacteria 11701
245 Ga0207643_10003015 3300025908 Bacteria 9077
246 Ga0207684_10000425 3300025910 Bacteria 56051
247 Ga0207684_10006212 3300025910 Bacteria 10907
248 Ga0207684_10019127 3300025910 Bacteria 5858
249 Ga0207684_10039752 3300025910 Bacteria 3988
250 Ga0207684_10151796 3300025910 Bacteria 1993
251 Ga0207654_10002320 3300025911 Bacteria 9769
252 Ga0207654_10010035 3300025911 Bacteria 4816
253 Ga0207707_10000091 3300025912 Bacteria 90540
254 Ga0207707_10000280 3300025912 Bacteria 54565
255 Ga0207660_10000076 3300025917 Bacteria 51418
256 Ga0207660_10028751 3300025917 Bacteria 3806
257 Ga0207662_10094096 3300025918 Bacteria 1847
258 Ga0207657_10000383 3300025919 Bacteria 46673
259 Ga0207657_10000925 3300025919 Bacteria 31095
260 Ga0207649_10004400 3300025920 Bacteria 7644
261 Ga0207652_10000681 3300025921 Bacteria 33162
262 Ga0207652_10003874 3300025921 Bacteria 12254
263 Ga0207646_10000645 3300025922 Bacteria 45262
264 Ga0207646_10003426 3300025922 Bacteria 17920
265 Ga0207646_10019390 3300025922 Bacteria 6323
266 Ga0207646_10031732 3300025922 Bacteria 4781
267 Ga0207646_10033764 3300025922 Bacteria 4626
268 Ga0207646_10077660 3300025922 Bacteria 2967
269 Ga0207646_10203454 3300025922 Bacteria 1789
270 Ga0207646_10283117 3300025922 Bacteria 1498
271 Ga0207646_10317596 3300025922 Bacteria 1407
272 Ga0207681_10020440 3300025923 Bacteria 4196
273 Ga0207681_10046982 3300025923 Bacteria 2905
274 Ga0207681_10057625 3300025923 Bacteria 2656
275 Ga0207687_10535001 3300025927 Bacteria 981
276 Ga0207690_10002609 3300025932 Bacteria 10867
277 Ga0207690_10010689 3300025932 Bacteria 5469
278 Ga0207706_10001349 3300025933 Bacteria 24531
279 Ga0207706_10002645 3300025933 Bacteria 17452
280 Ga0207706_10078506 3300025933 Bacteria 2903
281 Ga0207706_10184216 3300025933 Bacteria 1834
282 Ga0207709_10378491 3300025935 Bacteria 1077
283 Ga0207709_10426221 3300025935 Bacteria 1020
284 Ga0207670_10119416 3300025936 Bacteria 1914
285 Ga0207665_10010700 3300025939 Bacteria 6026
286 Ga0207665_10010772 3300025939 Bacteria 6002
287 Ga0207689_10000127 3300025942 Bacteria 64217
288 Ga0207689_10003443 3300025942 Bacteria 14446
289 Ga0207689_10010357 3300025942 Bacteria 8033
290 Ga0207689_10096028 3300025942 Bacteria 2434
291 Ga0207661_10286002 3300025944 Bacteria 1475
292 Ga0207679_10000422 3300025945 Bacteria 30232
293 Ga0207679_10051716 3300025945 Bacteria 3009
294 Ga0207667_10003623 3300025949 Bacteria 19056
295 Ga0207667_10004905 3300025949 Bacteria 16340
296 Ga0207651_10035392 3300025960 Bacteria 3246
297 Ga0207712_10107906 3300025961 Bacteria 2082
298 Ga0207668_10166288 3300025972 Bacteria 1725
299 Ga0207640_10014890 3300025981 Bacteria 4487
300 Ga0207640_10022120 3300025981 Bacteria 3800
301 Ga0207658_10198257 3300025986 Bacteria 1674
302 Ga0207677_10108607 3300026023 Bacteria 2061
303 Ga0207703_10141422 3300026035 Bacteria 2089
304 Ga0207703_10162945 3300026035 Bacteria 1954
305 Ga0207639_10001822 3300026041 Bacteria 14348
306 Ga0207678_10001588 3300026067 Bacteria 20904
307 Ga0207678_10020979 3300026067 Bacteria 5725
308 Ga0207702_10006321 3300026078 Bacteria 10234
309 Ga0207702_10010495 3300026078 Bacteria 7749
310 Ga0207641_10386263 3300026088 Bacteria 1342
311 Ga0207648_10001700 3300026089 Bacteria 24065
312 Ga0207648_10012559 3300026089 Bacteria 7924
313 Ga0207648_10080225 3300026089 Bacteria 2847
314 Ga0207648_10329403 3300026089 Bacteria 1373
315 Ga0207676_10053850 3300026095 Bacteria 3150
316 Ga0207676_10124520 3300026095 Bacteria 2180
317 Ga0207674_10000720 3300026116 Bacteria 43278
318 Ga0207674_10001080 3300026116 Bacteria 35457
319 Ga0207675_100004428 3300026118 Bacteria 13571
320 Ga0207675_100013405 3300026118 Bacteria 7649
321 Ga0207675_100157287 3300026118 Bacteria 2166
322 Ga0207698_10131559 3300026142 Bacteria 2139
323 Ga0209968_1000255 3300027526 Bacteria 9108
324 Ga0209588_1005137 3300027671 Bacteria 3733
325 Ga0209971_1000003 3300027682 Bacteria 110664
326 Ga0209966_1000149 3300027695 Bacteria 29724
327 Ga0209966_1008120 3300027695 Bacteria 1856
328 Ga0209998_10000004 3300027717 Bacteria 104862
329 Ga0207428_10000306 3300027907 Bacteria 65012
330 Ga0207428_10000631 3300027907 Bacteria 41443
331 Ga0207428_10216115 3300027907 Bacteria 1439
332 Ga0268265_10002124 3300028380 Bacteria 15369
333 Ga0268265_10003385 3300028380 Bacteria 11481
334 Ga0268264_10012691 3300028381 Bacteria 6935
335 Ga0268264_10172127 3300028381 Bacteria 1959
336 Ga0307408_100007207 3300031548 Bacteria 7355
337 Ga0307408_100041305 3300031548 Bacteria 3270
338 Ga0307416_100025069 3300032002 Bacteria 4366
339 Ga0373959_0000923 3300034820 Bacteria 4955
340 Ga0373928_0028550 3300035084 Unclassified 1222
341 Ga0373960_0000907 3300035121 Bacteria 6291
342 Ga0373960_0005416 3300035121 Bacteria 2956
343 Ga0373961_0026954 3300035241 Bacteria 1574
344 Ga0373931_0003204 3300035691 Bacteria 7303
345 Ga0395899_0019185 3300037312 Bacteria 5198
346 Ga0395898_0001915 3300037466 Bacteria 26488
347 Ga0395901_0000430 3300038443 Bacteria 49340
348 Ga0439448_0002836 3300042005 Bacteria 4744
349 Ga0439458_0012185 3300042157 Bacteria 1928
350 Ga0439435_0004869 3300042436 Bacteria 2919
351 Ga0439464_0009705 3300042439 Bacteria 2535
352 Ga0439460_0003260 3300042461 Bacteria 3926
353 Ga0451577_0003313 3300042876 Bacteria 18095
354 Ga0451577_0016518 3300042876 Bacteria 6833
355 Ga0451577_0016767 3300042876 Bacteria 6774
356 Ga0451577_0035032 3300042876 Bacteria 4522
357 Ga0453683_0006026 3300044673 Bacteria 8355
358 Ga0453683_0074102 3300044673 Bacteria 2131
359 Ga0453683_0109402 3300044673 Bacteria 1737
360 Ga0453684_0019600 3300044712 Bacteria 10281
361 Ga0453684_0020439 3300044712 Bacteria 9985
362 Ga0451576_0006637 3300045051 Bacteria 14133
