F456783
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 508 | 194 | 506 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100035069|Ga0070708_1000350693 |
| Length | 310 |
| Sequence | MATIAATLTITPAHPAFAAEVSGVDLTRRLDDATFERIAVAFDDYSVLVFRGQALSDEQQMAFSERWGPLETTVRTLGGEDRLGAHIVDLSNTDPDGKLMGWEDRRMLYQSGNQLWHSDSSFKPVPAHSSALSARVIPPEGGETEFASMRVAYEHLAEDIRLDENVRRDLDRLIVVHSFGFSRSMIDPGIGTEIGRDYPPVRHALVRANPRNGRRSLYIGSHAWFIEGLGLDESRILIARLLEQTTRADRVYRHRWQVGDLVMWDNRCVLHRGRPWDSARYKRVMHRTTVAGDGATADPAFLHELTATRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 140 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 147 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 148 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 149 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 150 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 151 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 152 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 160 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 194 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.41 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.98 |
| Rhizosphere | 98.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10008554 | 3300005328 | Bacteria | 5518 |
| 2 | Ga0070690_100143938 | 3300005330 | Bacteria | 1620 |
| 3 | Ga0070690_100222469 | 3300005330 | Bacteria | 1323 |
| 4 | Ga0070670_100003552 | 3300005331 | Bacteria | 12969 |
| 5 | Ga0070670_100091510 | 3300005331 | Bacteria | 2615 |
| 6 | Ga0070677_10113234 | 3300005333 | Bacteria | 1214 |
| 7 | Ga0068869_100000441 | 3300005334 | Bacteria | 22683 |
| 8 | Ga0068869_100005949 | 3300005334 | Bacteria | 7711 |
| 9 | Ga0068869_100083013 | 3300005334 | Bacteria | 2396 |
| 10 | Ga0070666_10129598 | 3300005335 | Bacteria | 1752 |
| 11 | Ga0070680_100001037 | 3300005336 | Bacteria | 19918 |
| 12 | Ga0070680_100003438 | 3300005336 | Bacteria | 11825 |
| 13 | Ga0070682_100000431 | 3300005337 | Bacteria | 27098 |
| 14 | Ga0070682_100000441 | 3300005337 | Bacteria | 26724 |
| 15 | Ga0068868_100011295 | 3300005338 | Bacteria | 6502 |
| 16 | Ga0070660_100000167 | 3300005339 | Bacteria | 43059 |
| 17 | Ga0070660_100002407 | 3300005339 | Bacteria | 12855 |
| 18 | Ga0070689_100010334 | 3300005340 | Bacteria | 6654 |
| 19 | Ga0070689_100010529 | 3300005340 | Bacteria | 6591 |
| 20 | Ga0070691_10010735 | 3300005341 | Bacteria | 4180 |
| 21 | Ga0070691_10033127 | 3300005341 | Bacteria | 2430 |
| 22 | Ga0070691_10080439 | 3300005341 | Unclassified | 1595 |
| 23 | Ga0070687_100018536 | 3300005343 | Bacteria | 3222 |
| 24 | Ga0070661_100019188 | 3300005344 | Bacteria | 4870 |
| 25 | Ga0070692_10000218 | 3300005345 | Bacteria | 15694 |
| 26 | Ga0070692_10003682 | 3300005345 | Bacteria | 6274 |
| 27 | Ga0070692_10070619 | 3300005345 | Bacteria | 1860 |
| 28 | Ga0070669_100011936 | 3300005353 | Bacteria | 6164 |
| 29 | Ga0070669_100207673 | 3300005353 | Bacteria | 1543 |
| 30 | Ga0070669_100538489 | 3300005353 | Bacteria | 972 |
| 31 | Ga0070673_100007386 | 3300005364 | Bacteria | 7243 |
| 32 | Ga0070659_100000748 | 3300005366 | Bacteria | 23646 |
| 33 | Ga0070659_100001067 | 3300005366 | Bacteria | 20046 |
| 34 | Ga0070703_10002309 | 3300005406 | Bacteria | 5512 |
| 35 | Ga0070709_10061206 | 3300005434 | Bacteria | 2396 |
| 36 | Ga0070701_10041255 | 3300005438 | Bacteria | 2351 |
| 37 | Ga0070701_10134015 | 3300005438 | Bacteria | 1410 |
| 38 | Ga0070705_100000739 | 3300005440 | Bacteria | 18584 |
| 39 | Ga0070705_100001807 | 3300005440 | Bacteria | 11042 |
| 40 | Ga0070705_100017019 | 3300005440 | Bacteria | 3787 |
| 41 | Ga0070705_100066520 | 3300005440 | Bacteria | 2161 |
| 42 | Ga0070705_100214645 | 3300005440 | Bacteria | 1329 |
| 43 | Ga0070705_100228853 | 3300005440 | Bacteria | 1292 |
| 44 | Ga0070700_100025850 | 3300005441 | Bacteria | 3461 |
| 45 | Ga0070694_100000520 | 3300005444 | Bacteria | 21250 |
| 46 | Ga0070694_100000546 | 3300005444 | Bacteria | 20714 |
| 47 | Ga0070694_100003863 | 3300005444 | Bacteria | 8952 |
| 48 | Ga0070694_100013182 | 3300005444 | Bacteria | 5160 |
| 49 | Ga0070708_100016456 | 3300005445 | Bacteria | 6136 |
| 50 | Ga0070708_100018070 | 3300005445 | Bacteria | 5897 |
| 51 | Ga0070708_100035069 | 3300005445 | Bacteria | 4369 |
| 52 | Ga0070708_100048210 | 3300005445 | Bacteria | 3765 |
| 53 | Ga0070708_100187734 | 3300005445 | Bacteria | 1933 |
| 54 | Ga0070708_100189544 | 3300005445 | Bacteria | 1923 |
| 55 | Ga0070708_100254680 | 3300005445 | Bacteria | 1649 |
| 56 | Ga0070663_100000680 | 3300005455 | Bacteria | 18271 |
| 57 | Ga0070663_100002687 | 3300005455 | Bacteria | 10064 |
| 58 | Ga0070662_100007954 | 3300005457 | Bacteria | 6897 |
| 59 | Ga0070662_100117784 | 3300005457 | Bacteria | 2032 |
| 60 | Ga0070681_10017635 | 3300005458 | Bacteria | 7134 |
| 61 | Ga0070681_10165867 | 3300005458 | Bacteria | 2131 |
| 62 | Ga0068867_100002988 | 3300005459 | Bacteria | 11916 |
| 63 | Ga0068867_100017279 | 3300005459 | Bacteria | 5123 |
| 64 | Ga0068867_100285991 | 3300005459 | Bacteria | 1354 |
| 65 | Ga0070706_100010899 | 3300005467 | Bacteria | 8437 |
| 66 | Ga0070706_100026249 | 3300005467 | Bacteria | 5361 |
| 67 | Ga0070706_100103787 | 3300005467 | Bacteria | 2643 |
| 68 | Ga0070706_100167071 | 3300005467 | Bacteria | 2054 |
| 69 | Ga0070707_100000971 | 3300005468 | Bacteria | 28355 |
| 70 | Ga0070707_100032917 | 3300005468 | Bacteria | 4940 |
| 71 | Ga0070707_100069183 | 3300005468 | Bacteria | 3398 |
| 72 | Ga0070707_100093947 | 3300005468 | Bacteria | 2904 |
| 73 | Ga0070707_100241843 | 3300005468 | Bacteria | 1757 |
| 74 | Ga0070707_100243720 | 3300005468 | Bacteria | 1749 |
| 75 | Ga0070707_100256603 | 3300005468 | Bacteria | 1701 |
| 76 | Ga0070707_100311678 | 3300005468 | Bacteria | 1529 |
| 77 | Ga0070698_100005995 | 3300005471 | Bacteria | 13251 |
| 78 | Ga0070698_100044378 | 3300005471 | Bacteria | 4553 |
| 79 | Ga0070698_100092817 | 3300005471 | Bacteria | 2999 |
| 80 | Ga0070698_100364277 | 3300005471 | Bacteria | 1377 |
| 81 | Ga0070699_100002124 | 3300005518 | Bacteria | 17975 |
| 82 | Ga0070699_100004855 | 3300005518 | Bacteria | 11867 |
| 83 | Ga0070699_100021259 | 3300005518 | Bacteria | 5596 |
| 84 | Ga0070699_100027881 | 3300005518 | Bacteria | 4871 |
| 85 | Ga0070699_100044628 | 3300005518 | Bacteria | 3837 |
| 86 | Ga0070699_100175419 | 3300005518 | Bacteria | 1900 |
| 87 | Ga0070699_100179459 | 3300005518 | Bacteria | 1879 |
| 88 | Ga0070679_100001116 | 3300005530 | Bacteria | 23414 |
| 89 | Ga0070679_100006668 | 3300005530 | Bacteria | 10764 |
| 90 | Ga0070697_100001063 | 3300005536 | Bacteria | 20764 |
| 91 | Ga0070697_100005384 | 3300005536 | Bacteria | 9849 |
| 92 | Ga0070697_100023648 | 3300005536 | Bacteria | 4888 |
| 93 | Ga0070697_100040278 | 3300005536 | Bacteria | 3779 |
| 94 | Ga0070697_100053626 | 3300005536 | Bacteria | 3277 |
| 95 | Ga0070697_100100317 | 3300005536 | Bacteria | 2404 |
| 96 | Ga0070697_100113519 | 3300005536 | Bacteria | 2260 |
| 97 | Ga0070697_100137676 | 3300005536 | Bacteria | 2051 |
| 98 | Ga0070697_100197897 | 3300005536 | Bacteria | 1707 |
| 99 | Ga0070697_100265060 | 3300005536 | Bacteria | 1471 |
| 100 | Ga0068853_100000697 | 3300005539 | Bacteria | 23226 |
| 101 | Ga0068853_100000940 | 3300005539 | Bacteria | 20409 |
| 102 | Ga0070672_100006026 | 3300005543 | Bacteria | 8101 |
| 103 | Ga0070695_100001716 | 3300005545 | Bacteria | 12333 |
| 104 | Ga0070695_100010563 | 3300005545 | Bacteria | 5516 |
| 105 | Ga0070695_100011637 | 3300005545 | Bacteria | 5265 |
| 106 | Ga0070695_100022153 | 3300005545 | Bacteria | 3894 |
| 107 | Ga0070695_100278110 | 3300005545 | Bacteria | 1229 |
| 108 | Ga0070696_100000619 | 3300005546 | Bacteria | 22828 |
| 109 | Ga0070696_100013708 | 3300005546 | Bacteria | 5443 |
| 110 | Ga0070696_100029101 | 3300005546 | Bacteria | 3772 |
| 111 | Ga0070696_100038946 | 3300005546 | Bacteria | 3282 |
| 112 | Ga0070696_100076384 | 3300005546 | Bacteria | 2365 |
| 113 | Ga0070696_100084321 | 3300005546 | Bacteria | 2254 |
| 114 | Ga0070693_100000017 | 3300005547 | Bacteria | 62990 |
| 115 | Ga0070693_100000058 | 3300005547 | Bacteria | 43221 |
| 116 | Ga0070693_100183798 | 3300005547 | Bacteria | 1348 |
| 117 | Ga0070704_100001317 | 3300005549 | Bacteria | 13139 |
| 118 | Ga0070704_100006116 | 3300005549 | Bacteria | 7066 |
| 119 | Ga0070704_100017013 | 3300005549 | Bacteria | 4612 |
| 120 | Ga0070704_100024239 | 3300005549 | Bacteria | 3979 |
| 121 | Ga0070704_100321035 | 3300005549 | Bacteria | 1297 |
| 122 | Ga0068855_100002413 | 3300005563 | Bacteria | 23055 |
| 123 | Ga0068855_100006700 | 3300005563 | Bacteria | 13976 |
| 124 | Ga0070664_100002214 | 3300005564 | Bacteria | 15628 |
| 125 | Ga0070664_100260801 | 3300005564 | Bacteria | 1559 |
| 126 | Ga0068857_100087444 | 3300005577 | Bacteria | 2787 |
| 127 | Ga0068854_100005389 | 3300005578 | Bacteria | 8074 |