363 Ga0451576_0006808 3300045051 Bacteria 13890
364 Ga0451576_0035484 3300045051 Bacteria 5289
365 Ga0451576_0050655 3300045051 Bacteria 4354
366 Ga0451576_0080942 3300045051 Bacteria 3378
367 Ga0451576_0105770 3300045051 Bacteria 2928
368 Ga0451576_0275122 3300045051 Bacteria 1760
369 Ga0495580_0010134 3300046472 Bacteria 7362
370 Ga0495670_0167605 3300046691 Bacteria 1156
371 Ga0496102_0044804 3300048905 Bacteria 4015
372 Ga0496102_0078503 3300048905 Bacteria 3039
373 Ga0496102_0131947 3300048905 Bacteria 2339
374 Ga0496106_0088302 3300048909 Bacteria 2390
375 Ga0496107_0114516 3300048910 Bacteria 1984
376 Ga0501036_0397787 3300049572 Bacteria 1149
377 Ga0501037_0045399 3300049573 Bacteria 3226
378 Ga0501037_0060145 3300049573 Bacteria 2771
379 Ga0501038_0033796 3300049574 Bacteria 4501
380 Ga0501039_0245938 3300049575 Bacteria 1407
381 Ga0501039_0381993 3300049575 Bacteria 1106
382 Ga0501040_0011006 3300049576 Bacteria 5916
383 Ga0501040_0011567 3300049576 Bacteria 5775
384 Ga0501040_0033069 3300049576 Bacteria 3501
385 Ga0501040_0093706 3300049576 Bacteria 2089
386 Ga0501040_0128768 3300049576 Bacteria 1779
387 Ga0501041_0005353 3300049577 Bacteria 7513
388 Ga0501041_0060877 3300049577 Bacteria 2311
389 Ga0501041_0088650 3300049577 Bacteria 1910
390 Ga0501041_0201305 3300049577 Bacteria 1248
391 Ga0501042_0008138 3300049578 Bacteria 6906
392 Ga0501042_0028348 3300049578 Bacteria 3944
393 Ga0501042_0041890 3300049578 Bacteria 3257
394 Ga0501042_0118392 3300049578 Bacteria 1907
395 Ga0501042_0139917 3300049578 Bacteria 1745
396 Ga0501046_0000303 3300049580 Bacteria 49710
397 Ga0501046_0016616 3300049580 Bacteria 6159
398 Ga0501046_0120963 3300049580 Bacteria 1992
399 Ga0501046_0331164 3300049580 Bacteria 1108
400 Ga0501047_0114303 3300049581 Bacteria 2581
401 Ga0501048_0013358 3300049582 Bacteria 6094
402 Ga0501072_0059825 3300049588 Bacteria 3004
403 Ga0501072_0112675 3300049588 Bacteria 2166
404 Ga0501073_0256792 3300049589 Bacteria 1206
405 Ga0501074_0007053 3300049590 Bacteria 8119
406 Ga0501075_0010023 3300049591 Bacteria 6648
407 Ga0501075_0017718 3300049591 Bacteria 5143
408 Ga0501075_0067392 3300049591 Bacteria 2703
409 Ga0501075_0089619 3300049591 Bacteria 2332
410 Ga0501075_0142127 3300049591 Bacteria 1829
411 Ga0501075_0187553 3300049591 Unclassified 1577
412 Ga0501076_0023088 3300049592 Bacteria 4789
413 Ga0501076_0030464 3300049592 Bacteria 4202
414 Ga0501076_0049908 3300049592 Bacteria 3310
415 Ga0501076_0103186 3300049592 Bacteria 2300
416 Ga0501076_0107315 3300049592 Bacteria 2255
417 Ga0501076_0116392 3300049592 Bacteria 2163
418 Ga0501076_0440830 3300049592 Bacteria 1072
419 Ga0501077_0027974 3300049593 Bacteria 3583
420 Ga0501077_0033808 3300049593 Bacteria 3255
421 Ga0501077_0044964 3300049593 Bacteria 2805
422 Ga0501077_0057419 3300049593 Bacteria 2471
423 Ga0501077_0064175 3300049593 Bacteria 2330
424 Ga0501077_0098574 3300049593 Bacteria 1852
425 Ga0501077_0099173 3300049593 Bacteria 1846
426 Ga0501079_0000600 3300049741 Bacteria 23913
427 Ga0501079_0001407 3300049741 Bacteria 16936
428 Ga0501079_0168238 3300049741 Bacteria 1709
429 Ga0501079_0348551 3300049741 Bacteria 1160
430 Ga0501080_0037951 3300049742 Bacteria 4499
431 Ga0501080_0138936 3300049742 Bacteria 2247
432 Ga0501080_0224919 3300049742 Bacteria 1716
433 Ga0501081_0002259 3300049743 Bacteria 12118
434 Ga0501081_0011090 3300049743 Bacteria 5894
435 Ga0501081_0064098 3300049743 Bacteria 2552
436 Ga0501081_0090487 3300049743 Bacteria 2151
437 Ga0501083_0007814 3300049744 Bacteria 7577
438 Ga0501083_0063970 3300049744 Bacteria 2453
439 Ga0501035_0188674 3300049822 Bacteria 1773
440 Ga0501045_0012296 3300049824 Bacteria 6028
441 Ga0501045_0081462 3300049824 Bacteria 2387
442 nmdc:mga05p37_11406_c1 3300050507 Bacteria 10578
443 nmdc:mga05p37_143110_c1 3300050507 Bacteria 2929
444 nmdc:mga05p37_143923_c1 3300050507 Bacteria 2920
445 nmdc:mga05p37_20197_c1 3300050507 Bacteria 8062
446 nmdc:mga05p37_24360_c1 3300050507 Bacteria 7354
447 nmdc:mga05p37_271002_c1 3300050507 Bacteria 2028
448 nmdc:mga05p37_446207_c1 3300050507 Bacteria 1499
449 nmdc:mga05p37_453472_c1 3300050507 Bacteria 1484
450 nmdc:mga05p37_63216_c1 3300050507 Bacteria 4555
451 nmdc:mga05p37_797339_c1 3300050507 Bacteria 1034
452 nmdc:mga05p37_94337_c1 3300050507 Bacteria 3687
453 nmdc:mga09592_20256_c1 3300050508 Bacteria 5467
454 nmdc:mga09592_216637_c1 3300050508 Bacteria 1659
455 nmdc:mga09592_282516_c1 3300050508 Bacteria 1440
456 nmdc:mga09592_311024_c1 3300050508 Unclassified 1365
457 nmdc:mga09592_312823_c1 3300050508 Bacteria 1361
458 nmdc:mga09592_601_c1 3300050508 Bacteria 27297
459 nmdc:mga0qj67_1405_c1 3300050509 Bacteria 16858
460 nmdc:mga0qj67_20036_c1 3300050509 Bacteria 5118
461 nmdc:mga0qj67_59377_c1 3300050509 Bacteria 3033
462 nmdc:mga06r32_13298_c1 3300050510 Bacteria 7453
463 nmdc:mga06r32_205_c1 3300050510 Bacteria 47453
464 nmdc:mga06r32_24025_c1 3300050510 Bacteria 5651
465 nmdc:mga06r32_49784_c1 3300050510 Bacteria 4008
466 nmdc:mga06r32_67230_c1 3300050510 Bacteria 3460
467 nmdc:mga06r32_90681_c1 3300050510 Bacteria 2986
468 nmdc:mga08y16_12593_c1 3300050511 Bacteria 8897
469 nmdc:mga08y16_14092_c1 3300050511 Bacteria 8416
470 nmdc:mga08y16_23990_c1 3300050511 Bacteria 6442
471 nmdc:mga08y16_305319_c1 3300050511 Bacteria 1640
472 nmdc:mga0n895_271704_c1 3300050512 Bacteria 1719
473 nmdc:mga0n895_3639_c1 3300050512 Bacteria 12462
474 nmdc:mga0n895_376073_c1 3300050512 Bacteria 1438
475 nmdc:mga0n895_41216_c1 3300050512 Bacteria 4488
476 nmdc:mga0n895_41613_c1 3300050512 Bacteria 4468
477 nmdc:mga0n895_59945_c1 3300050512 Bacteria 3755
478 nmdc:mga0n895_82189_c1 3300050512 Bacteria 3211
479 nmdc:mga0rr50_11178_c1 3300050513 Bacteria 5729
480 nmdc:mga0rr50_129004_c1 3300050513 Bacteria 2022
481 nmdc:mga0rr50_28522_c1 3300050513 Bacteria 3925
482 nmdc:mga0rr50_39917_c1 3300050513 Bacteria 3408
483 nmdc:mga0rr50_94021_c1 3300050513 Bacteria 2340
484 nmdc:mga08x19_20879_c1 3300050514 Bacteria 4037
485 nmdc:mga08x19_28556_c1 3300050514 Bacteria 3494
486 nmdc:mga08x19_59940_c1 3300050514 Bacteria 2465
487 nmdc:mga0a205_11449_c1 3300050515 Bacteria 8167
488 nmdc:mga0a205_140552_c1 3300050515 Bacteria 2315
489 nmdc:mga0a205_48508_c1 3300050515 Bacteria 4098
490 nmdc:mga0a205_62377_c1 3300050515 Bacteria 3601
491 nmdc:mga0a205_75939_c1 3300050515 Bacteria 3247
492 nmdc:mga0a205_8013_c1 3300050515 Bacteria 9601
493 Ga0501084_0002736 3300054114 Bacteria 14225
494 Ga0501084_0005319 3300054114 Bacteria 10540
495 Ga0501084_0007675 3300054114 Bacteria 8887
496 Ga0501084_0065189 3300054114 Bacteria 3047
497 Ga0501084_0106464 3300054114 Bacteria 2356
498 Ga0501084_0222984 3300054114 Bacteria 1591
499 Ga0501084_0287252 3300054114 Bacteria 1389
500 Ga0501082_0000212 3300060353 Bacteria 50890
501 Ga0501082_0066220 3300060353 Bacteria 3111
502 Ga0501082_0083794 3300060353 Bacteria 2750
503 Ga0530510_0205517 3300061734 Bacteria 1463
504 Ga0530510_0223776 3300061734 Unclassified 1399
505 Ga0530510_0255797 3300061734 Bacteria 1305
506 Ga0530510_0291587 3300061734 Bacteria 1220

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0098574 Ga0501077_0098574_1023_1841 258
2 3300049593 Ga0501077_0064175 Ga0501077_0064175_33_893 264
3 3300026035 Ga0207703_10141422 Ga0207703_101414222 273
4 iso_pu_bacteria 2929199973 2929201493 278
5 iso_pu_bacteria 8055909800 8055915696 278
6 3300005440 Ga0070705_100214645 Ga0070705_1002146451 280
7 3300005468 Ga0070707_100243720 Ga0070707_1002437202 280
8 3300005471 Ga0070698_100092817 Ga0070698_1000928172 280
9 3300005518 Ga0070699_100027881 Ga0070699_1000278813 280
10 3300007265 Ga0099794_10175639 Ga0099794_101756392 280
11 3300025922 Ga0207646_10283117 Ga0207646_102831171 280
12 3300005467 Ga0070706_100010899 Ga0070706_1000108995 282
13 3300005468 Ga0070707_100069183 Ga0070707_1000691833 282
14 3300005471 Ga0070698_100044378 Ga0070698_1000443783 282
15 3300005518 Ga0070699_100004855 Ga0070699_1000048553 282
16 3300005536 Ga0070697_100040278 Ga0070697_1000402782 282
17 3300005545 Ga0070695_100278110 Ga0070695_1002781101 282
18 3300005937 Ga0081455_10001120 Ga0081455_1000112012 282
19 3300006173 Ga0070716_100000651 Ga0070716_1000006513 282
20 3300006852 Ga0075433_10026037 Ga0075433_100260372 282
21 3300025922 Ga0207646_10077660 Ga0207646_100776603 282
22 3300025939 Ga0207665_10010772 Ga0207665_100107723 282
23 3300027695 Ga0209966_1008120 Ga0209966_10081201 282
24 3300044673 Ga0453683_0006026 Ga0453683_0006026_4282_5181 282
25 3300050507 nmdc:mga05p37_143110_c1 nmdc:mga05p37_143110_c1_227_1138 282
26 3300050508 nmdc:mga09592_216637_c1 nmdc:mga09592_216637_c1_526_1416 282
27 3300050512 nmdc:mga0n895_41216_c1 nmdc:mga0n895_41216_c1_2781_3674 282
28 3300050514 nmdc:mga08x19_59940_c1 nmdc:mga08x19_59940_c1_1346_2239 282
29 3300050515 nmdc:mga0a205_11449_c1 nmdc:mga0a205_11449_c1_445_1338 282
30 3300005334 Ga0068869_100005949 Ga0068869_1000059497 283
31 3300005545 Ga0070695_100010563 Ga0070695_1000105636 283
32 3300005546 Ga0070696_100038946 Ga0070696_1000389463 283
33 3300005719 Ga0068861_100277330 Ga0068861_1002773302 283
34 3300007265 Ga0099794_10002225 Ga0099794_100022256 283
35 3300009553 Ga0105249_10420668 Ga0105249_104206681 283
36 3300025942 Ga0207689_10010357 Ga0207689_100103578 283
37 3300025961 Ga0207712_10107906 Ga0207712_101079062 283
38 3300026118 Ga0207675_100157287 Ga0207675_1001572873 283
39 3300005444 Ga0070694_100003863 Ga0070694_1000038634 284
40 3300005445 Ga0070708_100018070 Ga0070708_1000180701 284
41 3300005445 Ga0070708_100035069 Ga0070708_1000350693 284
42 3300005467 Ga0070706_100026249 Ga0070706_1000262492 284
43 3300005467 Ga0070706_100103787 Ga0070706_1001037872 284
44 3300005468 Ga0070707_100032917 Ga0070707_1000329173 284
45 3300005468 Ga0070707_100093947 Ga0070707_1000939473 284
46 3300005471 Ga0070698_100005995 Ga0070698_1000059957 284
47 3300005471 Ga0070698_100364277 Ga0070698_1003642772 284
48 3300005518 Ga0070699_100175419 Ga0070699_1001754192 284
49 3300005536 Ga0070697_100001063 Ga0070697_10000106322 284
50 3300006880 Ga0075429_100093279 Ga0075429_1000932793 284
51 3300025910 Ga0207684_10000425 Ga0207684_1000042518 284
52 3300025922 Ga0207646_10000645 Ga0207646_1000064511 284
53 3300025922 Ga0207646_10031732 Ga0207646_100317323 284
54 3300025922 Ga0207646_10317596 Ga0207646_103175962 284
55 3300042876 Ga0451577_0016518 Ga0451577_0016518_5470_6384 284
56 3300044673 Ga0453683_0109402 Ga0453683_0109402_192_1106 284
57 3300044712 Ga0453684_0019600 Ga0453684_0019600_5984_6898 284
58 3300045051 Ga0451576_0035484 Ga0451576_0035484_2386_3318 284
59 3300045051 Ga0451576_0275122 Ga0451576_0275122_654_1568 284
60 3300049580 Ga0501046_0331164 Ga0501046_0331164_138_1040 284
61 3300049591 Ga0501075_0089619 Ga0501075_0089619_1140_2042 284
62 3300049592 Ga0501076_0116392 Ga0501076_0116392_237_1139 284
63 3300049593 Ga0501077_0044964 Ga0501077_0044964_781_1683 284
64 3300049741 Ga0501079_0168238 Ga0501079_0168238_70_972 284
65 3300049742 Ga0501080_0224919 Ga0501080_0224919_736_1638 284
66 3300050508 nmdc:mga09592_311024_c1 nmdc:mga09592_311024_c1_298_1239 284
67 3300054114 Ga0501084_0065189 Ga0501084_0065189_52_954 284
68 3300005445 Ga0070708_100016456 Ga0070708_1000164567 285
69 3300005518 Ga0070699_100179459 Ga0070699_1001794592 285
70 3300006844 Ga0075428_100039962 Ga0075428_1000399625 285
71 3300006846 Ga0075430_100001778 Ga0075430_1000017783 285
72 3300006847 Ga0075431_100005232 Ga0075431_1000052323 285
73 3300009147 Ga0114129_10003334 Ga0114129_1000333422 285