| 128 | Ga0068854_100034465 | 3300005578 | Bacteria | 3536 |
| 129 | Ga0068856_100000929 | 3300005614 | Bacteria | 31390 |
| 130 | Ga0068856_100003454 | 3300005614 | Bacteria | 15973 |
| 131 | Ga0070702_100003973 | 3300005615 | Bacteria | 6707 |
| 132 | Ga0070702_100318923 | 3300005615 | Bacteria | 1082 |
| 133 | Ga0068852_100161235 | 3300005616 | Bacteria | 2094 |
| 134 | Ga0068859_100001234 | 3300005617 | Bacteria | 26131 |
| 135 | Ga0068859_100006591 | 3300005617 | Bacteria | 11785 |
| 136 | Ga0068859_100247860 | 3300005617 | Bacteria | 1871 |
| 137 | Ga0068864_100028108 | 3300005618 | Bacteria | 4752 |
| 138 | Ga0068864_100035528 | 3300005618 | Bacteria | 4242 |
| 139 | Ga0068861_100003185 | 3300005719 | Bacteria | 10857 |
| 140 | Ga0068861_100007264 | 3300005719 | Bacteria | 7592 |
| 141 | Ga0068861_100277330 | 3300005719 | Bacteria | 1442 |
| 142 | Ga0068870_10000518 | 3300005840 | Bacteria | 14581 |
| 143 | Ga0068870_10001484 | 3300005840 | Bacteria | 9499 |
| 144 | Ga0068863_100044864 | 3300005841 | Bacteria | 4195 |
| 145 | Ga0068863_100182269 | 3300005841 | Bacteria | 2016 |
| 146 | Ga0068858_100317006 | 3300005842 | Bacteria | 1490 |
| 147 | Ga0068860_100025685 | 3300005843 | Bacteria | 5681 |
| 148 | Ga0068860_100027381 | 3300005843 | Bacteria | 5491 |
| 149 | Ga0068862_100002103 | 3300005844 | Bacteria | 17946 |
| 150 | Ga0068862_100028306 | 3300005844 | Bacteria | 4717 |
| 151 | Ga0068862_100242256 | 3300005844 | Bacteria | 1640 |
| 152 | Ga0081455_10001120 | 3300005937 | Bacteria | 33487 |
| 153 | Ga0070716_100000651 | 3300006173 | Bacteria | 14747 |
| 154 | Ga0070716_100006404 | 3300006173 | Bacteria | 5748 |
| 155 | Ga0075428_100000435 | 3300006844 | Bacteria | 41534 |
| 156 | Ga0075428_100039962 | 3300006844 | Bacteria | 5163 |
| 157 | Ga0075428_100055095 | 3300006844 | Bacteria | 4358 |
| 158 | Ga0075428_100149548 | 3300006844 | Bacteria | 2537 |
| 159 | Ga0075430_100001040 | 3300006846 | Bacteria | 21918 |
| 160 | Ga0075430_100001778 | 3300006846 | Bacteria | 17614 |
| 161 | Ga0075430_100010088 | 3300006846 | Bacteria | 7993 |
| 162 | Ga0075430_100011001 | 3300006846 | Bacteria | 7665 |
| 163 | Ga0075431_100000876 | 3300006847 | Bacteria | 26465 |
| 164 | Ga0075431_100002879 | 3300006847 | Bacteria | 16650 |
| 165 | Ga0075431_100005232 | 3300006847 | Bacteria | 12772 |
| 166 | Ga0075431_100024616 | 3300006847 | Bacteria | 6171 |
| 167 | Ga0075431_100036183 | 3300006847 | Bacteria | 5085 |
| 168 | Ga0075431_100042700 | 3300006847 | Bacteria | 4678 |
| 169 | Ga0075431_100118578 | 3300006847 | Bacteria | 2731 |
| 170 | Ga0075431_100162349 | 3300006847 | Bacteria | 2297 |
| 171 | Ga0075431_100416224 | 3300006847 | Bacteria | 1343 |
| 172 | Ga0075433_10002881 | 3300006852 | Bacteria | 13187 |
| 173 | Ga0075433_10016321 | 3300006852 | Bacteria | 6115 |
| 174 | Ga0075433_10026037 | 3300006852 | Bacteria | 4948 |
| 175 | Ga0075433_10037138 | 3300006852 | Bacteria | 4200 |
| 176 | Ga0075433_10191800 | 3300006852 | Bacteria | 1818 |
| 177 | Ga0075434_100002983 | 3300006871 | Bacteria | 15057 |
| 178 | Ga0075434_100004846 | 3300006871 | Bacteria | 12198 |
| 179 | Ga0075434_100007646 | 3300006871 | Bacteria | 9995 |
| 180 | Ga0075434_100055550 | 3300006871 | Bacteria | 3935 |
| 181 | Ga0075434_100174030 | 3300006871 | Bacteria | 2172 |
| 182 | Ga0075434_100555982 | 3300006871 | Bacteria | 1167 |
| 183 | Ga0075429_100000189 | 3300006880 | Bacteria | 40717 |
| 184 | Ga0075429_100093279 | 3300006880 | Bacteria | 2626 |
| 185 | Ga0075429_100095804 | 3300006880 | Bacteria | 2588 |
| 186 | Ga0075429_100111801 | 3300006880 | Bacteria | 2387 |
| 187 | Ga0075429_100401753 | 3300006880 | Bacteria | 1200 |
| 188 | Ga0075436_100003897 | 3300006914 | Bacteria | 10227 |
| 189 | Ga0075436_100317213 | 3300006914 | Bacteria | 1119 |
| 190 | Ga0097620_100001234 | 3300006931 | Bacteria | 26131 |
| 191 | Ga0097620_100006591 | 3300006931 | Bacteria | 11785 |
| 192 | Ga0097620_100247892 | 3300006931 | Bacteria | 1871 |
| 193 | Ga0075435_100011106 | 3300007076 | Bacteria | 6606 |
| 194 | Ga0075435_100011673 | 3300007076 | Bacteria | 6476 |
| 195 | Ga0075435_100072862 | 3300007076 | Bacteria | 2807 |
| 196 | Ga0075435_100242101 | 3300007076 | Bacteria | 1534 |
| 197 | Ga0075435_100350961 | 3300007076 | Bacteria | 1264 |
| 198 | Ga0099794_10002225 | 3300007265 | Bacteria | 7087 |
| 199 | Ga0099794_10022947 | 3300007265 | Bacteria | 2849 |
| 200 | Ga0099794_10051219 | 3300007265 | Bacteria | 1988 |
| 201 | Ga0099794_10175639 | 3300007265 | Bacteria | 1092 |
| 202 | Ga0111539_10000715 | 3300009094 | Bacteria | 43156 |
| 203 | Ga0111539_10004715 | 3300009094 | Bacteria | 17823 |
| 204 | Ga0111539_10677404 | 3300009094 | Bacteria | 1201 |
| 205 | Ga0114129_10000839 | 3300009147 | Bacteria | 39797 |
| 206 | Ga0114129_10003334 | 3300009147 | Bacteria | 22561 |
| 207 | Ga0114129_10085057 | 3300009147 | Bacteria | 4389 |
| 208 | Ga0114129_10085342 | 3300009147 | Bacteria | 4380 |
| 209 | Ga0114129_10099619 | 3300009147 | Unclassified | 4022 |
| 210 | Ga0114129_10189090 | 3300009147 | Unclassified | 2797 |
| 211 | Ga0114129_10189192 | 3300009147 | Bacteria | 2796 |
| 212 | Ga0114129_10334276 | 3300009147 | Bacteria | 2011 |
| 213 | Ga0114129_10541997 | 3300009147 | Bacteria | 1514 |
| 214 | Ga0114129_10586189 | 3300009147 | Bacteria | 1446 |
| 215 | Ga0114129_10833391 | 3300009147 | Bacteria | 1174 |
| 216 | Ga0105243_10052990 | 3300009148 | Unclassified | 3216 |
| 217 | Ga0105241_10000582 | 3300009174 | Bacteria | 27518 |
| 218 | Ga0105241_10006360 | 3300009174 | Bacteria | 8705 |
| 219 | Ga0105242_10032796 | 3300009176 | Bacteria | 4155 |
| 220 | Ga0105249_10420668 | 3300009553 | Bacteria | 1370 |
| 221 | Ga0105249_10551684 | 3300009553 | Bacteria | 1203 |
| 222 | Ga0105239_10097799 | 3300010375 | Bacteria | 3244 |
| 223 | Ga0105239_10230837 | 3300010375 | Bacteria | 2076 |
| 224 | Ga0105246_10057835 | 3300011119 | Bacteria | 2685 |
| 225 | Ga0157373_10000229 | 3300013100 | Bacteria | 45851 |
| 226 | Ga0157373_10001566 | 3300013100 | Bacteria | 17443 |
| 227 | Ga0157371_10099595 | 3300013102 | Bacteria | 2061 |
| 228 | Ga0157369_10009446 | 3300013105 | Bacteria | 11148 |
| 229 | Ga0157378_10052922 | 3300013297 | Bacteria | 3613 |
| 230 | Ga0157378_10172215 | 3300013297 | Bacteria | 2031 |
| 231 | Ga0157372_10000144 | 3300013307 | Bacteria | 78166 |
| 232 | Ga0157372_10001358 | 3300013307 | Bacteria | 26478 |
| 233 | Ga0157375_10238878 | 3300013308 | Bacteria | 1976 |
| 234 | Ga0182008_10114656 | 3300014497 | Bacteria | 1336 |
| 235 | Ga0182007_10008367 | 3300015262 | Bacteria | 4257 |
| 236 | Ga0206353_11287094 | 3300020082 | Bacteria | 1865 |
| 237 | Ga0207653_10002270 | 3300025885 | Bacteria | 6124 |
| 238 | Ga0207653_10003710 | 3300025885 | Bacteria | 4802 |
| 239 | Ga0207688_10014419 | 3300025901 | Bacteria | 4297 |
| 240 | Ga0207688_10106494 | 3300025901 | Bacteria | 1624 |
| 241 | Ga0207685_10052401 | 3300025905 | Bacteria | 1581 |
| 242 | Ga0207645_10000560 | 3300025907 | Bacteria | 30825 |
| 243 | Ga0207645_10002372 | 3300025907 | Bacteria | 14853 |
| 244 | Ga0207643_10001850 | 3300025908 | Bacteria | 11701 |
| 245 | Ga0207643_10003015 | 3300025908 | Bacteria | 9077 |
| 246 | Ga0207684_10000425 | 3300025910 | Bacteria | 56051 |
| 247 | Ga0207684_10006212 | 3300025910 | Bacteria | 10907 |
| 248 | Ga0207684_10019127 | 3300025910 | Bacteria | 5858 |
| 249 | Ga0207684_10039752 | 3300025910 | Bacteria | 3988 |
| 250 | Ga0207684_10151796 | 3300025910 | Bacteria | 1993 |
| 251 | Ga0207654_10002320 | 3300025911 | Bacteria | 9769 |
| 252 | Ga0207654_10010035 | 3300025911 | Bacteria | 4816 |
| 253 | Ga0207707_10000091 | 3300025912 | Bacteria | 90540 |
| 254 | Ga0207707_10000280 | 3300025912 | Bacteria | 54565 |
| 255 | Ga0207660_10000076 | 3300025917 | Bacteria | 51418 |
| 256 | Ga0207660_10028751 | 3300025917 | Bacteria | 3806 |
| 257 | Ga0207662_10094096 | 3300025918 | Bacteria | 1847 |
| 258 | Ga0207657_10000383 | 3300025919 | Bacteria | 46673 |
| 259 | Ga0207657_10000925 | 3300025919 | Bacteria | 31095 |
| 260 | Ga0207649_10004400 | 3300025920 | Bacteria | 7644 |
| 261 | Ga0207652_10000681 | 3300025921 | Bacteria | 33162 |
| 262 | Ga0207652_10003874 | 3300025921 | Bacteria | 12254 |
| 263 | Ga0207646_10000645 | 3300025922 | Bacteria | 45262 |
| 264 | Ga0207646_10003426 | 3300025922 | Bacteria | 17920 |
| 265 | Ga0207646_10019390 | 3300025922 | Bacteria | 6323 |
| 266 | Ga0207646_10031732 | 3300025922 | Bacteria | 4781 |
| 267 | Ga0207646_10033764 | 3300025922 | Bacteria | 4626 |
| 268 | Ga0207646_10077660 | 3300025922 | Bacteria | 2967 |
| 269 | Ga0207646_10203454 | 3300025922 | Bacteria | 1789 |
| 270 | Ga0207646_10283117 | 3300025922 | Bacteria | 1498 |
| 271 | Ga0207646_10317596 | 3300025922 | Bacteria | 1407 |
| 272 | Ga0207681_10020440 | 3300025923 | Bacteria | 4196 |
| 273 | Ga0207681_10046982 | 3300025923 | Bacteria | 2905 |
| 274 | Ga0207681_10057625 | 3300025923 | Bacteria | 2656 |