74 3300025910 Ga0207684_10039752 Ga0207684_100397523 285
75 3300050507 nmdc:mga05p37_11406_c1 nmdc:mga05p37_11406_c1_4898_5824 285
76 3300050509 nmdc:mga0qj67_20036_c1 nmdc:mga0qj67_20036_c1_3147_4073 285
77 3300050510 nmdc:mga06r32_13298_c1 nmdc:mga06r32_13298_c1_1530_2456 285
78 3300005615 Ga0070702_100318923 Ga0070702_1003189231 286
79 3300025922 Ga0207646_10019390 Ga0207646_100193904 286
80 3300005440 Ga0070705_100228853 Ga0070705_1002288532 287
81 3300005444 Ga0070694_100013182 Ga0070694_1000131823 287
82 3300005536 Ga0070697_100265060 Ga0070697_1002650602 287
83 3300005547 Ga0070693_100183798 Ga0070693_1001837982 287
84 3300005549 Ga0070704_100017013 Ga0070704_1000170133 287
85 3300005617 Ga0068859_100006591 Ga0068859_10000659112 287
86 3300006871 Ga0075434_100007646 Ga0075434_1000076468 287
87 3300006931 Ga0097620_100006591 Ga0097620_10000659112 287
88 3300025942 Ga0207689_10096028 Ga0207689_100960282 287
89 3300048905 Ga0496102_0044804 Ga0496102_0044804_1081_2007 287
90 3300048909 Ga0496106_0088302 Ga0496106_0088302_1375_2301 287
91 3300049572 Ga0501036_0397787 Ga0501036_0397787_38_973 287
92 3300049573 Ga0501037_0045399 Ga0501037_0045399_2126_3061 287
93 3300049576 Ga0501040_0011567 Ga0501040_0011567_2264_3199 287
94 3300049578 Ga0501042_0028348 Ga0501042_0028348_1981_2916 287
95 3300049591 Ga0501075_0187553 Ga0501075_0187553_573_1508 287
96 3300049592 Ga0501076_0023088 Ga0501076_0023088_1373_2308 287
97 3300049743 Ga0501081_0011090 Ga0501081_0011090_1988_2923 287
98 3300049822 Ga0501035_0188674 Ga0501035_0188674_161_1096 287
99 3300049824 Ga0501045_0012296 Ga0501045_0012296_2013_2948 287
100 3300050512 nmdc:mga0n895_3639_c1 nmdc:mga0n895_3639_c1_4192_5121 287
101 3300050515 nmdc:mga0a205_62377_c1 nmdc:mga0a205_62377_c1_1171_2100 287
102 3300054114 Ga0501084_0005319 Ga0501084_0005319_6525_7460 287
103 3300061734 Ga0530510_0205517 Ga0530510_0205517_293_1228 287
104 3300061734 Ga0530510_0223776 Ga0530510_0223776_403_1338 287
105 3300005331 Ga0070670_100003552 Ga0070670_1000035526 288
106 3300005333 Ga0070677_10113234 Ga0070677_101132341 288
107 3300005334 Ga0068869_100000441 Ga0068869_10000044113 288
108 3300005335 Ga0070666_10129598 Ga0070666_101295982 288
109 3300005336 Ga0070680_100001037 Ga0070680_1000010372 288
110 3300005337 Ga0070682_100000441 Ga0070682_1000004416 288
111 3300005338 Ga0068868_100011295 Ga0068868_1000112954 288
112 3300005339 Ga0070660_100000167 Ga0070660_1000001674 288
113 3300005340 Ga0070689_100010529 Ga0070689_1000105292 288
114 3300005341 Ga0070691_10010735 Ga0070691_100107353 288
115 3300005343 Ga0070687_100018536 Ga0070687_1000185363 288
116 3300005344 Ga0070661_100019188 Ga0070661_1000191883 288
117 3300005345 Ga0070692_10000218 Ga0070692_1000021813 288
118 3300005366 Ga0070659_100001067 Ga0070659_10000106712 288
119 3300005406 Ga0070703_10002309 Ga0070703_100023093 288
120 3300005438 Ga0070701_10041255 Ga0070701_100412552 288
121 3300005440 Ga0070705_100000739 Ga0070705_10000073914 288
122 3300005444 Ga0070694_100000546 Ga0070694_1000005463 288
123 3300005455 Ga0070663_100002687 Ga0070663_1000026876 288
124 3300005457 Ga0070662_100007954 Ga0070662_1000079542 288
125 3300005458 Ga0070681_10017635 Ga0070681_100176356 288
126 3300005459 Ga0068867_100002988 Ga0068867_1000029889 288
127 3300005530 Ga0070679_100001116 Ga0070679_1000011165 288
128 3300005539 Ga0068853_100000940 Ga0068853_10000094015 288
129 3300005545 Ga0070695_100001716 Ga0070695_1000017168 288
130 3300005546 Ga0070696_100000619 Ga0070696_1000006198 288
131 3300005547 Ga0070693_100000058 Ga0070693_10000005834 288
132 3300005549 Ga0070704_100006116 Ga0070704_1000061162 288
133 3300005563 Ga0068855_100002413 Ga0068855_10000241314 288
134 3300005564 Ga0070664_100002214 Ga0070664_1000022148 288
135 3300005577 Ga0068857_100087444 Ga0068857_1000874442 288
136 3300005578 Ga0068854_100034465 Ga0068854_1000344653 288
137 3300005614 Ga0068856_100000929 Ga0068856_10000092915 288
138 3300005615 Ga0070702_100003973 Ga0070702_1000039736 288
139 3300005616 Ga0068852_100161235 Ga0068852_1001612352 288
140 3300005618 Ga0068864_100028108 Ga0068864_1000281085 288
141 3300005719 Ga0068861_100003185 Ga0068861_1000031856 288
142 3300005840 Ga0068870_10000518 Ga0068870_100005185 288
143 3300005841 Ga0068863_100044864 Ga0068863_1000448643 288
144 3300005842 Ga0068858_100317006 Ga0068858_1003170062 288
145 3300005843 Ga0068860_100025685 Ga0068860_1000256852 288
146 3300005844 Ga0068862_100002103 Ga0068862_1000021033 288
147 3300005844 Ga0068862_100242256 Ga0068862_1002422562 288
148 3300006852 Ga0075433_10191800 Ga0075433_101918002 288
149 3300006871 Ga0075434_100055550 Ga0075434_1000555504 288
150 3300006871 Ga0075434_100174030 Ga0075434_1001740302 288
151 3300007076 Ga0075435_100072862 Ga0075435_1000728622 288
152 3300007076 Ga0075435_100242101 Ga0075435_1002421011 288
153 3300009094 Ga0111539_10000715 Ga0111539_1000071511 288
154 3300009147 Ga0114129_10085342 Ga0114129_100853423 288
155 3300009174 Ga0105241_10000582 Ga0105241_1000058214 288
156 3300010375 Ga0105239_10097799 Ga0105239_100977994 288
157 3300013100 Ga0157373_10000229 Ga0157373_100002295 288
158 3300013102 Ga0157371_10099595 Ga0157371_100995952 288
159 3300013105 Ga0157369_10009446 Ga0157369_100094465 288
160 3300013307 Ga0157372_10000144 Ga0157372_1000014417 288
161 3300013308 Ga0157375_10238878 Ga0157375_102388782 288
162 3300015262 Ga0182007_10008367 Ga0182007_100083673 288
163 3300020082 Ga0206353_11287094 Ga0206353_112870941 288
164 3300025885 Ga0207653_10002270 Ga0207653_100022702 288
165 3300025901 Ga0207688_10014419 Ga0207688_100144192 288
166 3300025907 Ga0207645_10000560 Ga0207645_1000056017 288
167 3300025908 Ga0207643_10001850 Ga0207643_100018505 288
168 3300025911 Ga0207654_10002320 Ga0207654_100023203 288
169 3300025912 Ga0207707_10000280 Ga0207707_1000028015 288
170 3300025917 Ga0207660_10000076 Ga0207660_100000766 288
171 3300025919 Ga0207657_10000383 Ga0207657_1000038316 288
172 3300025920 Ga0207649_10004400 Ga0207649_100044008 288
173 3300025921 Ga0207652_10000681 Ga0207652_1000068119 288
174 3300025932 Ga0207690_10002609 Ga0207690_1000260912 288
175 3300025933 Ga0207706_10001349 Ga0207706_1000134922 288
176 3300025933 Ga0207706_10078506 Ga0207706_100785062 288
177 3300025936 Ga0207670_10119416 Ga0207670_101194162 288
178 3300025942 Ga0207689_10000127 Ga0207689_1000012742 288
179 3300025944 Ga0207661_10286002 Ga0207661_102860021 288
180 3300025945 Ga0207679_10000422 Ga0207679_100004227 288
181 3300025949 Ga0207667_10003623 Ga0207667_1000362318 288
182 3300025981 Ga0207640_10014890 Ga0207640_100148902 288
183 3300026041 Ga0207639_10001822 Ga0207639_100018226 288
184 3300026067 Ga0207678_10001588 Ga0207678_1000158815 288
185 3300026078 Ga0207702_10006321 Ga0207702_1000632110 288
186 3300026089 Ga0207648_10001700 Ga0207648_1000170013 288
187 3300026095 Ga0207676_10053850 Ga0207676_100538503 288
188 3300026116 Ga0207674_10000720 Ga0207674_100007207 288
189 3300026118 Ga0207675_100004428 Ga0207675_1000044286 288
190 3300026142 Ga0207698_10131559 Ga0207698_101315592 288
191 3300027907 Ga0207428_10000631 Ga0207428_1000063133 288
192 3300028380 Ga0268265_10003385 Ga0268265_100033852 288
193 3300028381 Ga0268264_10012691 Ga0268264_100126914 288
194 3300031548 Ga0307408_100007207 Ga0307408_1000072076 288
195 3300032002 Ga0307416_100025069 Ga0307416_1000250694 288
196 3300035121 Ga0373960_0000907 Ga0373960_0000907_2013_2939 288
197 3300042876 Ga0451577_0003313 Ga0451577_0003313_10027_10950 288
198 3300042876 Ga0451577_0035032 Ga0451577_0035032_651_1577 288
199 3300044673 Ga0453683_0074102 Ga0453683_0074102_244_1167 288
200 3300044712 Ga0453684_0020439 Ga0453684_0020439_5024_5947 288
201 3300045051 Ga0451576_0006637 Ga0451576_0006637_5440_6363 288
202 3300045051 Ga0451576_0105770 Ga0451576_0105770_1405_2328 288
203 3300048905 Ga0496102_0078503 Ga0496102_0078503_981_1907 288
204 3300050507 nmdc:mga05p37_797339_c1 nmdc:mga05p37_797339_c1_86_1024 288
205 3300050507 nmdc:mga05p37_94337_c1 nmdc:mga05p37_94337_c1_2573_3499 288
206 3300050511 nmdc:mga08y16_12593_c1 nmdc:mga08y16_12593_c1_6317_7240 288
207 3300050513 nmdc:mga0rr50_39917_c1 nmdc:mga0rr50_39917_c1_2382_3320 288
208 3300050513 nmdc:mga0rr50_94021_c1 nmdc:mga0rr50_94021_c1_135_1061 288
209 3300050515 nmdc:mga0a205_75939_c1 nmdc:mga0a205_75939_c1_2226_3152 288
210 3300006844 Ga0075428_100149548 Ga0075428_1001495482 289
211 3300006871 Ga0075434_100002983 Ga0075434_1000029835 289
212 3300009147 Ga0114129_10099619 Ga0114129_100996192 289
213 3300027907 Ga0207428_10216115 Ga0207428_102161151 289
214 3300050511 nmdc:mga08y16_23990_c1 nmdc:mga08y16_23990_c1_1178_2104 289
215 3300050512 nmdc:mga0n895_82189_c1 nmdc:mga0n895_82189_c1_2219_3145 289
216 3300050513 nmdc:mga0rr50_129004_c1 nmdc:mga0rr50_129004_c1_767_1693 289
217 3300050515 nmdc:mga0a205_8013_c1 nmdc:mga0a205_8013_c1_1439_2365 289
218 3300006871 Ga0075434_100555982 Ga0075434_1005559821 290
219 3300006844 Ga0075428_100000435 Ga0075428_10000043525 292
220 3300006846 Ga0075430_100010088 Ga0075430_1000100883 292
221 3300006847 Ga0075431_100024616 Ga0075431_1000246162 292
222 3300006880 Ga0075429_100000189 Ga0075429_10000018933 292
223 3300050508 nmdc:mga09592_601_c1 nmdc:mga09592_601_c1_12282_13220 292
224 3300050509 nmdc:mga0qj67_59377_c1 nmdc:mga0qj67_59377_c1_485_1423 292
225 3300050510 nmdc:mga06r32_24025_c1 nmdc:mga06r32_24025_c1_4502_5440 292
226 3300006847 Ga0075431_100042700 Ga0075431_1000427006 293
227 3300007265 Ga0099794_10022947 Ga0099794_100229474 293
228 3300009147 Ga0114129_10000839 Ga0114129_1000083918 293
229 3300050507 nmdc:mga05p37_20197_c1 nmdc:mga05p37_20197_c1_4466_5401 293
230 3300050510 nmdc:mga06r32_49784_c1 nmdc:mga06r32_49784_c1_476_1411 293
231 3300005438 Ga0070701_10134015 Ga0070701_101340152 294
232 3300005546 Ga0070696_100076384 Ga0070696_1000763842 294
233 3300006847 Ga0075431_100118578 Ga0075431_1001185783 294
234 3300006914 Ga0075436_100003897 Ga0075436_10000389711 294
235 3300026089 Ga0207648_10080225 Ga0207648_100802252 294
236 3300050507 nmdc:mga05p37_453472_c1 nmdc:mga05p37_453472_c1_106_1047 294
237 3300050512 nmdc:mga0n895_271704_c1 nmdc:mga0n895_271704_c1_531_1457 294
238 3300050514 nmdc:mga08x19_28556_c1 nmdc:mga08x19_28556_c1_237_1178 294
239 3300005353 Ga0070669_100538489 Ga0070669_1005384891 295
240 3300005445 Ga0070708_100048210 Ga0070708_1000482103 295
241 3300005518 Ga0070699_100021259 Ga0070699_1000212593 295
242 3300005536 Ga0070697_100005384 Ga0070697_1000053846 295
243 3300005341 Ga0070691_10080439 Ga0070691_100804392 296
244 3300005345 Ga0070692_10070619 Ga0070692_100706191 296
245 3300005440 Ga0070705_100066520 Ga0070705_1000665201 296
246 3300005459 Ga0068867_100285991 Ga0068867_1002859911 296
247 3300005468 Ga0070707_100000971 Ga0070707_10000097121 296
248 3300005468 Ga0070707_100241843 Ga0070707_1002418432 296
249 3300005518 Ga0070699_100002124 Ga0070699_1000021249 296
250 3300005536 Ga0070697_100023648 Ga0070697_1000236485 296
251 3300005546 Ga0070696_100084321 Ga0070696_1000843212 296
252 3300005549 Ga0070704_100024239 Ga0070704_1000242395 296
253 3300006844 Ga0075428_100055095 Ga0075428_1000550955 296
254 3300006847 Ga0075431_100416224 Ga0075431_1004162242 296
255 3300009094 Ga0111539_10677404 Ga0111539_106774041 296
256 3300009147 Ga0114129_10189090 Ga0114129_101890902 296
257 3300009147 Ga0114129_10334276 Ga0114129_103342762 296
258 3300009148 Ga0105243_10052990 Ga0105243_100529903 296