| 275 | Ga0207687_10535001 | 3300025927 | Bacteria | 981 |
| 276 | Ga0207690_10002609 | 3300025932 | Bacteria | 10867 |
| 277 | Ga0207690_10010689 | 3300025932 | Bacteria | 5469 |
| 278 | Ga0207706_10001349 | 3300025933 | Bacteria | 24531 |
| 279 | Ga0207706_10002645 | 3300025933 | Bacteria | 17452 |
| 280 | Ga0207706_10078506 | 3300025933 | Bacteria | 2903 |
| 281 | Ga0207706_10184216 | 3300025933 | Bacteria | 1834 |
| 282 | Ga0207709_10378491 | 3300025935 | Bacteria | 1077 |
| 283 | Ga0207709_10426221 | 3300025935 | Bacteria | 1020 |
| 284 | Ga0207670_10119416 | 3300025936 | Bacteria | 1914 |
| 285 | Ga0207665_10010700 | 3300025939 | Bacteria | 6026 |
| 286 | Ga0207665_10010772 | 3300025939 | Bacteria | 6002 |
| 287 | Ga0207689_10000127 | 3300025942 | Bacteria | 64217 |
| 288 | Ga0207689_10003443 | 3300025942 | Bacteria | 14446 |
| 289 | Ga0207689_10010357 | 3300025942 | Bacteria | 8033 |
| 290 | Ga0207689_10096028 | 3300025942 | Bacteria | 2434 |
| 291 | Ga0207661_10286002 | 3300025944 | Bacteria | 1475 |
| 292 | Ga0207679_10000422 | 3300025945 | Bacteria | 30232 |
| 293 | Ga0207679_10051716 | 3300025945 | Bacteria | 3009 |
| 294 | Ga0207667_10003623 | 3300025949 | Bacteria | 19056 |
| 295 | Ga0207667_10004905 | 3300025949 | Bacteria | 16340 |
| 296 | Ga0207651_10035392 | 3300025960 | Bacteria | 3246 |
| 297 | Ga0207712_10107906 | 3300025961 | Bacteria | 2082 |
| 298 | Ga0207668_10166288 | 3300025972 | Bacteria | 1725 |
| 299 | Ga0207640_10014890 | 3300025981 | Bacteria | 4487 |
| 300 | Ga0207640_10022120 | 3300025981 | Bacteria | 3800 |
| 301 | Ga0207658_10198257 | 3300025986 | Bacteria | 1674 |
| 302 | Ga0207677_10108607 | 3300026023 | Bacteria | 2061 |
| 303 | Ga0207703_10141422 | 3300026035 | Bacteria | 2089 |
| 304 | Ga0207703_10162945 | 3300026035 | Bacteria | 1954 |
| 305 | Ga0207639_10001822 | 3300026041 | Bacteria | 14348 |
| 306 | Ga0207678_10001588 | 3300026067 | Bacteria | 20904 |
| 307 | Ga0207678_10020979 | 3300026067 | Bacteria | 5725 |
| 308 | Ga0207702_10006321 | 3300026078 | Bacteria | 10234 |
| 309 | Ga0207702_10010495 | 3300026078 | Bacteria | 7749 |
| 310 | Ga0207641_10386263 | 3300026088 | Bacteria | 1342 |
| 311 | Ga0207648_10001700 | 3300026089 | Bacteria | 24065 |
| 312 | Ga0207648_10012559 | 3300026089 | Bacteria | 7924 |
| 313 | Ga0207648_10080225 | 3300026089 | Bacteria | 2847 |
| 314 | Ga0207648_10329403 | 3300026089 | Bacteria | 1373 |
| 315 | Ga0207676_10053850 | 3300026095 | Bacteria | 3150 |
| 316 | Ga0207676_10124520 | 3300026095 | Bacteria | 2180 |
| 317 | Ga0207674_10000720 | 3300026116 | Bacteria | 43278 |
| 318 | Ga0207674_10001080 | 3300026116 | Bacteria | 35457 |
| 319 | Ga0207675_100004428 | 3300026118 | Bacteria | 13571 |
| 320 | Ga0207675_100013405 | 3300026118 | Bacteria | 7649 |
| 321 | Ga0207675_100157287 | 3300026118 | Bacteria | 2166 |
| 322 | Ga0207698_10131559 | 3300026142 | Bacteria | 2139 |
| 323 | Ga0209968_1000255 | 3300027526 | Bacteria | 9108 |
| 324 | Ga0209588_1005137 | 3300027671 | Bacteria | 3733 |
| 325 | Ga0209971_1000003 | 3300027682 | Bacteria | 110664 |
| 326 | Ga0209966_1000149 | 3300027695 | Bacteria | 29724 |
| 327 | Ga0209966_1008120 | 3300027695 | Bacteria | 1856 |
| 328 | Ga0209998_10000004 | 3300027717 | Bacteria | 104862 |
| 329 | Ga0207428_10000306 | 3300027907 | Bacteria | 65012 |
| 330 | Ga0207428_10000631 | 3300027907 | Bacteria | 41443 |
| 331 | Ga0207428_10216115 | 3300027907 | Bacteria | 1439 |
| 332 | Ga0268265_10002124 | 3300028380 | Bacteria | 15369 |
| 333 | Ga0268265_10003385 | 3300028380 | Bacteria | 11481 |
| 334 | Ga0268264_10012691 | 3300028381 | Bacteria | 6935 |
| 335 | Ga0268264_10172127 | 3300028381 | Bacteria | 1959 |
| 336 | Ga0307408_100007207 | 3300031548 | Bacteria | 7355 |
| 337 | Ga0307408_100041305 | 3300031548 | Bacteria | 3270 |
| 338 | Ga0307416_100025069 | 3300032002 | Bacteria | 4366 |
| 339 | Ga0373959_0000923 | 3300034820 | Bacteria | 4955 |
| 340 | Ga0373928_0028550 | 3300035084 | Unclassified | 1222 |
| 341 | Ga0373960_0000907 | 3300035121 | Bacteria | 6291 |
| 342 | Ga0373960_0005416 | 3300035121 | Bacteria | 2956 |
| 343 | Ga0373961_0026954 | 3300035241 | Bacteria | 1574 |
| 344 | Ga0373931_0003204 | 3300035691 | Bacteria | 7303 |
| 345 | Ga0395899_0019185 | 3300037312 | Bacteria | 5198 |
| 346 | Ga0395898_0001915 | 3300037466 | Bacteria | 26488 |
| 347 | Ga0395901_0000430 | 3300038443 | Bacteria | 49340 |
| 348 | Ga0439448_0002836 | 3300042005 | Bacteria | 4744 |
| 349 | Ga0439458_0012185 | 3300042157 | Bacteria | 1928 |
| 350 | Ga0439435_0004869 | 3300042436 | Bacteria | 2919 |
| 351 | Ga0439464_0009705 | 3300042439 | Bacteria | 2535 |
| 352 | Ga0439460_0003260 | 3300042461 | Bacteria | 3926 |
| 353 | Ga0451577_0003313 | 3300042876 | Bacteria | 18095 |
| 354 | Ga0451577_0016518 | 3300042876 | Bacteria | 6833 |
| 355 | Ga0451577_0016767 | 3300042876 | Bacteria | 6774 |
| 356 | Ga0451577_0035032 | 3300042876 | Bacteria | 4522 |
| 357 | Ga0453683_0006026 | 3300044673 | Bacteria | 8355 |
| 358 | Ga0453683_0074102 | 3300044673 | Bacteria | 2131 |
| 359 | Ga0453683_0109402 | 3300044673 | Bacteria | 1737 |
| 360 | Ga0453684_0019600 | 3300044712 | Bacteria | 10281 |
| 361 | Ga0453684_0020439 | 3300044712 | Bacteria | 9985 |
| 362 | Ga0451576_0006637 | 3300045051 | Bacteria | 14133 |
| 363 | Ga0451576_0006808 | 3300045051 | Bacteria | 13890 |
| 364 | Ga0451576_0035484 | 3300045051 | Bacteria | 5289 |
| 365 | Ga0451576_0050655 | 3300045051 | Bacteria | 4354 |
| 366 | Ga0451576_0080942 | 3300045051 | Bacteria | 3378 |
| 367 | Ga0451576_0105770 | 3300045051 | Bacteria | 2928 |
| 368 | Ga0451576_0275122 | 3300045051 | Bacteria | 1760 |
| 369 | Ga0495580_0010134 | 3300046472 | Bacteria | 7362 |
| 370 | Ga0495670_0167605 | 3300046691 | Bacteria | 1156 |
| 371 | Ga0496102_0044804 | 3300048905 | Bacteria | 4015 |
| 372 | Ga0496102_0078503 | 3300048905 | Bacteria | 3039 |
| 373 | Ga0496102_0131947 | 3300048905 | Bacteria | 2339 |
| 374 | Ga0496106_0088302 | 3300048909 | Bacteria | 2390 |
| 375 | Ga0496107_0114516 | 3300048910 | Bacteria | 1984 |
| 376 | Ga0501036_0397787 | 3300049572 | Bacteria | 1149 |
| 377 | Ga0501037_0045399 | 3300049573 | Bacteria | 3226 |
| 378 | Ga0501037_0060145 | 3300049573 | Bacteria | 2771 |
| 379 | Ga0501038_0033796 | 3300049574 | Bacteria | 4501 |
| 380 | Ga0501039_0245938 | 3300049575 | Bacteria | 1407 |
| 381 | Ga0501039_0381993 | 3300049575 | Bacteria | 1106 |
| 382 | Ga0501040_0011006 | 3300049576 | Bacteria | 5916 |
| 383 | Ga0501040_0011567 | 3300049576 | Bacteria | 5775 |
| 384 | Ga0501040_0033069 | 3300049576 | Bacteria | 3501 |
| 385 | Ga0501040_0093706 | 3300049576 | Bacteria | 2089 |
| 386 | Ga0501040_0128768 | 3300049576 | Bacteria | 1779 |
| 387 | Ga0501041_0005353 | 3300049577 | Bacteria | 7513 |
| 388 | Ga0501041_0060877 | 3300049577 | Bacteria | 2311 |
| 389 | Ga0501041_0088650 | 3300049577 | Bacteria | 1910 |
| 390 | Ga0501041_0201305 | 3300049577 | Bacteria | 1248 |
| 391 | Ga0501042_0008138 | 3300049578 | Bacteria | 6906 |
| 392 | Ga0501042_0028348 | 3300049578 | Bacteria | 3944 |
| 393 | Ga0501042_0041890 | 3300049578 | Bacteria | 3257 |
| 394 | Ga0501042_0118392 | 3300049578 | Bacteria | 1907 |
| 395 | Ga0501042_0139917 | 3300049578 | Bacteria | 1745 |
| 396 | Ga0501046_0000303 | 3300049580 | Bacteria | 49710 |
| 397 | Ga0501046_0016616 | 3300049580 | Bacteria | 6159 |
| 398 | Ga0501046_0120963 | 3300049580 | Bacteria | 1992 |
| 399 | Ga0501046_0331164 | 3300049580 | Bacteria | 1108 |
| 400 | Ga0501047_0114303 | 3300049581 | Bacteria | 2581 |
| 401 | Ga0501048_0013358 | 3300049582 | Bacteria | 6094 |
| 402 | Ga0501072_0059825 | 3300049588 | Bacteria | 3004 |
| 403 | Ga0501072_0112675 | 3300049588 | Bacteria | 2166 |
| 404 | Ga0501073_0256792 | 3300049589 | Bacteria | 1206 |
| 405 | Ga0501074_0007053 | 3300049590 | Bacteria | 8119 |
| 406 | Ga0501075_0010023 | 3300049591 | Bacteria | 6648 |
| 407 | Ga0501075_0017718 | 3300049591 | Bacteria | 5143 |
| 408 | Ga0501075_0067392 | 3300049591 | Bacteria | 2703 |
| 409 | Ga0501075_0089619 | 3300049591 | Bacteria | 2332 |
| 410 | Ga0501075_0142127 | 3300049591 | Bacteria | 1829 |
| 411 | Ga0501075_0187553 | 3300049591 | Unclassified | 1577 |
| 412 | Ga0501076_0023088 | 3300049592 | Bacteria | 4789 |
| 413 | Ga0501076_0030464 | 3300049592 | Bacteria | 4202 |
| 414 | Ga0501076_0049908 | 3300049592 | Bacteria | 3310 |
| 415 | Ga0501076_0103186 | 3300049592 | Bacteria | 2300 |
| 416 | Ga0501076_0107315 | 3300049592 | Bacteria | 2255 |
| 417 | Ga0501076_0116392 | 3300049592 | Bacteria | 2163 |
| 418 | Ga0501076_0440830 | 3300049592 | Bacteria | 1072 |
| 419 | Ga0501077_0027974 | 3300049593 | Bacteria | 3583 |
| 420 | Ga0501077_0033808 | 3300049593 | Bacteria | 3255 |
| 421 | Ga0501077_0044964 | 3300049593 | Bacteria | 2805 |
| 422 | Ga0501077_0057419 | 3300049593 | Bacteria | 2471 |
| 423 | Ga0501077_0064175 | 3300049593 | Bacteria | 2330 |