259 3300009176 Ga0105242_10032796 Ga0105242_100327964 296
260 3300025910 Ga0207684_10019127 Ga0207684_100191275 296
261 3300025922 Ga0207646_10003426 Ga0207646_1000342619 296
262 3300025927 Ga0207687_10535001 Ga0207687_105350011 296
263 3300025935 Ga0207709_10378491 Ga0207709_103784912 296
264 3300026089 Ga0207648_10329403 Ga0207648_103294031 296
265 3300028381 Ga0268264_10172127 Ga0268264_101721271 296
266 3300049576 Ga0501040_0128768 Ga0501040_0128768_161_1117 296
267 3300049577 Ga0501041_0088650 Ga0501041_0088650_762_1724 296
268 3300049591 Ga0501075_0067392 Ga0501075_0067392_1643_2599 296
269 3300049592 Ga0501076_0107315 Ga0501076_0107315_113_1069 296
270 3300049741 Ga0501079_0348551 Ga0501079_0348551_49_1011 296
271 3300049743 Ga0501081_0090487 Ga0501081_0090487_174_1136 296
272 3300050507 nmdc:mga05p37_271002_c1 nmdc:mga05p37_271002_c1_524_1462 296
273 3300005328 Ga0070676_10008554 Ga0070676_100085543 298
274 3300005330 Ga0070690_100143938 Ga0070690_1001439382 298
275 3300005330 Ga0070690_100222469 Ga0070690_1002224692 298
276 3300005331 Ga0070670_100091510 Ga0070670_1000915103 298
277 3300005334 Ga0068869_100083013 Ga0068869_1000830132 298
278 3300005336 Ga0070680_100003438 Ga0070680_1000034383 298
279 3300005337 Ga0070682_100000431 Ga0070682_1000004312 298
280 3300005339 Ga0070660_100002407 Ga0070660_1000024071 298
281 3300005340 Ga0070689_100010334 Ga0070689_1000103345 298
282 3300005341 Ga0070691_10033127 Ga0070691_100331272 298
283 3300005345 Ga0070692_10003682 Ga0070692_100036823 298
284 3300005353 Ga0070669_100011936 Ga0070669_1000119362 298
285 3300005353 Ga0070669_100207673 Ga0070669_1002076732 298
286 3300005364 Ga0070673_100007386 Ga0070673_1000073862 298
287 3300005366 Ga0070659_100000748 Ga0070659_1000007486 298
288 3300005434 Ga0070709_10061206 Ga0070709_100612063 298
289 3300005440 Ga0070705_100001807 Ga0070705_1000018077 298
290 3300005440 Ga0070705_100017019 Ga0070705_1000170194 298
291 3300005441 Ga0070700_100025850 Ga0070700_1000258502 298
292 3300005444 Ga0070694_100000520 Ga0070694_10000052011 298
293 3300005445 Ga0070708_100187734 Ga0070708_1001877342 298
294 3300005445 Ga0070708_100189544 Ga0070708_1001895442 298
295 3300005445 Ga0070708_100254680 Ga0070708_1002546802 298
296 3300005455 Ga0070663_100000680 Ga0070663_10000068020 298
297 3300005457 Ga0070662_100117784 Ga0070662_1001177843 298
298 3300005458 Ga0070681_10165867 Ga0070681_101658673 298
299 3300005459 Ga0068867_100017279 Ga0068867_1000172795 298
300 3300005467 Ga0070706_100167071 Ga0070706_1001670712 298
301 3300005468 Ga0070707_100256603 Ga0070707_1002566032 298
302 3300005468 Ga0070707_100311678 Ga0070707_1003116782 298
303 3300005518 Ga0070699_100044628 Ga0070699_1000446283 298
304 3300005530 Ga0070679_100006668 Ga0070679_1000066688 298
305 3300005536 Ga0070697_100053626 Ga0070697_1000536263 298
306 3300005536 Ga0070697_100100317 Ga0070697_1001003173 298
307 3300005536 Ga0070697_100113519 Ga0070697_1001135193 298
308 3300005536 Ga0070697_100137676 Ga0070697_1001376762 298
309 3300005536 Ga0070697_100197897 Ga0070697_1001978972 298
310 3300005539 Ga0068853_100000697 Ga0068853_10000069717 298
311 3300005543 Ga0070672_100006026 Ga0070672_1000060267 298
312 3300005545 Ga0070695_100011637 Ga0070695_1000116372 298
313 3300005545 Ga0070695_100022153 Ga0070695_1000221532 298
314 3300005546 Ga0070696_100013708 Ga0070696_1000137083 298
315 3300005546 Ga0070696_100029101 Ga0070696_1000291012 298
316 3300005547 Ga0070693_100000017 Ga0070693_10000001760 298
317 3300005549 Ga0070704_100001317 Ga0070704_1000013175 298
318 3300005549 Ga0070704_100321035 Ga0070704_1003210351 298
319 3300005563 Ga0068855_100006700 Ga0068855_1000067003 298
320 3300005564 Ga0070664_100260801 Ga0070664_1002608012 298
321 3300005578 Ga0068854_100005389 Ga0068854_1000053892 298
322 3300005614 Ga0068856_100003454 Ga0068856_10000345417 298
323 3300005617 Ga0068859_100001234 Ga0068859_10000123421 298
324 3300005617 Ga0068859_100247860 Ga0068859_1002478602 298
325 3300005618 Ga0068864_100035528 Ga0068864_1000355283 298
326 3300005719 Ga0068861_100007264 Ga0068861_1000072643 298
327 3300005840 Ga0068870_10001484 Ga0068870_100014842 298
328 3300005841 Ga0068863_100182269 Ga0068863_1001822693 298
329 3300005843 Ga0068860_100027381 Ga0068860_1000273814 298
330 3300005844 Ga0068862_100028306 Ga0068862_1000283063 298
331 3300006173 Ga0070716_100006404 Ga0070716_1000064043 298
332 3300006846 Ga0075430_100001040 Ga0075430_1000010403 298
333 3300006846 Ga0075430_100011001 Ga0075430_1000110011 298
334 3300006847 Ga0075431_100000876 Ga0075431_10000087616 298
335 3300006847 Ga0075431_100002879 Ga0075431_1000028793 298
336 3300006847 Ga0075431_100036183 Ga0075431_1000361834 298
337 3300006847 Ga0075431_100162349 Ga0075431_1001623492 298
338 3300006852 Ga0075433_10002881 Ga0075433_1000288111 298
339 3300006852 Ga0075433_10016321 Ga0075433_100163215 298
340 3300006852 Ga0075433_10037138 Ga0075433_100371382 298
341 3300006871 Ga0075434_100004846 Ga0075434_1000048468 298
342 3300006880 Ga0075429_100095804 Ga0075429_1000958043 298
343 3300006880 Ga0075429_100111801 Ga0075429_1001118012 298
344 3300006880 Ga0075429_100401753 Ga0075429_1004017531 298
345 3300006914 Ga0075436_100317213 Ga0075436_1003172131 298
346 3300006931 Ga0097620_100001234 Ga0097620_10000123421 298
347 3300006931 Ga0097620_100247892 Ga0097620_1002478922 298
348 3300007076 Ga0075435_100011106 Ga0075435_1000111062 298
349 3300007076 Ga0075435_100011673 Ga0075435_1000116735 298
350 3300007076 Ga0075435_100350961 Ga0075435_1003509611 298
351 3300007265 Ga0099794_10051219 Ga0099794_100512192 298
352 3300009094 Ga0111539_10004715 Ga0111539_1000471514 298
353 3300009147 Ga0114129_10085057 Ga0114129_100850576 298
354 3300009147 Ga0114129_10189192 Ga0114129_101891925 298
355 3300009147 Ga0114129_10541997 Ga0114129_105419972 298
356 3300009147 Ga0114129_10586189 Ga0114129_105861892 298
357 3300009147 Ga0114129_10833391 Ga0114129_108333912 298
358 3300009174 Ga0105241_10006360 Ga0105241_100063609 298
359 3300009553 Ga0105249_10551684 Ga0105249_105516841 298
360 3300010375 Ga0105239_10230837 Ga0105239_102308372 298
361 3300011119 Ga0105246_10057835 Ga0105246_100578353 298
362 3300013100 Ga0157373_10001566 Ga0157373_100015667 298
363 3300013297 Ga0157378_10052922 Ga0157378_100529224 298
364 3300013297 Ga0157378_10172215 Ga0157378_101722152 298
365 3300013307 Ga0157372_10001358 Ga0157372_1000135814 298
366 3300014497 Ga0182008_10114656 Ga0182008_101146562 298
367 3300025885 Ga0207653_10003710 Ga0207653_100037103 298
368 3300025901 Ga0207688_10106494 Ga0207688_101064942 298
369 3300025905 Ga0207685_10052401 Ga0207685_100524012 298
370 3300025907 Ga0207645_10002372 Ga0207645_1000237216 298
371 3300025908 Ga0207643_10003015 Ga0207643_100030158 298
372 3300025910 Ga0207684_10006212 Ga0207684_100062122 298
373 3300025910 Ga0207684_10151796 Ga0207684_101517962 298
374 3300025911 Ga0207654_10010035 Ga0207654_100100356 298
375 3300025912 Ga0207707_10000091 Ga0207707_1000009115 298
376 3300025917 Ga0207660_10028751 Ga0207660_100287511 298
377 3300025918 Ga0207662_10094096 Ga0207662_100940961 298
378 3300025919 Ga0207657_10000925 Ga0207657_1000092535 298
379 3300025921 Ga0207652_10003874 Ga0207652_1000387412 298
380 3300025922 Ga0207646_10033764 Ga0207646_100337644 298
381 3300025922 Ga0207646_10203454 Ga0207646_102034542 298
382 3300025923 Ga0207681_10020440 Ga0207681_100204404 298
383 3300025923 Ga0207681_10046982 Ga0207681_100469822 298
384 3300025923 Ga0207681_10057625 Ga0207681_100576253 298
385 3300025932 Ga0207690_10010689 Ga0207690_100106895 298
386 3300025933 Ga0207706_10002645 Ga0207706_100026451 298
387 3300025933 Ga0207706_10184216 Ga0207706_101842162 298
388 3300025935 Ga0207709_10426221 Ga0207709_104262211 298
389 3300025939 Ga0207665_10010700 Ga0207665_100107003 298
390 3300025942 Ga0207689_10003443 Ga0207689_100034432 298
391 3300025945 Ga0207679_10051716 Ga0207679_100517163 298
392 3300025949 Ga0207667_10004905 Ga0207667_1000490517 298
393 3300025960 Ga0207651_10035392 Ga0207651_100353923 298
394 3300025972 Ga0207668_10166288 Ga0207668_101662881 298
395 3300025981 Ga0207640_10022120 Ga0207640_100221204 298
396 3300025986 Ga0207658_10198257 Ga0207658_101982572 298
397 3300026023 Ga0207677_10108607 Ga0207677_101086071 298
398 3300026035 Ga0207703_10162945 Ga0207703_101629452 298
399 3300026067 Ga0207678_10020979 Ga0207678_100209796 298
400 3300026078 Ga0207702_10010495 Ga0207702_100104955 298
401 3300026088 Ga0207641_10386263 Ga0207641_103862632 298
402 3300026089 Ga0207648_10012559 Ga0207648_100125594 298
403 3300026095 Ga0207676_10124520 Ga0207676_101245202 298
404 3300026116 Ga0207674_10001080 Ga0207674_1000108019 298
405 3300026118 Ga0207675_100013405 Ga0207675_1000134054 298
406 3300027526 Ga0209968_1000255 Ga0209968_10002552 298
407 3300027671 Ga0209588_1005137 Ga0209588_10051375 298
408 3300027682 Ga0209971_1000003 Ga0209971_100000381 298
409 3300027695 Ga0209966_1000149 Ga0209966_100014927 298
410 3300027717 Ga0209998_10000004 Ga0209998_1000000475 298
411 3300027907 Ga0207428_10000306 Ga0207428_1000030636 298
412 3300028380 Ga0268265_10002124 Ga0268265_100021243 298
413 3300031548 Ga0307408_100041305 Ga0307408_1000413052 298
414 3300034820 Ga0373959_0000923 Ga0373959_0000923_1538_2476 298
415 3300035084 Ga0373928_0028550 Ga0373928_0028550_158_1096 298
416 3300035121 Ga0373960_0005416 Ga0373960_0005416_405_1343 298
417 3300035241 Ga0373961_0026954 Ga0373961_0026954_382_1320 298
418 3300035691 Ga0373931_0003204 Ga0373931_0003204_492_1430 298
419 3300037312 Ga0395899_0019185 Ga0395899_0019185_870_1808 298
420 3300037466 Ga0395898_0001915 Ga0395898_0001915_6561_7499 298
421 3300038443 Ga0395901_0000430 Ga0395901_0000430_20145_21083 298
422 3300042005 Ga0439448_0002836 Ga0439448_0002836_968_1906 298
423 3300042157 Ga0439458_0012185 Ga0439458_0012185_361_1299 298
424 3300042436 Ga0439435_0004869 Ga0439435_0004869_355_1293 298
425 3300042439 Ga0439464_0009705 Ga0439464_0009705_105_1043 298
426 3300042461 Ga0439460_0003260 Ga0439460_0003260_2606_3544 298
427 3300042876 Ga0451577_0016767 Ga0451577_0016767_4736_5674 298
428 3300045051 Ga0451576_0006808 Ga0451576_0006808_11067_12005 298
429 3300045051 Ga0451576_0050655 Ga0451576_0050655_1850_2788 298
430 3300045051 Ga0451576_0080942 Ga0451576_0080942_1801_2739 298
431 3300046472 Ga0495580_0010134 Ga0495580_0010134_3593_4534 298
432 3300046691 Ga0495670_0167605 Ga0495670_0167605_88_1029 298
433 3300048905 Ga0496102_0131947 Ga0496102_0131947_257_1195 298
434 3300048910 Ga0496107_0114516 Ga0496107_0114516_55_993 298
435 3300049573 Ga0501037_0060145 Ga0501037_0060145_1488_2426 298
436 3300049574 Ga0501038_0033796 Ga0501038_0033796_1695_2633 298
437 3300049575 Ga0501039_0245938 Ga0501039_0245938_157_1095 298
438 3300049575 Ga0501039_0381993 Ga0501039_0381993_121_1056 298
439 3300049576 Ga0501040_0011006 Ga0501040_0011006_4207_5145 298
440 3300049576 Ga0501040_0033069 Ga0501040_0033069_1255_2193 298
441 3300049576 Ga0501040_0093706 Ga0501040_0093706_618_1556 298
442 3300049577 Ga0501041_0005353 Ga0501041_0005353_1846_2784 298
443 3300049577 Ga0501041_0060877 Ga0501041_0060877_368_1306 298
444 3300049577 Ga0501041_0201305 Ga0501041_0201305_174_1109 298
445 3300049578 Ga0501042_0008138 Ga0501042_0008138_4197_5135 298
446 3300049578 Ga0501042_0041890 Ga0501042_0041890_2007_2942 298
447 3300049578 Ga0501042_0118392 Ga0501042_0118392_283_1221 298
448 3300049578 Ga0501042_0139917 Ga0501042_0139917_47_985 298