| 424 | Ga0501077_0098574 | 3300049593 | Bacteria | 1852 |
| 425 | Ga0501077_0099173 | 3300049593 | Bacteria | 1846 |
| 426 | Ga0501079_0000600 | 3300049741 | Bacteria | 23913 |
| 427 | Ga0501079_0001407 | 3300049741 | Bacteria | 16936 |
| 428 | Ga0501079_0168238 | 3300049741 | Bacteria | 1709 |
| 429 | Ga0501079_0348551 | 3300049741 | Bacteria | 1160 |
| 430 | Ga0501080_0037951 | 3300049742 | Bacteria | 4499 |
| 431 | Ga0501080_0138936 | 3300049742 | Bacteria | 2247 |
| 432 | Ga0501080_0224919 | 3300049742 | Bacteria | 1716 |
| 433 | Ga0501081_0002259 | 3300049743 | Bacteria | 12118 |
| 434 | Ga0501081_0011090 | 3300049743 | Bacteria | 5894 |
| 435 | Ga0501081_0064098 | 3300049743 | Bacteria | 2552 |
| 436 | Ga0501081_0090487 | 3300049743 | Bacteria | 2151 |
| 437 | Ga0501083_0007814 | 3300049744 | Bacteria | 7577 |
| 438 | Ga0501083_0063970 | 3300049744 | Bacteria | 2453 |
| 439 | Ga0501035_0188674 | 3300049822 | Bacteria | 1773 |
| 440 | Ga0501045_0012296 | 3300049824 | Bacteria | 6028 |
| 441 | Ga0501045_0081462 | 3300049824 | Bacteria | 2387 |
| 442 | nmdc:mga05p37_11406_c1 | 3300050507 | Bacteria | 10578 |
| 443 | nmdc:mga05p37_143110_c1 | 3300050507 | Bacteria | 2929 |
| 444 | nmdc:mga05p37_143923_c1 | 3300050507 | Bacteria | 2920 |
| 445 | nmdc:mga05p37_20197_c1 | 3300050507 | Bacteria | 8062 |
| 446 | nmdc:mga05p37_24360_c1 | 3300050507 | Bacteria | 7354 |
| 447 | nmdc:mga05p37_271002_c1 | 3300050507 | Bacteria | 2028 |
| 448 | nmdc:mga05p37_446207_c1 | 3300050507 | Bacteria | 1499 |
| 449 | nmdc:mga05p37_453472_c1 | 3300050507 | Bacteria | 1484 |
| 450 | nmdc:mga05p37_63216_c1 | 3300050507 | Bacteria | 4555 |
| 451 | nmdc:mga05p37_797339_c1 | 3300050507 | Bacteria | 1034 |
| 452 | nmdc:mga05p37_94337_c1 | 3300050507 | Bacteria | 3687 |
| 453 | nmdc:mga09592_20256_c1 | 3300050508 | Bacteria | 5467 |
| 454 | nmdc:mga09592_216637_c1 | 3300050508 | Bacteria | 1659 |
| 455 | nmdc:mga09592_282516_c1 | 3300050508 | Bacteria | 1440 |
| 456 | nmdc:mga09592_311024_c1 | 3300050508 | Unclassified | 1365 |
| 457 | nmdc:mga09592_312823_c1 | 3300050508 | Bacteria | 1361 |
| 458 | nmdc:mga09592_601_c1 | 3300050508 | Bacteria | 27297 |
| 459 | nmdc:mga0qj67_1405_c1 | 3300050509 | Bacteria | 16858 |
| 460 | nmdc:mga0qj67_20036_c1 | 3300050509 | Bacteria | 5118 |
| 461 | nmdc:mga0qj67_59377_c1 | 3300050509 | Bacteria | 3033 |
| 462 | nmdc:mga06r32_13298_c1 | 3300050510 | Bacteria | 7453 |
| 463 | nmdc:mga06r32_205_c1 | 3300050510 | Bacteria | 47453 |
| 464 | nmdc:mga06r32_24025_c1 | 3300050510 | Bacteria | 5651 |
| 465 | nmdc:mga06r32_49784_c1 | 3300050510 | Bacteria | 4008 |
| 466 | nmdc:mga06r32_67230_c1 | 3300050510 | Bacteria | 3460 |
| 467 | nmdc:mga06r32_90681_c1 | 3300050510 | Bacteria | 2986 |
| 468 | nmdc:mga08y16_12593_c1 | 3300050511 | Bacteria | 8897 |
| 469 | nmdc:mga08y16_14092_c1 | 3300050511 | Bacteria | 8416 |
| 470 | nmdc:mga08y16_23990_c1 | 3300050511 | Bacteria | 6442 |
| 471 | nmdc:mga08y16_305319_c1 | 3300050511 | Bacteria | 1640 |
| 472 | nmdc:mga0n895_271704_c1 | 3300050512 | Bacteria | 1719 |
| 473 | nmdc:mga0n895_3639_c1 | 3300050512 | Bacteria | 12462 |
| 474 | nmdc:mga0n895_376073_c1 | 3300050512 | Bacteria | 1438 |
| 475 | nmdc:mga0n895_41216_c1 | 3300050512 | Bacteria | 4488 |
| 476 | nmdc:mga0n895_41613_c1 | 3300050512 | Bacteria | 4468 |
| 477 | nmdc:mga0n895_59945_c1 | 3300050512 | Bacteria | 3755 |
| 478 | nmdc:mga0n895_82189_c1 | 3300050512 | Bacteria | 3211 |
| 479 | nmdc:mga0rr50_11178_c1 | 3300050513 | Bacteria | 5729 |
| 480 | nmdc:mga0rr50_129004_c1 | 3300050513 | Bacteria | 2022 |
| 481 | nmdc:mga0rr50_28522_c1 | 3300050513 | Bacteria | 3925 |
| 482 | nmdc:mga0rr50_39917_c1 | 3300050513 | Bacteria | 3408 |
| 483 | nmdc:mga0rr50_94021_c1 | 3300050513 | Bacteria | 2340 |
| 484 | nmdc:mga08x19_20879_c1 | 3300050514 | Bacteria | 4037 |
| 485 | nmdc:mga08x19_28556_c1 | 3300050514 | Bacteria | 3494 |
| 486 | nmdc:mga08x19_59940_c1 | 3300050514 | Bacteria | 2465 |
| 487 | nmdc:mga0a205_11449_c1 | 3300050515 | Bacteria | 8167 |
| 488 | nmdc:mga0a205_140552_c1 | 3300050515 | Bacteria | 2315 |
| 489 | nmdc:mga0a205_48508_c1 | 3300050515 | Bacteria | 4098 |
| 490 | nmdc:mga0a205_62377_c1 | 3300050515 | Bacteria | 3601 |
| 491 | nmdc:mga0a205_75939_c1 | 3300050515 | Bacteria | 3247 |
| 492 | nmdc:mga0a205_8013_c1 | 3300050515 | Bacteria | 9601 |
| 493 | Ga0501084_0002736 | 3300054114 | Bacteria | 14225 |
| 494 | Ga0501084_0005319 | 3300054114 | Bacteria | 10540 |
| 495 | Ga0501084_0007675 | 3300054114 | Bacteria | 8887 |
| 496 | Ga0501084_0065189 | 3300054114 | Bacteria | 3047 |
| 497 | Ga0501084_0106464 | 3300054114 | Bacteria | 2356 |
| 498 | Ga0501084_0222984 | 3300054114 | Bacteria | 1591 |
| 499 | Ga0501084_0287252 | 3300054114 | Bacteria | 1389 |
| 500 | Ga0501082_0000212 | 3300060353 | Bacteria | 50890 |
| 501 | Ga0501082_0066220 | 3300060353 | Bacteria | 3111 |
| 502 | Ga0501082_0083794 | 3300060353 | Bacteria | 2750 |
| 503 | Ga0530510_0205517 | 3300061734 | Bacteria | 1463 |
| 504 | Ga0530510_0223776 | 3300061734 | Unclassified | 1399 |
| 505 | Ga0530510_0255797 | 3300061734 | Bacteria | 1305 |
| 506 | Ga0530510_0291587 | 3300061734 | Bacteria | 1220 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049593 | Ga0501077_0098574 | Ga0501077_0098574_1023_1841 | 258 |
| 2 | 3300049593 | Ga0501077_0064175 | Ga0501077_0064175_33_893 | 264 |
| 3 | 3300026035 | Ga0207703_10141422 | Ga0207703_101414222 | 273 |
| 4 | iso_pu_bacteria | 2929199973 | 2929201493 | 278 |
| 5 | iso_pu_bacteria | 8055909800 | 8055915696 | 278 |
| 6 | 3300005440 | Ga0070705_100214645 | Ga0070705_1002146451 | 280 |
| 7 | 3300005468 | Ga0070707_100243720 | Ga0070707_1002437202 | 280 |
| 8 | 3300005471 | Ga0070698_100092817 | Ga0070698_1000928172 | 280 |
| 9 | 3300005518 | Ga0070699_100027881 | Ga0070699_1000278813 | 280 |
| 10 | 3300007265 | Ga0099794_10175639 | Ga0099794_101756392 | 280 |
| 11 | 3300025922 | Ga0207646_10283117 | Ga0207646_102831171 | 280 |
| 12 | 3300005467 | Ga0070706_100010899 | Ga0070706_1000108995 | 282 |
| 13 | 3300005468 | Ga0070707_100069183 | Ga0070707_1000691833 | 282 |
| 14 | 3300005471 | Ga0070698_100044378 | Ga0070698_1000443783 | 282 |
| 15 | 3300005518 | Ga0070699_100004855 | Ga0070699_1000048553 | 282 |
| 16 | 3300005536 | Ga0070697_100040278 | Ga0070697_1000402782 | 282 |
| 17 | 3300005545 | Ga0070695_100278110 | Ga0070695_1002781101 | 282 |
| 18 | 3300005937 | Ga0081455_10001120 | Ga0081455_1000112012 | 282 |
| 19 | 3300006173 | Ga0070716_100000651 | Ga0070716_1000006513 | 282 |
| 20 | 3300006852 | Ga0075433_10026037 | Ga0075433_100260372 | 282 |
| 21 | 3300025922 | Ga0207646_10077660 | Ga0207646_100776603 | 282 |
| 22 | 3300025939 | Ga0207665_10010772 | Ga0207665_100107723 | 282 |
| 23 | 3300027695 | Ga0209966_1008120 | Ga0209966_10081201 | 282 |
| 24 | 3300044673 | Ga0453683_0006026 | Ga0453683_0006026_4282_5181 | 282 |
| 25 | 3300050507 | nmdc:mga05p37_143110_c1 | nmdc:mga05p37_143110_c1_227_1138 | 282 |
| 26 | 3300050508 | nmdc:mga09592_216637_c1 | nmdc:mga09592_216637_c1_526_1416 | 282 |
| 27 | 3300050512 | nmdc:mga0n895_41216_c1 | nmdc:mga0n895_41216_c1_2781_3674 | 282 |
| 28 | 3300050514 | nmdc:mga08x19_59940_c1 | nmdc:mga08x19_59940_c1_1346_2239 | 282 |
| 29 | 3300050515 | nmdc:mga0a205_11449_c1 | nmdc:mga0a205_11449_c1_445_1338 | 282 |
| 30 | 3300005334 | Ga0068869_100005949 | Ga0068869_1000059497 | 283 |
| 31 | 3300005545 | Ga0070695_100010563 | Ga0070695_1000105636 | 283 |
| 32 | 3300005546 | Ga0070696_100038946 | Ga0070696_1000389463 | 283 |
| 33 | 3300005719 | Ga0068861_100277330 | Ga0068861_1002773302 | 283 |
| 34 | 3300007265 | Ga0099794_10002225 | Ga0099794_100022256 | 283 |
| 35 | 3300009553 | Ga0105249_10420668 | Ga0105249_104206681 | 283 |
| 36 | 3300025942 | Ga0207689_10010357 | Ga0207689_100103578 | 283 |
| 37 | 3300025961 | Ga0207712_10107906 | Ga0207712_101079062 | 283 |
| 38 | 3300026118 | Ga0207675_100157287 | Ga0207675_1001572873 | 283 |
| 39 | 3300005444 | Ga0070694_100003863 | Ga0070694_1000038634 | 284 |
| 40 | 3300005445 | Ga0070708_100018070 | Ga0070708_1000180701 | 284 |
| 41 | 3300005445 | Ga0070708_100035069 | Ga0070708_1000350693 | 284 |
| 42 | 3300005467 | Ga0070706_100026249 | Ga0070706_1000262492 | 284 |
| 43 | 3300005467 | Ga0070706_100103787 | Ga0070706_1001037872 | 284 |
| 44 | 3300005468 | Ga0070707_100032917 | Ga0070707_1000329173 | 284 |
| 45 | 3300005468 | Ga0070707_100093947 | Ga0070707_1000939473 | 284 |
| 46 | 3300005471 | Ga0070698_100005995 | Ga0070698_1000059957 | 284 |
| 47 | 3300005471 | Ga0070698_100364277 | Ga0070698_1003642772 | 284 |
| 48 | 3300005518 | Ga0070699_100175419 | Ga0070699_1001754192 | 284 |
| 49 | 3300005536 | Ga0070697_100001063 | Ga0070697_10000106322 | 284 |
| 50 | 3300006880 | Ga0075429_100093279 | Ga0075429_1000932793 | 284 |
| 51 | 3300025910 | Ga0207684_10000425 | Ga0207684_1000042518 | 284 |
| 52 | 3300025922 | Ga0207646_10000645 | Ga0207646_1000064511 | 284 |
| 53 | 3300025922 | Ga0207646_10031732 | Ga0207646_100317323 | 284 |
| 54 | 3300025922 | Ga0207646_10317596 | Ga0207646_103175962 | 284 |
| 55 | 3300042876 | Ga0451577_0016518 | Ga0451577_0016518_5470_6384 | 284 |
| 56 | 3300044673 | Ga0453683_0109402 | Ga0453683_0109402_192_1106 | 284 |
| 57 | 3300044712 | Ga0453684_0019600 | Ga0453684_0019600_5984_6898 | 284 |
| 58 | 3300045051 | Ga0451576_0035484 | Ga0451576_0035484_2386_3318 | 284 |
| 59 | 3300045051 | Ga0451576_0275122 | Ga0451576_0275122_654_1568 | 284 |
| 60 | 3300049580 | Ga0501046_0331164 | Ga0501046_0331164_138_1040 | 284 |
| 61 | 3300049591 | Ga0501075_0089619 | Ga0501075_0089619_1140_2042 | 284 |
| 62 | 3300049592 | Ga0501076_0116392 | Ga0501076_0116392_237_1139 | 284 |
| 63 | 3300049593 | Ga0501077_0044964 | Ga0501077_0044964_781_1683 | 284 |
| 64 | 3300049741 | Ga0501079_0168238 | Ga0501079_0168238_70_972 | 284 |
| 65 | 3300049742 | Ga0501080_0224919 | Ga0501080_0224919_736_1638 | 284 |
| 66 | 3300050508 | nmdc:mga09592_311024_c1 | nmdc:mga09592_311024_c1_298_1239 | 284 |
| 67 | 3300054114 | Ga0501084_0065189 | Ga0501084_0065189_52_954 | 284 |
| 68 | 3300005445 | Ga0070708_100016456 | Ga0070708_1000164567 | 285 |
| 69 | 3300005518 | Ga0070699_100179459 | Ga0070699_1001794592 | 285 |
| 70 | 3300006844 | Ga0075428_100039962 | Ga0075428_1000399625 | 285 |
| 71 | 3300006846 | Ga0075430_100001778 | Ga0075430_1000017783 | 285 |
| 72 | 3300006847 | Ga0075431_100005232 | Ga0075431_1000052323 | 285 |
| 73 | 3300009147 | Ga0114129_10003334 | Ga0114129_1000333422 | 285 |
| 74 | 3300025910 | Ga0207684_10039752 | Ga0207684_100397523 | 285 |
| 75 | 3300050507 | nmdc:mga05p37_11406_c1 | nmdc:mga05p37_11406_c1_4898_5824 | 285 |
| 76 | 3300050509 | nmdc:mga0qj67_20036_c1 | nmdc:mga0qj67_20036_c1_3147_4073 | 285 |
| 77 | 3300050510 | nmdc:mga06r32_13298_c1 | nmdc:mga06r32_13298_c1_1530_2456 | 285 |
| 78 | 3300005615 | Ga0070702_100318923 | Ga0070702_1003189231 | 286 |
| 79 | 3300025922 | Ga0207646_10019390 | Ga0207646_100193904 | 286 |
| 80 | 3300005440 | Ga0070705_100228853 | Ga0070705_1002288532 | 287 |
| 81 | 3300005444 | Ga0070694_100013182 | Ga0070694_1000131823 | 287 |
| 82 | 3300005536 | Ga0070697_100265060 | Ga0070697_1002650602 | 287 |
| 83 | 3300005547 | Ga0070693_100183798 | Ga0070693_1001837982 | 287 |
| 84 | 3300005549 | Ga0070704_100017013 | Ga0070704_1000170133 | 287 |
| 85 | 3300005617 | Ga0068859_100006591 | Ga0068859_10000659112 | 287 |
| 86 | 3300006871 | Ga0075434_100007646 | Ga0075434_1000076468 | 287 |
| 87 | 3300006931 | Ga0097620_100006591 | Ga0097620_10000659112 | 287 |
| 88 | 3300025942 | Ga0207689_10096028 | Ga0207689_100960282 | 287 |
| 89 | 3300048905 | Ga0496102_0044804 | Ga0496102_0044804_1081_2007 | 287 |
| 90 | 3300048909 | Ga0496106_0088302 | Ga0496106_0088302_1375_2301 | 287 |
| 91 | 3300049572 | Ga0501036_0397787 | Ga0501036_0397787_38_973 | 287 |
| 92 | 3300049573 | Ga0501037_0045399 | Ga0501037_0045399_2126_3061 | 287 |
| 93 | 3300049576 | Ga0501040_0011567 | Ga0501040_0011567_2264_3199 | 287 |
| 94 | 3300049578 | Ga0501042_0028348 | Ga0501042_0028348_1981_2916 | 287 |
| 95 | 3300049591 | Ga0501075_0187553 | Ga0501075_0187553_573_1508 | 287 |
| 96 | 3300049592 | Ga0501076_0023088 | Ga0501076_0023088_1373_2308 | 287 |
| 97 | 3300049743 | Ga0501081_0011090 | Ga0501081_0011090_1988_2923 | 287 |
| 98 | 3300049822 | Ga0501035_0188674 | Ga0501035_0188674_161_1096 | 287 |
| 99 | 3300049824 | Ga0501045_0012296 | Ga0501045_0012296_2013_2948 | 287 |
| 100 | 3300050512 | nmdc:mga0n895_3639_c1 | nmdc:mga0n895_3639_c1_4192_5121 | 287 |
| 101 | 3300050515 | nmdc:mga0a205_62377_c1 | nmdc:mga0a205_62377_c1_1171_2100 | 287 |
| 102 | 3300054114 | Ga0501084_0005319 | Ga0501084_0005319_6525_7460 | 287 |
| 103 | 3300061734 | Ga0530510_0205517 | Ga0530510_0205517_293_1228 | 287 |
| 104 | 3300061734 | Ga0530510_0223776 | Ga0530510_0223776_403_1338 | 287 |
| 105 | 3300005331 | Ga0070670_100003552 | Ga0070670_1000035526 | 288 |
| 106 | 3300005333 | Ga0070677_10113234 | Ga0070677_101132341 | 288 |
| 107 | 3300005334 | Ga0068869_100000441 | Ga0068869_10000044113 | 288 |
| 108 | 3300005335 | Ga0070666_10129598 | Ga0070666_101295982 | 288 |
| 109 | 3300005336 | Ga0070680_100001037 | Ga0070680_1000010372 | 288 |
| 110 | 3300005337 | Ga0070682_100000441 | Ga0070682_1000004416 | 288 |
| 111 | 3300005338 | Ga0068868_100011295 | Ga0068868_1000112954 | 288 |
| 112 | 3300005339 | Ga0070660_100000167 | Ga0070660_1000001674 | 288 |
| 113 | 3300005340 | Ga0070689_100010529 | Ga0070689_1000105292 | 288 |
| 114 | 3300005341 | Ga0070691_10010735 | Ga0070691_100107353 | 288 |
| 115 | 3300005343 | Ga0070687_100018536 | Ga0070687_1000185363 | 288 |
| 116 | 3300005344 | Ga0070661_100019188 | Ga0070661_1000191883 | 288 |
| 117 | 3300005345 | Ga0070692_10000218 | Ga0070692_1000021813 | 288 |
| 118 | 3300005366 | Ga0070659_100001067 | Ga0070659_10000106712 | 288 |
| 119 | 3300005406 | Ga0070703_10002309 | Ga0070703_100023093 | 288 |
| 120 | 3300005438 | Ga0070701_10041255 | Ga0070701_100412552 | 288 |
| 121 | 3300005440 | Ga0070705_100000739 | Ga0070705_10000073914 | 288 |
| 122 | 3300005444 | Ga0070694_100000546 | Ga0070694_1000005463 | 288 |
| 123 | 3300005455 | Ga0070663_100002687 | Ga0070663_1000026876 | 288 |
| 124 | 3300005457 | Ga0070662_100007954 | Ga0070662_1000079542 | 288 |
| 125 | 3300005458 | Ga0070681_10017635 | Ga0070681_100176356 | 288 |
| 126 | 3300005459 | Ga0068867_100002988 | Ga0068867_1000029889 | 288 |
| 127 | 3300005530 | Ga0070679_100001116 | Ga0070679_1000011165 | 288 |
| 128 | 3300005539 | Ga0068853_100000940 | Ga0068853_10000094015 | 288 |
| 129 | 3300005545 | Ga0070695_100001716 | Ga0070695_1000017168 | 288 |
| 130 | 3300005546 | Ga0070696_100000619 | Ga0070696_1000006198 | 288 |
| 131 | 3300005547 | Ga0070693_100000058 | Ga0070693_10000005834 | 288 |
| 132 | 3300005549 | Ga0070704_100006116 | Ga0070704_1000061162 | 288 |
| 133 | 3300005563 | Ga0068855_100002413 | Ga0068855_10000241314 | 288 |
| 134 | 3300005564 | Ga0070664_100002214 | Ga0070664_1000022148 | 288 |
| 135 | 3300005577 | Ga0068857_100087444 | Ga0068857_1000874442 | 288 |
| 136 | 3300005578 | Ga0068854_100034465 | Ga0068854_1000344653 | 288 |
| 137 | 3300005614 | Ga0068856_100000929 | Ga0068856_10000092915 | 288 |
| 138 | 3300005615 | Ga0070702_100003973 | Ga0070702_1000039736 | 288 |
| 139 | 3300005616 | Ga0068852_100161235 | Ga0068852_1001612352 | 288 |
| 140 | 3300005618 | Ga0068864_100028108 | Ga0068864_1000281085 | 288 |
| 141 | 3300005719 | Ga0068861_100003185 | Ga0068861_1000031856 | 288 |
| 142 | 3300005840 | Ga0068870_10000518 | Ga0068870_100005185 | 288 |
| 143 | 3300005841 | Ga0068863_100044864 | Ga0068863_1000448643 | 288 |
| 144 | 3300005842 | Ga0068858_100317006 | Ga0068858_1003170062 | 288 |
| 145 | 3300005843 | Ga0068860_100025685 | Ga0068860_1000256852 | 288 |
| 146 | 3300005844 | Ga0068862_100002103 | Ga0068862_1000021033 | 288 |
| 147 | 3300005844 | Ga0068862_100242256 | Ga0068862_1002422562 | 288 |
| 148 | 3300006852 | Ga0075433_10191800 | Ga0075433_101918002 | 288 |
| 149 | 3300006871 | Ga0075434_100055550 | Ga0075434_1000555504 | 288 |
| 150 | 3300006871 | Ga0075434_100174030 | Ga0075434_1001740302 | 288 |
| 151 | 3300007076 | Ga0075435_100072862 | Ga0075435_1000728622 | 288 |
| 152 | 3300007076 | Ga0075435_100242101 | Ga0075435_1002421011 | 288 |
| 153 | 3300009094 | Ga0111539_10000715 | Ga0111539_1000071511 | 288 |
| 154 | 3300009147 | Ga0114129_10085342 | Ga0114129_100853423 | 288 |
| 155 | 3300009174 | Ga0105241_10000582 | Ga0105241_1000058214 | 288 |
| 156 | 3300010375 | Ga0105239_10097799 | Ga0105239_100977994 | 288 |
| 157 | 3300013100 | Ga0157373_10000229 | Ga0157373_100002295 | 288 |
| 158 | 3300013102 | Ga0157371_10099595 | Ga0157371_100995952 | 288 |
| 159 | 3300013105 | Ga0157369_10009446 | Ga0157369_100094465 | 288 |
| 160 | 3300013307 | Ga0157372_10000144 | Ga0157372_1000014417 | 288 |
| 161 | 3300013308 | Ga0157375_10238878 | Ga0157375_102388782 | 288 |
| 162 | 3300015262 | Ga0182007_10008367 | Ga0182007_100083673 | 288 |
| 163 | 3300020082 | Ga0206353_11287094 | Ga0206353_112870941 | 288 |
| 164 | 3300025885 | Ga0207653_10002270 | Ga0207653_100022702 | 288 |
| 165 | 3300025901 | Ga0207688_10014419 | Ga0207688_100144192 | 288 |
| 166 | 3300025907 | Ga0207645_10000560 | Ga0207645_1000056017 | 288 |
| 167 | 3300025908 | Ga0207643_10001850 | Ga0207643_100018505 | 288 |
| 168 | 3300025911 | Ga0207654_10002320 | Ga0207654_100023203 | 288 |
| 169 | 3300025912 | Ga0207707_10000280 | Ga0207707_1000028015 | 288 |
| 170 | 3300025917 | Ga0207660_10000076 | Ga0207660_100000766 | 288 |
| 171 | 3300025919 | Ga0207657_10000383 | Ga0207657_1000038316 | 288 |
| 172 | 3300025920 | Ga0207649_10004400 | Ga0207649_100044008 | 288 |
| 173 | 3300025921 | Ga0207652_10000681 | Ga0207652_1000068119 | 288 |