449 3300049580 Ga0501046_0000303 Ga0501046_0000303_16692_17630 298
450 3300049580 Ga0501046_0016616 Ga0501046_0016616_1686_2621 298
451 3300049580 Ga0501046_0120963 Ga0501046_0120963_339_1277 298
452 3300049581 Ga0501047_0114303 Ga0501047_0114303_201_1139 298
453 3300049582 Ga0501048_0013358 Ga0501048_0013358_2061_2999 298
454 3300049588 Ga0501072_0059825 Ga0501072_0059825_1560_2498 298
455 3300049588 Ga0501072_0112675 Ga0501072_0112675_622_1557 298
456 3300049589 Ga0501073_0256792 Ga0501073_0256792_197_1135 298
457 3300049590 Ga0501074_0007053 Ga0501074_0007053_5379_6317 298
458 3300049591 Ga0501075_0010023 Ga0501075_0010023_1915_2853 298
459 3300049591 Ga0501075_0017718 Ga0501075_0017718_414_1352 298
460 3300049591 Ga0501075_0142127 Ga0501075_0142127_660_1598 298
461 3300049592 Ga0501076_0030464 Ga0501076_0030464_1907_2845 298
462 3300049592 Ga0501076_0049908 Ga0501076_0049908_222_1157 298
463 3300049592 Ga0501076_0103186 Ga0501076_0103186_973_1911 298
464 3300049592 Ga0501076_0440830 Ga0501076_0440830_94_1032 298
465 3300049593 Ga0501077_0027974 Ga0501077_0027974_1315_2253 298
466 3300049593 Ga0501077_0033808 Ga0501077_0033808_1248_2186 298
467 3300049593 Ga0501077_0057419 Ga0501077_0057419_1397_2332 298
468 3300049593 Ga0501077_0099173 Ga0501077_0099173_170_1108 298
469 3300049741 Ga0501079_0000600 Ga0501079_0000600_18168_19106 298
470 3300049741 Ga0501079_0001407 Ga0501079_0001407_496_1434 298
471 3300049742 Ga0501080_0037951 Ga0501080_0037951_1496_2434 298
472 3300049742 Ga0501080_0138936 Ga0501080_0138936_1067_2002 298
473 3300049743 Ga0501081_0002259 Ga0501081_0002259_6174_7112 298
474 3300049743 Ga0501081_0064098 Ga0501081_0064098_1028_1966 298
475 3300049744 Ga0501083_0007814 Ga0501083_0007814_4741_5679 298
476 3300049744 Ga0501083_0063970 Ga0501083_0063970_716_1654 298
477 3300049824 Ga0501045_0081462 Ga0501045_0081462_316_1254 298
478 3300050507 nmdc:mga05p37_143923_c1 nmdc:mga05p37_143923_c1_301_1257 298
479 3300050507 nmdc:mga05p37_24360_c1 nmdc:mga05p37_24360_c1_5253_6191 298
480 3300050507 nmdc:mga05p37_446207_c1 nmdc:mga05p37_446207_c1_315_1253 298
481 3300050507 nmdc:mga05p37_63216_c1 nmdc:mga05p37_63216_c1_2336_3274 298
482 3300050508 nmdc:mga09592_20256_c1 nmdc:mga09592_20256_c1_578_1534 298
483 3300050508 nmdc:mga09592_282516_c1 nmdc:mga09592_282516_c1_454_1392 298
484 3300050508 nmdc:mga09592_312823_c1 nmdc:mga09592_312823_c1_345_1283 298
485 3300050509 nmdc:mga0qj67_1405_c1 nmdc:mga0qj67_1405_c1_4805_5743 298
486 3300050510 nmdc:mga06r32_205_c1 nmdc:mga06r32_205_c1_37666_38610 298
487 3300050510 nmdc:mga06r32_67230_c1 nmdc:mga06r32_67230_c1_1205_2143 298
488 3300050510 nmdc:mga06r32_90681_c1 nmdc:mga06r32_90681_c1_1098_2045 298
489 3300050511 nmdc:mga08y16_14092_c1 nmdc:mga08y16_14092_c1_6721_7659 298
490 3300050511 nmdc:mga08y16_305319_c1 nmdc:mga08y16_305319_c1_438_1394 298
491 3300050512 nmdc:mga0n895_376073_c1 nmdc:mga0n895_376073_c1_298_1242 298
492 3300050512 nmdc:mga0n895_41613_c1 nmdc:mga0n895_41613_c1_2390_3334 298
493 3300050512 nmdc:mga0n895_59945_c1 nmdc:mga0n895_59945_c1_1896_2834 298
494 3300050513 nmdc:mga0rr50_11178_c1 nmdc:mga0rr50_11178_c1_3715_4653 298
495 3300050513 nmdc:mga0rr50_28522_c1 nmdc:mga0rr50_28522_c1_2786_3742 298
496 3300050514 nmdc:mga08x19_20879_c1 nmdc:mga08x19_20879_c1_1754_2719 298
497 3300050515 nmdc:mga0a205_140552_c1 nmdc:mga0a205_140552_c1_157_1113 298
498 3300050515 nmdc:mga0a205_48508_c1 nmdc:mga0a205_48508_c1_2584_3522 298
499 3300054114 Ga0501084_0002736 Ga0501084_0002736_6469_7407 298
500 3300054114 Ga0501084_0007675 Ga0501084_0007675_6541_7479 298
501 3300054114 Ga0501084_0106464 Ga0501084_0106464_351_1289 298
502 3300054114 Ga0501084_0222984 Ga0501084_0222984_520_1458 298
503 3300054114 Ga0501084_0287252 Ga0501084_0287252_184_1122 298
504 3300060353 Ga0501082_0000212 Ga0501082_0000212_28821_29759 298
505 3300060353 Ga0501082_0066220 Ga0501082_0066220_511_1449 298
506 3300060353 Ga0501082_0083794 Ga0501082_0083794_66_1004 298
507 3300061734 Ga0530510_0255797 Ga0530510_0255797_255_1193 298
508 3300061734 Ga0530510_0291587 Ga0530510_0291587_98_1033 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

9

289

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bke-assembly1.cif.gz_D crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9586 4 282
5bke-assembly1.cif.gz_A crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9577 1 282
5bke-assembly1.cif.gz_B crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9554 3 282
5bke-assembly1.cif.gz_C crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9522 1 282
5bke-assembly1.cif.gz_E crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9499 1 282
ID Description Score Start End Superfamily
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9462 2 279 3.60.130.10
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.911 2 279 3.60.130.10
5hsxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9027 2 282 3.60.130.10
4y0eD00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8956 2 280 3.60.130.10
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.895 1 282 3.60.130.10
ID Description Score Start End GO Terms
AF-A0A2V6QVB6-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9798 1 282 GO:0046872
GO:0051213
AF-A0A3D2VEE5-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9773 87 282 GO:0051213
AF-A0A2V7E5C3-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9769 150 283 GO:0046872
GO:0051213
AF-A0A350RFH9-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9758 117 283 GO:0046872
GO:0051213
AF-A0A6A7KLN7-F1-model_v4 TauD/TfdA family dioxygenase 0.9738 1 283 GO:0046872
GO:0051213

Feature Viewer

pLDDT pTM Quality
90.21 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map