| 174 | 3300025932 | Ga0207690_10002609 | Ga0207690_1000260912 | 288 |
| 175 | 3300025933 | Ga0207706_10001349 | Ga0207706_1000134922 | 288 |
| 176 | 3300025933 | Ga0207706_10078506 | Ga0207706_100785062 | 288 |
| 177 | 3300025936 | Ga0207670_10119416 | Ga0207670_101194162 | 288 |
| 178 | 3300025942 | Ga0207689_10000127 | Ga0207689_1000012742 | 288 |
| 179 | 3300025944 | Ga0207661_10286002 | Ga0207661_102860021 | 288 |
| 180 | 3300025945 | Ga0207679_10000422 | Ga0207679_100004227 | 288 |
| 181 | 3300025949 | Ga0207667_10003623 | Ga0207667_1000362318 | 288 |
| 182 | 3300025981 | Ga0207640_10014890 | Ga0207640_100148902 | 288 |
| 183 | 3300026041 | Ga0207639_10001822 | Ga0207639_100018226 | 288 |
| 184 | 3300026067 | Ga0207678_10001588 | Ga0207678_1000158815 | 288 |
| 185 | 3300026078 | Ga0207702_10006321 | Ga0207702_1000632110 | 288 |
| 186 | 3300026089 | Ga0207648_10001700 | Ga0207648_1000170013 | 288 |
| 187 | 3300026095 | Ga0207676_10053850 | Ga0207676_100538503 | 288 |
| 188 | 3300026116 | Ga0207674_10000720 | Ga0207674_100007207 | 288 |
| 189 | 3300026118 | Ga0207675_100004428 | Ga0207675_1000044286 | 288 |
| 190 | 3300026142 | Ga0207698_10131559 | Ga0207698_101315592 | 288 |
| 191 | 3300027907 | Ga0207428_10000631 | Ga0207428_1000063133 | 288 |
| 192 | 3300028380 | Ga0268265_10003385 | Ga0268265_100033852 | 288 |
| 193 | 3300028381 | Ga0268264_10012691 | Ga0268264_100126914 | 288 |
| 194 | 3300031548 | Ga0307408_100007207 | Ga0307408_1000072076 | 288 |
| 195 | 3300032002 | Ga0307416_100025069 | Ga0307416_1000250694 | 288 |
| 196 | 3300035121 | Ga0373960_0000907 | Ga0373960_0000907_2013_2939 | 288 |
| 197 | 3300042876 | Ga0451577_0003313 | Ga0451577_0003313_10027_10950 | 288 |
| 198 | 3300042876 | Ga0451577_0035032 | Ga0451577_0035032_651_1577 | 288 |
| 199 | 3300044673 | Ga0453683_0074102 | Ga0453683_0074102_244_1167 | 288 |
| 200 | 3300044712 | Ga0453684_0020439 | Ga0453684_0020439_5024_5947 | 288 |
| 201 | 3300045051 | Ga0451576_0006637 | Ga0451576_0006637_5440_6363 | 288 |
| 202 | 3300045051 | Ga0451576_0105770 | Ga0451576_0105770_1405_2328 | 288 |
| 203 | 3300048905 | Ga0496102_0078503 | Ga0496102_0078503_981_1907 | 288 |
| 204 | 3300050507 | nmdc:mga05p37_797339_c1 | nmdc:mga05p37_797339_c1_86_1024 | 288 |
| 205 | 3300050507 | nmdc:mga05p37_94337_c1 | nmdc:mga05p37_94337_c1_2573_3499 | 288 |
| 206 | 3300050511 | nmdc:mga08y16_12593_c1 | nmdc:mga08y16_12593_c1_6317_7240 | 288 |
| 207 | 3300050513 | nmdc:mga0rr50_39917_c1 | nmdc:mga0rr50_39917_c1_2382_3320 | 288 |
| 208 | 3300050513 | nmdc:mga0rr50_94021_c1 | nmdc:mga0rr50_94021_c1_135_1061 | 288 |
| 209 | 3300050515 | nmdc:mga0a205_75939_c1 | nmdc:mga0a205_75939_c1_2226_3152 | 288 |
| 210 | 3300006844 | Ga0075428_100149548 | Ga0075428_1001495482 | 289 |
| 211 | 3300006871 | Ga0075434_100002983 | Ga0075434_1000029835 | 289 |
| 212 | 3300009147 | Ga0114129_10099619 | Ga0114129_100996192 | 289 |
| 213 | 3300027907 | Ga0207428_10216115 | Ga0207428_102161151 | 289 |
| 214 | 3300050511 | nmdc:mga08y16_23990_c1 | nmdc:mga08y16_23990_c1_1178_2104 | 289 |
| 215 | 3300050512 | nmdc:mga0n895_82189_c1 | nmdc:mga0n895_82189_c1_2219_3145 | 289 |
| 216 | 3300050513 | nmdc:mga0rr50_129004_c1 | nmdc:mga0rr50_129004_c1_767_1693 | 289 |
| 217 | 3300050515 | nmdc:mga0a205_8013_c1 | nmdc:mga0a205_8013_c1_1439_2365 | 289 |
| 218 | 3300006871 | Ga0075434_100555982 | Ga0075434_1005559821 | 290 |
| 219 | 3300006844 | Ga0075428_100000435 | Ga0075428_10000043525 | 292 |
| 220 | 3300006846 | Ga0075430_100010088 | Ga0075430_1000100883 | 292 |
| 221 | 3300006847 | Ga0075431_100024616 | Ga0075431_1000246162 | 292 |
| 222 | 3300006880 | Ga0075429_100000189 | Ga0075429_10000018933 | 292 |
| 223 | 3300050508 | nmdc:mga09592_601_c1 | nmdc:mga09592_601_c1_12282_13220 | 292 |
| 224 | 3300050509 | nmdc:mga0qj67_59377_c1 | nmdc:mga0qj67_59377_c1_485_1423 | 292 |
| 225 | 3300050510 | nmdc:mga06r32_24025_c1 | nmdc:mga06r32_24025_c1_4502_5440 | 292 |
| 226 | 3300006847 | Ga0075431_100042700 | Ga0075431_1000427006 | 293 |
| 227 | 3300007265 | Ga0099794_10022947 | Ga0099794_100229474 | 293 |
| 228 | 3300009147 | Ga0114129_10000839 | Ga0114129_1000083918 | 293 |
| 229 | 3300050507 | nmdc:mga05p37_20197_c1 | nmdc:mga05p37_20197_c1_4466_5401 | 293 |
| 230 | 3300050510 | nmdc:mga06r32_49784_c1 | nmdc:mga06r32_49784_c1_476_1411 | 293 |
| 231 | 3300005438 | Ga0070701_10134015 | Ga0070701_101340152 | 294 |
| 232 | 3300005546 | Ga0070696_100076384 | Ga0070696_1000763842 | 294 |
| 233 | 3300006847 | Ga0075431_100118578 | Ga0075431_1001185783 | 294 |
| 234 | 3300006914 | Ga0075436_100003897 | Ga0075436_10000389711 | 294 |
| 235 | 3300026089 | Ga0207648_10080225 | Ga0207648_100802252 | 294 |
| 236 | 3300050507 | nmdc:mga05p37_453472_c1 | nmdc:mga05p37_453472_c1_106_1047 | 294 |
| 237 | 3300050512 | nmdc:mga0n895_271704_c1 | nmdc:mga0n895_271704_c1_531_1457 | 294 |
| 238 | 3300050514 | nmdc:mga08x19_28556_c1 | nmdc:mga08x19_28556_c1_237_1178 | 294 |
| 239 | 3300005353 | Ga0070669_100538489 | Ga0070669_1005384891 | 295 |
| 240 | 3300005445 | Ga0070708_100048210 | Ga0070708_1000482103 | 295 |
| 241 | 3300005518 | Ga0070699_100021259 | Ga0070699_1000212593 | 295 |
| 242 | 3300005536 | Ga0070697_100005384 | Ga0070697_1000053846 | 295 |
| 243 | 3300005341 | Ga0070691_10080439 | Ga0070691_100804392 | 296 |
| 244 | 3300005345 | Ga0070692_10070619 | Ga0070692_100706191 | 296 |
| 245 | 3300005440 | Ga0070705_100066520 | Ga0070705_1000665201 | 296 |
| 246 | 3300005459 | Ga0068867_100285991 | Ga0068867_1002859911 | 296 |
| 247 | 3300005468 | Ga0070707_100000971 | Ga0070707_10000097121 | 296 |
| 248 | 3300005468 | Ga0070707_100241843 | Ga0070707_1002418432 | 296 |
| 249 | 3300005518 | Ga0070699_100002124 | Ga0070699_1000021249 | 296 |
| 250 | 3300005536 | Ga0070697_100023648 | Ga0070697_1000236485 | 296 |
| 251 | 3300005546 | Ga0070696_100084321 | Ga0070696_1000843212 | 296 |
| 252 | 3300005549 | Ga0070704_100024239 | Ga0070704_1000242395 | 296 |
| 253 | 3300006844 | Ga0075428_100055095 | Ga0075428_1000550955 | 296 |
| 254 | 3300006847 | Ga0075431_100416224 | Ga0075431_1004162242 | 296 |
| 255 | 3300009094 | Ga0111539_10677404 | Ga0111539_106774041 | 296 |
| 256 | 3300009147 | Ga0114129_10189090 | Ga0114129_101890902 | 296 |
| 257 | 3300009147 | Ga0114129_10334276 | Ga0114129_103342762 | 296 |
| 258 | 3300009148 | Ga0105243_10052990 | Ga0105243_100529903 | 296 |
| 259 | 3300009176 | Ga0105242_10032796 | Ga0105242_100327964 | 296 |
| 260 | 3300025910 | Ga0207684_10019127 | Ga0207684_100191275 | 296 |
| 261 | 3300025922 | Ga0207646_10003426 | Ga0207646_1000342619 | 296 |
| 262 | 3300025927 | Ga0207687_10535001 | Ga0207687_105350011 | 296 |
| 263 | 3300025935 | Ga0207709_10378491 | Ga0207709_103784912 | 296 |
| 264 | 3300026089 | Ga0207648_10329403 | Ga0207648_103294031 | 296 |
| 265 | 3300028381 | Ga0268264_10172127 | Ga0268264_101721271 | 296 |
| 266 | 3300049576 | Ga0501040_0128768 | Ga0501040_0128768_161_1117 | 296 |
| 267 | 3300049577 | Ga0501041_0088650 | Ga0501041_0088650_762_1724 | 296 |
| 268 | 3300049591 | Ga0501075_0067392 | Ga0501075_0067392_1643_2599 | 296 |
| 269 | 3300049592 | Ga0501076_0107315 | Ga0501076_0107315_113_1069 | 296 |
| 270 | 3300049741 | Ga0501079_0348551 | Ga0501079_0348551_49_1011 | 296 |
| 271 | 3300049743 | Ga0501081_0090487 | Ga0501081_0090487_174_1136 | 296 |
| 272 | 3300050507 | nmdc:mga05p37_271002_c1 | nmdc:mga05p37_271002_c1_524_1462 | 296 |
| 273 | 3300005328 | Ga0070676_10008554 | Ga0070676_100085543 | 298 |
| 274 | 3300005330 | Ga0070690_100143938 | Ga0070690_1001439382 | 298 |
| 275 | 3300005330 | Ga0070690_100222469 | Ga0070690_1002224692 | 298 |
| 276 | 3300005331 | Ga0070670_100091510 | Ga0070670_1000915103 | 298 |
| 277 | 3300005334 | Ga0068869_100083013 | Ga0068869_1000830132 | 298 |
| 278 | 3300005336 | Ga0070680_100003438 | Ga0070680_1000034383 | 298 |
| 279 | 3300005337 | Ga0070682_100000431 | Ga0070682_1000004312 | 298 |
| 280 | 3300005339 | Ga0070660_100002407 | Ga0070660_1000024071 | 298 |
| 281 | 3300005340 | Ga0070689_100010334 | Ga0070689_1000103345 | 298 |
| 282 | 3300005341 | Ga0070691_10033127 | Ga0070691_100331272 | 298 |
| 283 | 3300005345 | Ga0070692_10003682 | Ga0070692_100036823 | 298 |
| 284 | 3300005353 | Ga0070669_100011936 | Ga0070669_1000119362 | 298 |
| 285 | 3300005353 | Ga0070669_100207673 | Ga0070669_1002076732 | 298 |
| 286 | 3300005364 | Ga0070673_100007386 | Ga0070673_1000073862 | 298 |
| 287 | 3300005366 | Ga0070659_100000748 | Ga0070659_1000007486 | 298 |
| 288 | 3300005434 | Ga0070709_10061206 | Ga0070709_100612063 | 298 |
| 289 | 3300005440 | Ga0070705_100001807 | Ga0070705_1000018077 | 298 |
| 290 | 3300005440 | Ga0070705_100017019 | Ga0070705_1000170194 | 298 |
| 291 | 3300005441 | Ga0070700_100025850 | Ga0070700_1000258502 | 298 |
| 292 | 3300005444 | Ga0070694_100000520 | Ga0070694_10000052011 | 298 |
| 293 | 3300005445 | Ga0070708_100187734 | Ga0070708_1001877342 | 298 |
| 294 | 3300005445 | Ga0070708_100189544 | Ga0070708_1001895442 | 298 |
| 295 | 3300005445 | Ga0070708_100254680 | Ga0070708_1002546802 | 298 |
| 296 | 3300005455 | Ga0070663_100000680 | Ga0070663_10000068020 | 298 |
| 297 | 3300005457 | Ga0070662_100117784 | Ga0070662_1001177843 | 298 |
| 298 | 3300005458 | Ga0070681_10165867 | Ga0070681_101658673 | 298 |
| 299 | 3300005459 | Ga0068867_100017279 | Ga0068867_1000172795 | 298 |
| 300 | 3300005467 | Ga0070706_100167071 | Ga0070706_1001670712 | 298 |
| 301 | 3300005468 | Ga0070707_100256603 | Ga0070707_1002566032 | 298 |
| 302 | 3300005468 | Ga0070707_100311678 | Ga0070707_1003116782 | 298 |
| 303 | 3300005518 | Ga0070699_100044628 | Ga0070699_1000446283 | 298 |
| 304 | 3300005530 | Ga0070679_100006668 | Ga0070679_1000066688 | 298 |
| 305 | 3300005536 | Ga0070697_100053626 | Ga0070697_1000536263 | 298 |
| 306 | 3300005536 | Ga0070697_100100317 | Ga0070697_1001003173 | 298 |
| 307 | 3300005536 | Ga0070697_100113519 | Ga0070697_1001135193 | 298 |
| 308 | 3300005536 | Ga0070697_100137676 | Ga0070697_1001376762 | 298 |
| 309 | 3300005536 | Ga0070697_100197897 | Ga0070697_1001978972 | 298 |
| 310 | 3300005539 | Ga0068853_100000697 | Ga0068853_10000069717 | 298 |
| 311 | 3300005543 | Ga0070672_100006026 | Ga0070672_1000060267 | 298 |
| 312 | 3300005545 | Ga0070695_100011637 | Ga0070695_1000116372 | 298 |
| 313 | 3300005545 | Ga0070695_100022153 | Ga0070695_1000221532 | 298 |
| 314 | 3300005546 | Ga0070696_100013708 | Ga0070696_1000137083 | 298 |
| 315 | 3300005546 | Ga0070696_100029101 | Ga0070696_1000291012 | 298 |
| 316 | 3300005547 | Ga0070693_100000017 | Ga0070693_10000001760 | 298 |
| 317 | 3300005549 | Ga0070704_100001317 | Ga0070704_1000013175 | 298 |
| 318 | 3300005549 | Ga0070704_100321035 | Ga0070704_1003210351 | 298 |
| 319 | 3300005563 | Ga0068855_100006700 | Ga0068855_1000067003 | 298 |
| 320 | 3300005564 | Ga0070664_100260801 | Ga0070664_1002608012 | 298 |
| 321 | 3300005578 | Ga0068854_100005389 | Ga0068854_1000053892 | 298 |
| 322 | 3300005614 | Ga0068856_100003454 | Ga0068856_10000345417 | 298 |
| 323 | 3300005617 | Ga0068859_100001234 | Ga0068859_10000123421 | 298 |
| 324 | 3300005617 | Ga0068859_100247860 | Ga0068859_1002478602 | 298 |
| 325 | 3300005618 | Ga0068864_100035528 | Ga0068864_1000355283 | 298 |
| 326 | 3300005719 | Ga0068861_100007264 | Ga0068861_1000072643 | 298 |
| 327 | 3300005840 | Ga0068870_10001484 | Ga0068870_100014842 | 298 |
| 328 | 3300005841 | Ga0068863_100182269 | Ga0068863_1001822693 | 298 |
| 329 | 3300005843 | Ga0068860_100027381 | Ga0068860_1000273814 | 298 |
| 330 | 3300005844 | Ga0068862_100028306 | Ga0068862_1000283063 | 298 |
| 331 | 3300006173 | Ga0070716_100006404 | Ga0070716_1000064043 | 298 |
| 332 | 3300006846 | Ga0075430_100001040 | Ga0075430_1000010403 | 298 |
| 333 | 3300006846 | Ga0075430_100011001 | Ga0075430_1000110011 | 298 |
| 334 | 3300006847 | Ga0075431_100000876 | Ga0075431_10000087616 | 298 |
| 335 | 3300006847 | Ga0075431_100002879 | Ga0075431_1000028793 | 298 |
| 336 | 3300006847 | Ga0075431_100036183 | Ga0075431_1000361834 | 298 |
| 337 | 3300006847 | Ga0075431_100162349 | Ga0075431_1001623492 | 298 |
| 338 | 3300006852 | Ga0075433_10002881 | Ga0075433_1000288111 | 298 |
| 339 | 3300006852 | Ga0075433_10016321 | Ga0075433_100163215 | 298 |
| 340 | 3300006852 | Ga0075433_10037138 | Ga0075433_100371382 | 298 |
| 341 | 3300006871 | Ga0075434_100004846 | Ga0075434_1000048468 | 298 |
| 342 | 3300006880 | Ga0075429_100095804 | Ga0075429_1000958043 | 298 |
| 343 | 3300006880 | Ga0075429_100111801 | Ga0075429_1001118012 | 298 |
| 344 | 3300006880 | Ga0075429_100401753 | Ga0075429_1004017531 | 298 |
| 345 | 3300006914 | Ga0075436_100317213 | Ga0075436_1003172131 | 298 |
| 346 | 3300006931 | Ga0097620_100001234 | Ga0097620_10000123421 | 298 |
| 347 | 3300006931 | Ga0097620_100247892 | Ga0097620_1002478922 | 298 |
| 348 | 3300007076 | Ga0075435_100011106 | Ga0075435_1000111062 | 298 |
| 349 | 3300007076 | Ga0075435_100011673 | Ga0075435_1000116735 | 298 |
| 350 | 3300007076 | Ga0075435_100350961 | Ga0075435_1003509611 | 298 |
| 351 | 3300007265 | Ga0099794_10051219 | Ga0099794_100512192 | 298 |
| 352 | 3300009094 | Ga0111539_10004715 | Ga0111539_1000471514 | 298 |
| 353 | 3300009147 | Ga0114129_10085057 | Ga0114129_100850576 | 298 |
| 354 | 3300009147 | Ga0114129_10189192 | Ga0114129_101891925 | 298 |
| 355 | 3300009147 | Ga0114129_10541997 | Ga0114129_105419972 | 298 |
| 356 | 3300009147 | Ga0114129_10586189 | Ga0114129_105861892 | 298 |
| 357 | 3300009147 | Ga0114129_10833391 | Ga0114129_108333912 | 298 |
| 358 | 3300009174 | Ga0105241_10006360 | Ga0105241_100063609 | 298 |
| 359 | 3300009553 | Ga0105249_10551684 | Ga0105249_105516841 | 298 |
| 360 | 3300010375 | Ga0105239_10230837 | Ga0105239_102308372 | 298 |
| 361 | 3300011119 | Ga0105246_10057835 | Ga0105246_100578353 | 298 |
| 362 | 3300013100 | Ga0157373_10001566 | Ga0157373_100015667 | 298 |
| 363 | 3300013297 | Ga0157378_10052922 | Ga0157378_100529224 | 298 |
| 364 | 3300013297 | Ga0157378_10172215 | Ga0157378_101722152 | 298 |
| 365 | 3300013307 | Ga0157372_10001358 | Ga0157372_1000135814 | 298 |
| 366 | 3300014497 | Ga0182008_10114656 | Ga0182008_101146562 | 298 |
| 367 | 3300025885 | Ga0207653_10003710 | Ga0207653_100037103 | 298 |
| 368 | 3300025901 | Ga0207688_10106494 | Ga0207688_101064942 | 298 |
| 369 | 3300025905 | Ga0207685_10052401 | Ga0207685_100524012 | 298 |
| 370 | 3300025907 | Ga0207645_10002372 | Ga0207645_1000237216 | 298 |
| 371 | 3300025908 | Ga0207643_10003015 | Ga0207643_100030158 | 298 |
| 372 | 3300025910 | Ga0207684_10006212 | Ga0207684_100062122 | 298 |
| 373 | 3300025910 | Ga0207684_10151796 | Ga0207684_101517962 | 298 |
| 374 | 3300025911 | Ga0207654_10010035 | Ga0207654_100100356 | 298 |
| 375 | 3300025912 | Ga0207707_10000091 | Ga0207707_1000009115 | 298 |
| 376 | 3300025917 | Ga0207660_10028751 | Ga0207660_100287511 | 298 |
| 377 | 3300025918 | Ga0207662_10094096 | Ga0207662_100940961 | 298 |
| 378 | 3300025919 | Ga0207657_10000925 | Ga0207657_1000092535 | 298 |
| 379 | 3300025921 | Ga0207652_10003874 | Ga0207652_1000387412 | 298 |
| 380 | 3300025922 | Ga0207646_10033764 | Ga0207646_100337644 | 298 |
| 381 | 3300025922 | Ga0207646_10203454 | Ga0207646_102034542 | 298 |
| 382 | 3300025923 | Ga0207681_10020440 | Ga0207681_100204404 | 298 |
| 383 | 3300025923 | Ga0207681_10046982 | Ga0207681_100469822 | 298 |
| 384 | 3300025923 | Ga0207681_10057625 | Ga0207681_100576253 | 298 |
| 385 | 3300025932 | Ga0207690_10010689 | Ga0207690_100106895 | 298 |
| 386 | 3300025933 | Ga0207706_10002645 | Ga0207706_100026451 | 298 |
| 387 | 3300025933 | Ga0207706_10184216 | Ga0207706_101842162 | 298 |
| 388 | 3300025935 | Ga0207709_10426221 | Ga0207709_104262211 | 298 |
| 389 | 3300025939 | Ga0207665_10010700 | Ga0207665_100107003 | 298 |
| 390 | 3300025942 | Ga0207689_10003443 | Ga0207689_100034432 | 298 |
| 391 | 3300025945 | Ga0207679_10051716 | Ga0207679_100517163 | 298 |
| 392 | 3300025949 | Ga0207667_10004905 | Ga0207667_1000490517 | 298 |
| 393 | 3300025960 | Ga0207651_10035392 | Ga0207651_100353923 | 298 |
| 394 | 3300025972 | Ga0207668_10166288 | Ga0207668_101662881 | 298 |
| 395 | 3300025981 | Ga0207640_10022120 | Ga0207640_100221204 | 298 |
| 396 | 3300025986 | Ga0207658_10198257 | Ga0207658_101982572 | 298 |
| 397 | 3300026023 | Ga0207677_10108607 | Ga0207677_101086071 | 298 |
| 398 | 3300026035 | Ga0207703_10162945 | Ga0207703_101629452 | 298 |
| 399 | 3300026067 | Ga0207678_10020979 | Ga0207678_100209796 | 298 |
| 400 | 3300026078 | Ga0207702_10010495 | Ga0207702_100104955 | 298 |
| 401 | 3300026088 | Ga0207641_10386263 | Ga0207641_103862632 | 298 |
| 402 | 3300026089 | Ga0207648_10012559 | Ga0207648_100125594 | 298 |
| 403 | 3300026095 | Ga0207676_10124520 | Ga0207676_101245202 | 298 |
| 404 | 3300026116 | Ga0207674_10001080 | Ga0207674_1000108019 | 298 |
| 405 | 3300026118 | Ga0207675_100013405 | Ga0207675_1000134054 | 298 |
| 406 | 3300027526 | Ga0209968_1000255 | Ga0209968_10002552 | 298 |
| 407 | 3300027671 | Ga0209588_1005137 | Ga0209588_10051375 | 298 |
| 408 | 3300027682 | Ga0209971_1000003 | Ga0209971_100000381 | 298 |
| 409 | 3300027695 | Ga0209966_1000149 | Ga0209966_100014927 | 298 |
| 410 | 3300027717 | Ga0209998_10000004 | Ga0209998_1000000475 | 298 |
| 411 | 3300027907 | Ga0207428_10000306 | Ga0207428_1000030636 | 298 |
| 412 | 3300028380 | Ga0268265_10002124 | Ga0268265_100021243 | 298 |
| 413 | 3300031548 | Ga0307408_100041305 | Ga0307408_1000413052 | 298 |
| 414 | 3300034820 | Ga0373959_0000923 | Ga0373959_0000923_1538_2476 | 298 |
| 415 | 3300035084 | Ga0373928_0028550 | Ga0373928_0028550_158_1096 | 298 |
| 416 | 3300035121 | Ga0373960_0005416 | Ga0373960_0005416_405_1343 | 298 |
| 417 | 3300035241 | Ga0373961_0026954 | Ga0373961_0026954_382_1320 | 298 |
| 418 | 3300035691 | Ga0373931_0003204 | Ga0373931_0003204_492_1430 | 298 |
| 419 | 3300037312 | Ga0395899_0019185 | Ga0395899_0019185_870_1808 | 298 |
| 420 | 3300037466 | Ga0395898_0001915 | Ga0395898_0001915_6561_7499 | 298 |
| 421 | 3300038443 | Ga0395901_0000430 | Ga0395901_0000430_20145_21083 | 298 |
| 422 | 3300042005 | Ga0439448_0002836 | Ga0439448_0002836_968_1906 | 298 |
| 423 | 3300042157 | Ga0439458_0012185 | Ga0439458_0012185_361_1299 | 298 |
| 424 | 3300042436 | Ga0439435_0004869 | Ga0439435_0004869_355_1293 | 298 |
| 425 | 3300042439 | Ga0439464_0009705 | Ga0439464_0009705_105_1043 | 298 |
| 426 | 3300042461 | Ga0439460_0003260 | Ga0439460_0003260_2606_3544 | 298 |
| 427 | 3300042876 | Ga0451577_0016767 | Ga0451577_0016767_4736_5674 | 298 |
| 428 | 3300045051 | Ga0451576_0006808 | Ga0451576_0006808_11067_12005 | 298 |
| 429 | 3300045051 | Ga0451576_0050655 | Ga0451576_0050655_1850_2788 | 298 |
| 430 | 3300045051 | Ga0451576_0080942 | Ga0451576_0080942_1801_2739 | 298 |
| 431 | 3300046472 | Ga0495580_0010134 | Ga0495580_0010134_3593_4534 | 298 |
| 432 | 3300046691 | Ga0495670_0167605 | Ga0495670_0167605_88_1029 | 298 |
| 433 | 3300048905 | Ga0496102_0131947 | Ga0496102_0131947_257_1195 | 298 |
| 434 | 3300048910 | Ga0496107_0114516 | Ga0496107_0114516_55_993 | 298 |
| 435 | 3300049573 | Ga0501037_0060145 | Ga0501037_0060145_1488_2426 | 298 |
| 436 | 3300049574 | Ga0501038_0033796 | Ga0501038_0033796_1695_2633 | 298 |
| 437 | 3300049575 | Ga0501039_0245938 | Ga0501039_0245938_157_1095 | 298 |
| 438 | 3300049575 | Ga0501039_0381993 | Ga0501039_0381993_121_1056 | 298 |
| 439 | 3300049576 | Ga0501040_0011006 | Ga0501040_0011006_4207_5145 | 298 |
| 440 | 3300049576 | Ga0501040_0033069 | Ga0501040_0033069_1255_2193 | 298 |
| 441 | 3300049576 | Ga0501040_0093706 | Ga0501040_0093706_618_1556 | 298 |
| 442 | 3300049577 | Ga0501041_0005353 | Ga0501041_0005353_1846_2784 | 298 |
| 443 | 3300049577 | Ga0501041_0060877 | Ga0501041_0060877_368_1306 | 298 |
| 444 | 3300049577 | Ga0501041_0201305 | Ga0501041_0201305_174_1109 | 298 |
| 445 | 3300049578 | Ga0501042_0008138 | Ga0501042_0008138_4197_5135 | 298 |
| 446 | 3300049578 | Ga0501042_0041890 | Ga0501042_0041890_2007_2942 | 298 |
| 447 | 3300049578 | Ga0501042_0118392 | Ga0501042_0118392_283_1221 | 298 |
| 448 | 3300049578 | Ga0501042_0139917 | Ga0501042_0139917_47_985 | 298 |
| 449 | 3300049580 | Ga0501046_0000303 | Ga0501046_0000303_16692_17630 | 298 |
| 450 | 3300049580 | Ga0501046_0016616 | Ga0501046_0016616_1686_2621 | 298 |
| 451 | 3300049580 | Ga0501046_0120963 | Ga0501046_0120963_339_1277 | 298 |
| 452 | 3300049581 | Ga0501047_0114303 | Ga0501047_0114303_201_1139 | 298 |
| 453 | 3300049582 | Ga0501048_0013358 | Ga0501048_0013358_2061_2999 | 298 |
| 454 | 3300049588 | Ga0501072_0059825 | Ga0501072_0059825_1560_2498 | 298 |
| 455 | 3300049588 | Ga0501072_0112675 | Ga0501072_0112675_622_1557 | 298 |
| 456 | 3300049589 | Ga0501073_0256792 | Ga0501073_0256792_197_1135 | 298 |
| 457 | 3300049590 | Ga0501074_0007053 | Ga0501074_0007053_5379_6317 | 298 |
| 458 | 3300049591 | Ga0501075_0010023 | Ga0501075_0010023_1915_2853 | 298 |
| 459 | 3300049591 | Ga0501075_0017718 | Ga0501075_0017718_414_1352 | 298 |
| 460 | 3300049591 | Ga0501075_0142127 | Ga0501075_0142127_660_1598 | 298 |
| 461 | 3300049592 | Ga0501076_0030464 | Ga0501076_0030464_1907_2845 | 298 |
| 462 | 3300049592 | Ga0501076_0049908 | Ga0501076_0049908_222_1157 | 298 |
| 463 | 3300049592 | Ga0501076_0103186 | Ga0501076_0103186_973_1911 | 298 |
| 464 | 3300049592 | Ga0501076_0440830 | Ga0501076_0440830_94_1032 | 298 |
| 465 | 3300049593 | Ga0501077_0027974 | Ga0501077_0027974_1315_2253 | 298 |
| 466 | 3300049593 | Ga0501077_0033808 | Ga0501077_0033808_1248_2186 | 298 |
| 467 | 3300049593 | Ga0501077_0057419 | Ga0501077_0057419_1397_2332 | 298 |
| 468 | 3300049593 | Ga0501077_0099173 | Ga0501077_0099173_170_1108 | 298 |
| 469 | 3300049741 | Ga0501079_0000600 | Ga0501079_0000600_18168_19106 | 298 |
| 470 | 3300049741 | Ga0501079_0001407 | Ga0501079_0001407_496_1434 | 298 |
| 471 | 3300049742 | Ga0501080_0037951 | Ga0501080_0037951_1496_2434 | 298 |
| 472 | 3300049742 | Ga0501080_0138936 | Ga0501080_0138936_1067_2002 | 298 |
| 473 | 3300049743 | Ga0501081_0002259 | Ga0501081_0002259_6174_7112 | 298 |
| 474 | 3300049743 | Ga0501081_0064098 | Ga0501081_0064098_1028_1966 | 298 |
| 475 | 3300049744 | Ga0501083_0007814 | Ga0501083_0007814_4741_5679 | 298 |
| 476 | 3300049744 | Ga0501083_0063970 | Ga0501083_0063970_716_1654 | 298 |
| 477 | 3300049824 | Ga0501045_0081462 | Ga0501045_0081462_316_1254 | 298 |
| 478 | 3300050507 | nmdc:mga05p37_143923_c1 | nmdc:mga05p37_143923_c1_301_1257 | 298 |
| 479 | 3300050507 | nmdc:mga05p37_24360_c1 | nmdc:mga05p37_24360_c1_5253_6191 | 298 |
| 480 | 3300050507 | nmdc:mga05p37_446207_c1 | nmdc:mga05p37_446207_c1_315_1253 | 298 |
| 481 | 3300050507 | nmdc:mga05p37_63216_c1 | nmdc:mga05p37_63216_c1_2336_3274 | 298 |
| 482 | 3300050508 | nmdc:mga09592_20256_c1 | nmdc:mga09592_20256_c1_578_1534 | 298 |
| 483 | 3300050508 | nmdc:mga09592_282516_c1 | nmdc:mga09592_282516_c1_454_1392 | 298 |
| 484 | 3300050508 | nmdc:mga09592_312823_c1 | nmdc:mga09592_312823_c1_345_1283 | 298 |
| 485 | 3300050509 | nmdc:mga0qj67_1405_c1 | nmdc:mga0qj67_1405_c1_4805_5743 | 298 |
| 486 | 3300050510 | nmdc:mga06r32_205_c1 | nmdc:mga06r32_205_c1_37666_38610 | 298 |
| 487 | 3300050510 | nmdc:mga06r32_67230_c1 | nmdc:mga06r32_67230_c1_1205_2143 | 298 |
| 488 | 3300050510 | nmdc:mga06r32_90681_c1 | nmdc:mga06r32_90681_c1_1098_2045 | 298 |
| 489 | 3300050511 | nmdc:mga08y16_14092_c1 | nmdc:mga08y16_14092_c1_6721_7659 | 298 |
| 490 | 3300050511 | nmdc:mga08y16_305319_c1 | nmdc:mga08y16_305319_c1_438_1394 | 298 |
| 491 | 3300050512 | nmdc:mga0n895_376073_c1 | nmdc:mga0n895_376073_c1_298_1242 | 298 |
| 492 | 3300050512 | nmdc:mga0n895_41613_c1 | nmdc:mga0n895_41613_c1_2390_3334 | 298 |
| 493 | 3300050512 | nmdc:mga0n895_59945_c1 | nmdc:mga0n895_59945_c1_1896_2834 | 298 |
| 494 | 3300050513 | nmdc:mga0rr50_11178_c1 | nmdc:mga0rr50_11178_c1_3715_4653 | 298 |
| 495 | 3300050513 | nmdc:mga0rr50_28522_c1 | nmdc:mga0rr50_28522_c1_2786_3742 | 298 |
| 496 | 3300050514 | nmdc:mga08x19_20879_c1 | nmdc:mga08x19_20879_c1_1754_2719 | 298 |
| 497 | 3300050515 | nmdc:mga0a205_140552_c1 | nmdc:mga0a205_140552_c1_157_1113 | 298 |
| 498 | 3300050515 | nmdc:mga0a205_48508_c1 | nmdc:mga0a205_48508_c1_2584_3522 | 298 |
| 499 | 3300054114 | Ga0501084_0002736 | Ga0501084_0002736_6469_7407 | 298 |
| 500 | 3300054114 | Ga0501084_0007675 | Ga0501084_0007675_6541_7479 | 298 |
| 501 | 3300054114 | Ga0501084_0106464 | Ga0501084_0106464_351_1289 | 298 |
| 502 | 3300054114 | Ga0501084_0222984 | Ga0501084_0222984_520_1458 | 298 |
| 503 | 3300054114 | Ga0501084_0287252 | Ga0501084_0287252_184_1122 | 298 |
| 504 | 3300060353 | Ga0501082_0000212 | Ga0501082_0000212_28821_29759 | 298 |
| 505 | 3300060353 | Ga0501082_0066220 | Ga0501082_0066220_511_1449 | 298 |
| 506 | 3300060353 | Ga0501082_0083794 | Ga0501082_0083794_66_1004 | 298 |
| 507 | 3300061734 | Ga0530510_0255797 | Ga0530510_0255797_255_1193 | 298 |
| 508 | 3300061734 | Ga0530510_0291587 | Ga0530510_0291587_98_1033 | 298 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bke-assembly1.cif.gz_D | crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine | 0.9586 | 4 | 282 |
| 5bke-assembly1.cif.gz_A | crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine | 0.9577 | 1 | 282 |
| 5bke-assembly1.cif.gz_B | crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine | 0.9554 | 3 | 282 |
| 5bke-assembly1.cif.gz_C | crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine | 0.9522 | 1 | 282 |
| 5bke-assembly1.cif.gz_E | crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine | 0.9499 | 1 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5j92B00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.9462 | 2 | 279 | 3.60.130.10 |
| 5j92B00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.911 | 2 | 279 | 3.60.130.10 |
| 5hsxA00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.9027 | 2 | 282 | 3.60.130.10 |
| 4y0eD00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.8956 | 2 | 280 | 3.60.130.10 |
| 1vz4D00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like | 0.895 | 1 | 282 | 3.60.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6QVB6-F1-model_v4 | TauD/TfdA-like domain-containing protein | 0.9798 | 1 | 282 |
GO:0046872
GO:0051213 |
| AF-A0A3D2VEE5-F1-model_v4 | TauD/TfdA-like domain-containing protein | 0.9773 | 87 | 282 |
GO:0051213
|
| AF-A0A2V7E5C3-F1-model_v4 | TauD/TfdA-like domain-containing protein | 0.9769 | 150 | 283 |
GO:0046872
GO:0051213 |
| AF-A0A350RFH9-F1-model_v4 | TauD/TfdA-like domain-containing protein | 0.9758 | 117 | 283 |
GO:0046872
GO:0051213 |
| AF-A0A6A7KLN7-F1-model_v4 | TauD/TfdA family dioxygenase | 0.9738 | 1 | 283 |
GO:0046872
GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar