F456798

General Info

Members Datasets Scaffolds Average Seq Length
508 249 1016 226

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10273018|Ga0105240_102730183
Length 256
Sequence MHGCAAIRSTKTCAQADPLAIIAAIATKELAMNSTAPGKPRPRTYRRFHYLRARPRLMVSMAIFVAALVALLAYGVRHSMALLLAFDFAALVYLVLLAVLFGRASPELMRCQARAQDTGRWGFLWSGIVLTAVVMVALGAELHGGAEGGMSSIALAGGSIVLSWLFMNTMFAMHYAHGYYGDFGKKHEGLEFPDTPEPDYWDFAYFAIVIGMTFQVSDVQITSRYLRRVALLHSVIAFFFNVFIIALSVNVVAGKA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
71 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
140 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
141 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
219 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
220 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
225 2643221569 Achromobacter sp. Root565 Isolate Unclassified
226 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
227 2643221594 Achromobacter sp. Root170 Isolate Unclassified
228 2643221621 Achromobacter sp. Root83 Isolate Unclassified
229 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
230 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
231 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
232 2734482264 Dyella sp. AD052 Isolate Unclassified
233 2738543009 Luteibacter sp. OK325 Isolate Unclassified
234 2739367700 Dyella sp. YR388 Isolate Unclassified
235 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
236 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
237 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
238 2855730933 Achromobacter sp. HZ28 Isolate Nodule
239 2855767633 Achromobacter sp. HZ34 Isolate Nodule
240 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
241 2858950400 Achromobacter sp. K91 Isolate Unclassified
242 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
243 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
244 2884411467 Dyella sp. AD56 Isolate Rhizosphere
245 2919085039 Luteibacter sp. 1214 Isolate Unclassified
246 2928963466 Dyella japonica 1073 Isolate Unclassified
247 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
248 2941471342 Luteibacter sp. 621 Isolate Unclassified
249 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 94.69
Metatranscriptomes 0.2
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.31
Nodule 0.39
Rhizoplane 3.54
Rhizosphere 58.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10273018 3300009093 Bacteria 1945
2 JGI24740J21852_10035342 3300001979 Bacteria 1563
3 JGI24740J21852_10094845 3300001979 Bacteria 765
4 JGI24739J22299_10000112 3300001989 Bacteria 25198
5 JGI24739J22299_10105126 3300001989 Bacteria 850
6 JGI24737J22298_10004508 3300001990 Bacteria 4848
7 JGI24735J21928_10008301 3300002067 Bacteria 3363
8 JGI24735J21928_10045745 3300002067 Bacteria 1270
9 JGI25162J39368_1000138 3300002737 Bacteria 78713
10 JGI25162J39368_1001136 3300002737 Bacteria 16004
11 JGI25154J39366_1008072 3300002738 Bacteria 1388
12 JGI25157J39369_1000253 3300002741 Bacteria 39977
13 JGI25157J39369_1000586 3300002741 Bacteria 21510
14 JGI25157J39369_1001059 3300002741 Bacteria 12472
15 JGI25163J39215_1001513 3300002771 Bacteria 3662
16 JGI25164J39214_1000170 3300002772 Bacteria 60952
17 JGI25164J39214_1000310 3300002772 Bacteria 32075
18 JGI25164J39214_1001042 3300002772 Bacteria 8336
19 JGI25151J46595_10000185 3300003187 Bacteria 77945
20 JGI25165J46597_1000224 3300003214 Bacteria 78713
21 JGI25165J46597_1000580 3300003214 Bacteria 32075
22 JGI25165J46597_1000810 3300003214 Bacteria 23603
23 JGI25153J46596_10021949 3300003215 Bacteria 2368
24 rootH1_10015929 3300003316 Bacteria 1915
25 rootH2_10180704 3300003320 Bacteria 1725
26 rootH2_10227546 3300003320 Bacteria 1273
27 Ga0055538_1002409 3300003751 Bacteria 2775
28 Ga0055533_1000743 3300003756 Bacteria 10479
29 Ga0055525_1000192 3300003759 Bacteria 72944
30 Ga0055527_1000041 3300003760 Bacteria 116981
31 Ga0055527_1000234 3300003760 Bacteria 34826
32 Ga0055527_1002108 3300003760 Bacteria 3552
33 Ga0055535_1000193 3300003761 Bacteria 64634
34 Ga0055535_1000216 3300003761 Bacteria 60912
35 Ga0055535_1000457 3300003761 Bacteria 37713
36 Ga0055535_1000502 3300003761 Bacteria 34740
37 Ga0055535_1001000 3300003761 Bacteria 18231
38 Ga0055542_1000136 3300003762 Bacteria 93218
39 Ga0055542_1000152 3300003762 Bacteria 87561
40 Ga0055542_1000179 3300003762 Bacteria 78713
41 Ga0055542_1000183 3300003762 Bacteria 77794
42 Ga0055542_1000496 3300003762 Bacteria 36150
43 Ga0055542_1000520 3300003762 Bacteria 34740
44 Ga0055529_1000116 3300003763 Bacteria 117929
45 Ga0055529_1000189 3300003763 Bacteria 84123
46 Ga0055529_1000254 3300003763 Bacteria 64036
47 Ga0055529_1001711 3300003763 Bacteria 5617
48 Ga0065165_1000790 3300005262 Bacteria 42379
49 Ga0070682_100000901 3300005337 Bacteria 17351
50 Ga0070682_100005988 3300005337 Bacteria 6807
51 Ga0070689_100001668 3300005340 Bacteria 14172
52 Ga0070661_100017191 3300005344 Bacteria 5127
53 Ga0070661_100066660 3300005344 Bacteria 2645
54 Ga0070661_100375317 3300005344 Bacteria 1120
55 Ga0070661_100449599 3300005344 Bacteria 1025
56 Ga0070692_10217704 3300005345 Bacteria 1127
57 Ga0070659_100005586 3300005366 Bacteria 9035
58 Ga0070659_100010887 3300005366 Bacteria 6708
59 Ga0070667_100122329 3300005367 Bacteria 2265
60 Ga0070667_100611535 3300005367 Bacteria 1005
61 Ga0070709_10501673 3300005434 Bacteria 922
62 Ga0070714_100000030 3300005435 Bacteria 136610
63 Ga0070714_100016293 3300005435 Bacteria 5996
64 Ga0070714_100039789 3300005435 Bacteria 3960
65 Ga0070713_100033124 3300005436 Bacteria 4136
66 Ga0070663_100040164 3300005455 Bacteria 3274
67 Ga0070663_100230003 3300005455 Bacteria 1460
68 Ga0070663_100481802 3300005455 Bacteria 1027
69 Ga0070662_100285297 3300005457 Bacteria 1337
70 Ga0070681_10074659 3300005458 Bacteria 3352
71 Ga0070681_10247033 3300005458 Bacteria 1697
72 Ga0070685_10009901 3300005466 Bacteria 4943
73 Ga0070679_100048156 3300005530 Bacteria 4248
74 Ga0070679_100136952 3300005530 Bacteria 2430
75 Ga0068853_100000701 3300005539 Bacteria 23195
76 Ga0068853_100006672 3300005539 Bacteria 9192
77 Ga0068853_100094025 3300005539 Bacteria 2640
78 Ga0070696_100010393 3300005546 Bacteria 6236
79 Ga0070696_100051715 3300005546 Bacteria 2857
80 Ga0070693_100049659 3300005547 Bacteria 2394
81 Ga0070693_100102519 3300005547 Bacteria 1746
82 Ga0070665_100328982 3300005548 Bacteria 1532
83 Ga0068855_100009108 3300005563 Bacteria 11992
84 Ga0068855_100009396 3300005563 Bacteria 11809
85 Ga0068855_100023171 3300005563 Bacteria 7439
86 Ga0068855_100034435 3300005563 Bacteria 6040
87 Ga0068857_100000319 3300005577 Bacteria 33193
88 Ga0068854_100001263 3300005578 Bacteria 15187
89 Ga0068854_100004257 3300005578 Bacteria 9012
90 Ga0068856_100000652 3300005614 Bacteria 37607
91 Ga0068856_100009147 3300005614 Bacteria 9630
92 Ga0068856_100130422 3300005614 Bacteria 2518
93 Ga0068852_100511383 3300005616 Bacteria 1197
94 Ga0068863_100692604 3300005841 Bacteria 1012
95 Ga0068858_100320517 3300005842 Bacteria 1481
96 Ga0068860_100825802 3300005843 Bacteria 941
97 Ga0070712_100037322 3300006175 Bacteria 3311
98 Ga0075369_10069314 3300006186 Bacteria 1551
99 Ga0105240_10000254 3300009093 Bacteria 106067
100 Ga0105240_10013032 3300009093 Bacteria 11446
101 Ga0105240_10020159 3300009093 Bacteria 8900
102 Ga0105247_10018594 3300009101 Bacteria 4170
103 Ga0105241_10284352 3300009174 Bacteria 1414
104 Ga0105241_10841045 3300009174 Bacteria 848
105 Ga0105237_10000007 3300009545 Bacteria 367690
106 Ga0105237_10000307 3300009545 Bacteria 68076
107 Ga0105237_10863841 3300009545 Bacteria 911
108 Ga0105238_10025452 3300009551 Bacteria 6033
109 Ga0105238_10339220 3300009551 Bacteria 1491
110 Ga0105249_10006411 3300009553 Bacteria 10234
111 Ga0105239_10000020 3300010375 Bacteria 264435
112 Ga0105239_10006790 3300010375 Bacteria 13210
113 Ga0105239_10011929 3300010375 Bacteria 9691
114 Ga0105239_10764193 3300010375 Bacteria 1106
115 Ga0105239_10877742 3300010375 Bacteria 1029
116 Ga0157314_1000121 3300012500 Bacteria 8518
117 Ga0157373_10006314 3300013100 Bacteria 8853
118 Ga0157373_10173189 3300013100 Bacteria 1519
119 Ga0157371_10009310 3300013102 Bacteria 7743
120 Ga0157371_10035315 3300013102 Bacteria 3582
121 Ga0157371_10401658 3300013102 Bacteria 1003
122 Ga0157370_10002130 3300013104 Bacteria 24167
123 Ga0157370_10020669 3300013104 Bacteria 6570
124 Ga0157370_10099536 3300013104 Bacteria 2725
125 Ga0157370_10107943 3300013104 Bacteria 2603
126 Ga0157370_10530824 3300013104 Bacteria 1079
127 Ga0157369_10002156 3300013105 Bacteria 23727
128 Ga0157369_10045520 3300013105 Bacteria 4771
129 Ga0157369_10301161 3300013105 Bacteria 1668
130 Ga0163162_10044415 3300013306 Bacteria 4451
131 Ga0157372_10006658 3300013307 Bacteria 12295
132 Ga0157372_10033436 3300013307 Bacteria 5648
133 Ga0157372_10093224 3300013307 Bacteria 3427
134 Ga0157375_10279119 3300013308 Bacteria 1834
135 Ga0182008_10017242 3300014497 Bacteria 3748
136 Ga0182006_1000027 3300015261 Bacteria 252946
137 Ga0182006_1014707 3300015261 Bacteria 3369
138 Ga0182007_10006605 3300015262 Bacteria 4967
139 Ga0182007_10016559 3300015262 Bacteria 2717
140 Ga0182007_10019323 3300015262 Bacteria 2451
141 Ga0182005_1000055 3300015265 Bacteria 111824
142 Ga0182005_1012001 3300015265 Bacteria 2456
143 Ga0183369_1006 3300015685 Bacteria 449058
144 Ga0183368_1003 3300015687 Bacteria 1276390
145 Ga0163161_10003028 3300017792 Bacteria 11868
146 Ga0163161_10022440 3300017792 Bacteria 4446
147 Ga0206353_11728937 3300020082 Bacteria 4105
148 Ga0209760_101075 3300025207 Bacteria 3157
149 Ga0209784_100068 3300025224 Bacteria 152526
150 Ga0209674_100012 3300025226 Bacteria 950162
151 Ga0209674_100148 3300025226 Bacteria 98100
152 Ga0209674_100336 3300025226 Bacteria 28357
153 Ga0209672_100005 3300025228 Bacteria 1069303
154 Ga0209672_100045 3300025228 Bacteria 264926
155 Ga0209672_100100 3300025228 Bacteria 108785
156 Ga0209672_100350 3300025228 Bacteria 29469
157 Ga0209672_100676 3300025228 Bacteria 17169
158 Ga0209563_100023 3300025230 Bacteria 636844
159 Ga0207427_100120 3300025231 Bacteria 101516
160 Ga0207427_100139 3300025231 Bacteria 84807
161 Ga0207427_100140 3300025231 Bacteria 84637
162 Ga0207427_103928 3300025231 Bacteria 2767
163 Ga0209437_100020 3300025233 Bacteria 656374
164 Ga0209437_100147 3300025233 Bacteria 161997
165 Ga0209437_100231 3300025233 Bacteria 94387
166 Ga0209437_100462 3300025233 Bacteria 32102
167 Ga0209437_100463 3300025233 Bacteria 32076
168 Ga0209437_103189 3300025233 Bacteria 3006
169 Ga0209258_100006 3300025242 Bacteria 1069303
170 Ga0209258_100024 3300025242 Bacteria 542096
171 Ga0209258_100111 3300025242 Bacteria 197019
172 Ga0209258_100200 3300025242 Bacteria 123379
173 Ga0209258_100360 3300025242 Bacteria 61533
174 Ga0209258_100992 3300025242 Bacteria 13094
175 Ga0209258_101855 3300025242 Bacteria 6388
176 Ga0209646_1000448 3300025246 Bacteria 21870
177 Ga0209646_1000896 3300025246 Bacteria 9713
178 Ga0209026_1000037 3300025250 Bacteria 282562
179 Ga0209026_1000074 3300025250 Bacteria 203820
180 Ga0209026_1000099 3300025250 Bacteria 161750
181 Ga0209026_1000737 3300025250 Bacteria 18882
182 Ga0209026_1003781 3300025250 Bacteria 4799
183 Ga0209677_103326 3300025253 Bacteria 5296
184 Ga0209148_1000002 3300025254 Bacteria 2399500
185 Ga0209148_1000009 3300025254 Bacteria 1395625
186 Ga0209148_1000010 3300025254 Bacteria 1265567
187 Ga0209148_1000012 3300025254 Bacteria 1069303
188 Ga0209148_1000045 3300025254 Bacteria 448076
189 Ga0209148_1000099 3300025254 Bacteria 227713
190 Ga0209759_1000110 3300025256 Bacteria 144917
191 Ga0209759_1000247 3300025256 Bacteria 80850
192 Ga0209759_1000605 3300025256 Bacteria 34670
193 Ga0209129_1003076 3300025258 Bacteria 7530
194 Ga0209233_1000009 3300025261 Bacteria 1265567
195 Ga0209233_1000020 3300025261 Bacteria 798224
196 Ga0209233_1000147 3300025261 Bacteria 186517
197 Ga0209233_1000251 3300025261 Bacteria 84807
198 Ga0209233_1048694 3300025261 Bacteria 873
199 Ga0209455_1000008 3300025272 Bacteria 1069303
200 Ga0209455_1000029 3300025272 Bacteria 542096
201 Ga0209455_1000035 3300025272 Bacteria 479071
202 Ga0209455_1000086 3300025272 Bacteria 244650
203 Ga0209455_1000357 3300025272 Bacteria 42718
204 Ga0209455_1010368 3300025272 Bacteria 2373
205 Ga0209676_1002272 3300025292 Bacteria 14115
206 Ga0209025_1000064 3300025294 Bacteria 301309
207 Ga0209758_1000276 3300025297 Bacteria 102362
208 Ga0209758_1019556 3300025297 Bacteria 3260
209 Ga0209050_1004144 3300025298 Bacteria 10048
210 Ga0209051_1003630 3300025303 Bacteria 10005
211 Ga0207710_10024020 3300025900 Bacteria 2623
212 Ga0207647_10003260 3300025904 Bacteria 12187
213 Ga0207647_10005829 3300025904 Bacteria 8981
214 Ga0207647_10012861 3300025904 Bacteria 5814
215 Ga0207647_10017287 3300025904 Bacteria 4903
216 Ga0207699_10417378 3300025906 Bacteria 958
217 Ga0207654_10535426 3300025911 Bacteria 830
218 Ga0207707_10089106 3300025912 Bacteria 2696
219 Ga0207695_10000408 3300025913 Bacteria 95748
220 Ga0207695_10001214 3300025913 Bacteria 44135
221 Ga0207695_10002857 3300025913 Bacteria 25113
222 Ga0207695_10003147 3300025913 Bacteria 23559
223 Ga0207695_10008177 3300025913 Bacteria 13142
224 Ga0207695_10073644 3300025913 Bacteria 3479
225 Ga0207671_10000031 3300025914 Bacteria 247030
226 Ga0207671_10000074 3300025914 Bacteria 156482
227 Ga0207693_10057743 3300025915 Bacteria 3041
228 Ga0207649_10074569 3300025920 Bacteria 2177
229 Ga0207649_10339646 3300025920 Bacteria 1108
230 Ga0207694_10091905 3300025924 Bacteria 2395
231 Ga0207694_10318907 3300025924 Bacteria 1282
232 Ga0207700_10015921 3300025928 Bacteria 4979
233 Ga0207664_10000026 3300025929 Bacteria 194571
234 Ga0207664_10000857 3300025929 Bacteria 20580
235 Ga0207664_10003572 3300025929 Bacteria 10391
236 Ga0207690_10002130 3300025932 Bacteria 12122
237 Ga0207690_10008096 3300025932 Bacteria 6239
238 Ga0207690_10029336 3300025932 Bacteria 3496
239 Ga0207690_10049497 3300025932 Bacteria 2802
240 Ga0207706_10286677 3300025933 Bacteria 1436
241 Ga0207670_10001036 3300025936 Bacteria 14669
242 Ga0207667_10000082 3300025949 Bacteria 157749
243 Ga0207667_10000313 3300025949 Bacteria 67227
244 Ga0207667_10008318 3300025949 Bacteria 12343
245 Ga0207667_10153769 3300025949 Bacteria 2367
246 Ga0207667_10215557 3300025949 Bacteria 1967
247 Ga0207667_10633242 3300025949 Bacteria 1076
248 Ga0207640_10000018 3300025981 Bacteria 193664
249 Ga0207640_10000667 3300025981 Bacteria 20069
250 Ga0207640_10438516 3300025981 Bacteria 1073
251 Ga0207658_10359795 3300025986 Bacteria 1269
252 Ga0207703_10082493 3300026035 Bacteria 2683
253 Ga0207639_10000523 3300026041 Bacteria 26518
254 Ga0207639_10014615 3300026041 Bacteria 5527
255 Ga0207639_10618123 3300026041 Bacteria 1000
256 Ga0207678_10009903 3300026067 Bacteria 8367
257 Ga0207678_10038396 3300026067 Bacteria 4160
258 Ga0207678_10062700 3300026067 Bacteria 3195
259 Ga0207678_10435920 3300026067 Bacteria 1138
260 Ga0207702_10001333 3300026078 Bacteria 24688
261 Ga0207702_10005090 3300026078 Bacteria 11553
262 Ga0207702_10572497 3300026078 Bacteria 1106
263 Ga0207641_10087495 3300026088 Bacteria 2718
264 Ga0207641_10545001 3300026088 Bacteria 1131
265 Ga0207674_10000397 3300026116 Bacteria 56299
266 Ga0207674_10009479 3300026116 Bacteria 11118
267 Ga0207674_10188153 3300026116 Bacteria 2014
268 Ga0207698_10246421 3300026142 Bacteria 1632
269 Ga0209371_1014494 3300027312 Bacteria 2159
270 Ga0268266_10258370 3300028379 Bacteria 1613
271 Ga0268264_10150106 3300028381 Bacteria 2088
272 Ga0268264_10751391 3300028381 Bacteria 972
273 Ga0268256_1016060 3300030500 Bacteria 2159
274 Ga0395899_0006931 3300037312 Bacteria 8778
275 Ga0395899_0025641 3300037312 Bacteria 4450
276 Ga0395899_0316578 3300037312 Bacteria 1052
277 Ga0395900_0242103 3300037418 Bacteria 1809
278 Ga0395898_0000305 3300037466 Bacteria 116565
279 Ga0395898_0000526 3300037466 Bacteria 73315
280 Ga0395901_0000356 3300038443 Bacteria 55523
281 Ga0395901_0025511 3300038443 Bacteria 6068
282 Ga0395901_0045690 3300038443 Bacteria 4546
283 Ga0395901_0047914 3300038443 Bacteria 4437
284 Ga0395901_0058975 3300038443 Bacteria 3993
285 Ga0395901_0084915 3300038443 Bacteria 3309
286 Ga0395901_0531328 3300038443 Bacteria 1194
287 Ga0451789_1328922 3300041443 Bacteria 904
288 Ga0451793_0874712 3300041452 Bacteria 1940
289 Ga0451802_0469131 3300041460 Bacteria 6516
290 Ga0451804_0453964 3300041463 Bacteria 1595
291 Ga0451807_1838081 3300041486 Bacteria 2161
292 Ga0451835_0794154 3300041492 Bacteria 1157
293 Ga0451839_1084144 3300041496 Bacteria 1039
294 Ga0451847_0914510 3300041503 Bacteria 1396
295 Ga0451853_2209289 3300041512 Bacteria 2292
296 Ga0439459_0000693 3300042438 Bacteria 4598
297 Ga0466969_0008755 3300044656 Bacteria 5363
298 Ga0466975_0190098 3300044661 Bacteria 1400
299 Ga0466989_0125302 3300044663 Bacteria 1566
300 Ga0466982_0000004 3300044672 Bacteria 386724
301 Ga0466966_0003802 3300044684 Bacteria 9957
302 Ga0466966_0007499 3300044684 Bacteria 7225
303 Ga0466966_0018436 3300044684 Bacteria 4603
304 Ga0466966_0083951 3300044684 Bacteria 1981
305 Ga0466961_0001025 3300044693 Bacteria 17250
306 Ga0466961_0006712 3300044693 Bacteria 7323
307 Ga0466961_0010644 3300044693 Bacteria 5871
308 Ga0466961_0016012 3300044693 Bacteria 4813
309 Ga0466964_0006952 3300044706 Bacteria 4228
310 Ga0466971_0002157 3300044719 Bacteria 8320
311 Ga0466970_0011697 3300044765 Bacteria 4476
312 Ga0466970_0031224 3300044765 Bacteria 2813
313 Ga0466957_0015282 3300044842 Bacteria 4483
314 Ga0466959_0017018 3300045049 Bacteria 5321
315 Ga0466959_0062636 3300045049 Bacteria 2702
316 Ga0466959_0154806 3300045049 Bacteria 1614
317 Ga0466958_0003546 3300045836 Bacteria 8116
318 Ga0466958_0106802 3300045836 Bacteria 1746
319 Ga0466958_0204088 3300045836 Bacteria 1258
320 Ga0466967_0262397 3300045976 Bacteria 1653
321 Ga0466967_0817044 3300045976 Bacteria 926
322 Ga0495617_000084 3300046452 Bacteria 69137
323 Ga0495617_000403 3300046452 Bacteria 23927
324 Ga0495638_0000007 3300046460 Bacteria 602783
325 Ga0495638_0000165 3300046460 Bacteria 102999
326 Ga0495638_0000194 3300046460 Bacteria 88601
327 Ga0495638_0000213 3300046460 Bacteria 81547
328 Ga0495650_0000202 3300046471 Bacteria 129910
329 Ga0495650_0000851 3300046471 Bacteria 36692
330 Ga0495650_0009169 3300046471 Bacteria 5667
331 Ga0495584_0007765 3300046491 Bacteria 5583
332 Ga0495585_0000069 3300046492 Bacteria 106677
333 Ga0495607_0000019 3300046501 Bacteria 167319
334 Ga0495607_0000072 3300046501 Bacteria 100135
335 Ga0495607_0026517 3300046501 Bacteria 3594
336 Ga0495583_0122284 3300046506 Bacteria 1094
337 Ga0495606_0000164 3300046507 Bacteria 116768
338 Ga0495606_0000385 3300046507 Bacteria 74818
339 Ga0495606_0001151 3300046507 Bacteria 37509
340 Ga0495606_0004574 3300046507 Bacteria 13733
341 Ga0495606_0031421 3300046507 Bacteria 3692
342 Ga0495616_0000100 3300046513 Bacteria 73588
343 Ga0495620_0000775 3300046515 Bacteria 19606
344 Ga0495620_0002355 3300046515 Bacteria 10945
345 Ga0495631_0000070 3300046518 Bacteria 64592
346 Ga0495631_0000081 3300046518 Bacteria 62510
347 Ga0495632_0017957 3300046519 Bacteria 3891
348 Ga0495632_0268209 3300046519 Bacteria 762
349 Ga0495637_0015829 3300046520 Bacteria 3532
350 Ga0495648_0000335 3300046524 Bacteria 51908
351 Ga0495609_0001171 3300046538 Bacteria 18081
352 Ga0495622_0026738 3300046557 Bacteria 2693
353 Ga0495668_0005943 3300046616 Bacteria 8107
354 Ga0495611_0000001 3300046648 Bacteria 2628469
355 Ga0495611_0000043 3300046648 Bacteria 94862
356 Ga0495625_0000001 3300046660 Bacteria 1641829
357 Ga0495625_0006063 3300046660 Bacteria 10850
358 Ga0495661_0000103 3300046665 Bacteria 104642
359 Ga0495670_0003996 3300046691 Bacteria 7237
360 Ga0495670_0005423 3300046691 Bacteria 6262
361 Ga0495671_0000429 3300046692 Bacteria 33391
362 Ga0495649_0109714 3300046694 Bacteria 1463
363 Ga0495589_0000063 3300046794 Bacteria 103565
364 Ga0495660_0000275 3300046810 Bacteria 48406
365 Ga0495660_0000594 3300046810 Bacteria 28710
366 Ga0495683_0001467 3300047323 Bacteria 15444
367 Ga0495679_000001 3300047446 Bacteria 1607568
368 Ga0495673_0000001 3300047469 Bacteria 1630730
369 Ga0495673_0000010 3300047469 Bacteria 709599
370 Ga0495673_0000172 3300047469 Bacteria 106236
371 Ga0495686_0000085 3300047472 Bacteria 198128
372 Ga0495686_0000198 3300047472 Bacteria 112699
373 Ga0495686_0007691 3300047472 Bacteria 8047
374 Ga0495686_0046232 3300047472 Bacteria 2752
375 Ga0495686_0066838 3300047472 Bacteria 2220
376 Ga0496100_0019530 3300048903 Bacteria 4045
377 Ga0496100_0042561 3300048903 Bacteria 2901
378 Ga0496101_0003105 3300048904 Bacteria 10271
379 Ga0496104_0125557 3300048907 Bacteria 2464
380 Ga0496106_0000161 3300048909 Bacteria 48595
381 Ga0496107_0077551 3300048910 Bacteria 2420
382 Ga0496107_0348587 3300048910 Bacteria 1102
383 Ga0496108_0171195 3300048911 Bacteria 1879
384 Ga0496113_0091669 3300048916 Bacteria 2343
385 Ga0496115_0000337 3300048918 Bacteria 39950
386 Ga0496115_0000901 3300048918 Bacteria 21555
387 Ga0496115_0029269 3300048918 Bacteria 4324
388 Ga0496116_0005628 3300048919 Bacteria 11540
389 Ga0496117_0011258 3300048920 Bacteria 8028
390 Ga0496117_0053301 3300048920 Bacteria 2843
391 Ga0496117_0108031 3300048920 Bacteria 1741
392 Ga0496117_0223499 3300048920 Bacteria 1046
393 Ga0496118_0001148 3300048921 Bacteria 40842
394 Ga0496118_0004831 3300048921 Bacteria 15714
395 Ga0496118_0005494 3300048921 Bacteria 14387
396 Ga0496118_0014840 3300048921 Bacteria 7261
397 Ga0496118_0032027 3300048921 Bacteria 4342
398 Ga0496118_0099188 3300048921 Bacteria 1975
399 Ga0496118_0165819 3300048921 Bacteria 1358
400 Ga0496118_0210073 3300048921 Bacteria 1143
401 Ga0496119_0000058 3300048922 Bacteria 173131
402 Ga0496119_0003751 3300048922 Bacteria 15551
403 Ga0496119_0092425 3300048922 Bacteria 1716
404 Ga0496120_0000184 3300048923 Bacteria 106643
405 Ga0496120_0000335 3300048923 Bacteria 78595
406 Ga0496120_0048378 3300048923 Bacteria 2447
407 Ga0496121_0000369 3300048924 Bacteria 92541
408 Ga0496121_0000851 3300048924 Bacteria 55282
409 Ga0496121_0001051 3300048924 Bacteria 48973
410 Ga0496121_0001092 3300048924 Bacteria 47942
411 Ga0496121_0015297 3300048924 Bacteria 8056
412 Ga0496121_0021200 3300048924 Bacteria 6378
413 Ga0496121_0040555 3300048924 Bacteria 4082
414 Ga0496121_0057554 3300048924 Bacteria 3221
415 Ga0496121_0081294 3300048924 Bacteria 2565
416 Ga0496121_0093216 3300048924 Bacteria 2345
417 Ga0496121_0114089 3300048924 Bacteria 2054
418 Ga0496122_0000701 3300048925 Bacteria 66268
419 Ga0496122_0015881 3300048925 Bacteria 7169
420 Ga0496122_0023577 3300048925 Bacteria 5417
421 Ga0496122_0040922 3300048925 Bacteria 3674
422 Ga0496122_0048555 3300048925 Bacteria 3261
423 Ga0496122_0252132 3300048925 Bacteria 986
424 Ga0496123_0002017 3300048926 Bacteria 26215
425 Ga0496123_0061798 3300048926 Bacteria 2404
426 Ga0496123_0136439 3300048926 Bacteria 1349
427 Ga0496123_0166057 3300048926 Bacteria 1170
428 Ga0496123_0194598 3300048926 Bacteria 1045
429 Ga0496124_0000004 3300048927 Bacteria 976131
430 Ga0496124_0000006 3300048927 Bacteria 904259
431 Ga0496124_0000763 3300048927 Bacteria 52572
432 Ga0496124_0157922 3300048927 Bacteria 1771
433 Ga0496125_0000499 3300048928 Bacteria 68475
434 Ga0496125_0000768 3300048928 Bacteria 52483
435 Ga0496125_0004928 3300048928 Bacteria 15112
436 Ga0496125_0154132 3300048928 Bacteria 1572
437 Ga0496126_0005474 3300048929 Bacteria 14475
438 Ga0496126_0017941 3300048929 Bacteria 7037
439 Ga0496126_0044835 3300048929 Bacteria 4069
440 Ga0496126_0077273 3300048929 Bacteria 2952
441 Ga0496126_0260125 3300048929 Bacteria 1443
442 Ga0496126_0327806 3300048929 Bacteria 1257
443 Ga0495678_000180 3300049459 Bacteria 72870
444 Ga0495682_0001655 3300049460 Bacteria 11453
445 Ga0495682_0035897 3300049460 Bacteria 1825
446 Ga0501033_0005955 3300049570 Bacteria 9571
447 Ga0501033_0098968 3300049570 Bacteria 2129
448 Ga0501033_0645209 3300049570 Bacteria 723
449 Ga0501034_0193831 3300049571 Bacteria 1993
450 Ga0501034_0203625 3300049571 Bacteria 1936
451 Ga0501034_0225638 3300049571 Bacteria 1824
452 Ga0501036_0169744 3300049572 Bacteria 1838
453 Ga0501037_0364308 3300049573 Bacteria 995
454 Ga0501038_0139668 3300049574 Bacteria 1983
455 Ga0501039_0087328 3300049575 Bacteria 2429
456 Ga0501043_0045314 3300049579 Bacteria 3459
457 Ga0501043_0045595 3300049579 Bacteria 3448
458 Ga0501046_0024828 3300049580 Bacteria 4911
459 Ga0501047_0015911 3300049581 Bacteria 7170
460 Ga0501047_0021576 3300049581 Bacteria 6185
461 Ga0501048_0070752 3300049582 Bacteria 2463
462 Ga0501048_0079700 3300049582 Bacteria 2311
463 Ga0501048_0461039 3300049582 Bacteria 910
464 Ga0501070_0439440 3300049586 Bacteria 1053
465 Ga0501073_0064465 3300049589 Bacteria 2555
466 Ga0501080_0112371 3300049742 Bacteria 2525
467 Ga0501035_0036810 3300049822 Bacteria 4434
468 Ga0501035_0055538 3300049822 Bacteria 3535
469 Ga0501035_0087791 3300049822 Bacteria 2740
470 Ga0501035_0175856 3300049822 Bacteria 1846
471 Ga0501044_0026092 3300049823 Bacteria 6187
472 Ga0501044_0089478 3300049823 Bacteria 3107
473 Ga0501044_0228600 3300049823 Bacteria 1808
474 Ga0501045_0207191 3300049824 Bacteria 1461
475 Ga0500643_000080 3300053087 Bacteria 103235
476 Ga0500555_000031 3300053103 Bacteria 99406
477 Ga0500633_0000822 3300053160 Bacteria 5340
478 Ga0500638_129711 3300053162 Bacteria 1144
479 Ga0500645_000525 3300053730 Bacteria 25677
480 Ga0500661_003348 3300055283 Bacteria 3012
481 Ga0466962_0004777 3300061719 Bacteria 6517
482 Ga0466962_0010301 3300061719 Bacteria 4491
483 2599907298 2599185292 Bacteria 6290804
484 2643863955 2643221569 Bacteria 6064337
485 2643893946 2643221577 Bacteria 3710843
486 2643982531 2643221594 Bacteria 5811388
487 2644121460 2643221621 Bacteria 6212786
488 2644476165 2643221685 Bacteria 3673288
489 2687583444 2687453130 Bacteria 4227172
490 2721028084 2718218334 Bacteria 4765486
491 2735836351 2734482264 Unclassified 5014763
492 2739227570 2738543009 Bacteria 4944499
493 2739732012 2739367700 Bacteria 4747630
494 2809034641 2808606395 Bacteria 6020352
495 2842782849 2842780639 Bacteria 4337790
496 2842915442 2842914999 Bacteria 4419378
497 2855734877 2855730933 Bacteria 7047938
498 2855770661 2855767633 Bacteria 7049357
499 2857547347 2857542790 Bacteria 5326616
500 2858953763 2858950400 Bacteria 6783797
501 2881413202 2881412998 Bacteria 6492157
502 2884340024 2884338543 Bacteria 4610696
503 2884413848 2884411467 Bacteria 5246714
504 2919085911 2919085039 Bacteria 4532964
505 2928964705 2928963466 Bacteria 5165703
506 2939612564 2939611941 Bacteria 3892017
507 2941475102 2941471342 Bacteria 5018624
508 2941480384
509 Ga0105240_10273018
510 JGI24740J21852_10035342
511 JGI24740J21852_10094845
512 JGI24739J22299_10000112
513 JGI24739J22299_10105126
514 JGI24737J22298_10004508
515 JGI24735J21928_10008301
516 JGI24735J21928_10045745
517 JGI25162J39368_1000138
518 JGI25162J39368_1001136
519 JGI25154J39366_1008072
520 JGI25157J39369_1000253
521 JGI25157J39369_1000586
522 JGI25157J39369_1001059
523 JGI25163J39215_1001513
524 JGI25164J39214_1000170
525 JGI25164J39214_1000310
526 JGI25164J39214_1001042
527 JGI25151J46595_10000185
528 JGI25165J46597_1000224
529 JGI25165J46597_1000580
530 JGI25165J46597_1000810
531 JGI25153J46596_10021949
532 rootH1_10015929
533 rootH2_10180704
534 rootH2_10227546
535 Ga0055538_1002409
536 Ga0055533_1000743
537 Ga0055525_1000192
538 Ga0055527_1000041
539 Ga0055527_1000234
540 Ga0055527_1002108
541 Ga0055535_1000193
542 Ga0055535_1000216
543 Ga0055535_1000457
544 Ga0055535_1000502
545 Ga0055535_1001000
546 Ga0055542_1000136
547 Ga0055542_1000152
548 Ga0055542_1000179
549 Ga0055542_1000183
550 Ga0055542_1000496
551 Ga0055542_1000520
552 Ga0055529_1000116
553 Ga0055529_1000189
554 Ga0055529_1000254
555 Ga0055529_1001711
556 Ga0065165_1000790
557 Ga0070682_100000901
558 Ga0070682_100005988
559 Ga0070689_100001668
560 Ga0070661_100017191
561 Ga0070661_100066660
562 Ga0070661_100375317
563 Ga0070661_100449599
564 Ga0070692_10217704
565 Ga0070659_100005586
566 Ga0070659_100010887
567 Ga0070667_100122329
568 Ga0070667_100611535
569 Ga0070709_10501673
570 Ga0070714_100000030
571 Ga0070714_100016293
572 Ga0070714_100039789
573 Ga0070713_100033124
574 Ga0070663_100040164
575 Ga0070663_100230003
576 Ga0070663_100481802
577 Ga0070662_100285297
578 Ga0070681_10074659
579 Ga0070681_10247033
580 Ga0070685_10009901
581 Ga0070679_100048156
582 Ga0070679_100136952
583 Ga0068853_100000701
584 Ga0068853_100006672
585 Ga0068853_100094025
586 Ga0070696_100010393
587 Ga0070696_100051715
588 Ga0070693_100049659
589 Ga0070693_100102519
590 Ga0070665_100328982
591 Ga0068855_100009108
592 Ga0068855_100009396
593 Ga0068855_100023171
594 Ga0068855_100034435
595 Ga0068857_100000319
596 Ga0068854_100001263
597 Ga0068854_100004257
598 Ga0068856_100000652
599 Ga0068856_100009147
600 Ga0068856_100130422
601 Ga0068852_100511383
602 Ga0068863_100692604
603 Ga0068858_100320517
604 Ga0068860_100825802
605 Ga0070712_100037322
606 Ga0075369_10069314
607 Ga0105240_10000254
608 Ga0105240_10013032
609 Ga0105240_10020159
610 Ga0105247_10018594
611 Ga0105241_10284352
612 Ga0105241_10841045
613 Ga0105237_10000007
614 Ga0105237_10000307
615 Ga0105237_10863841
616 Ga0105238_10025452
617 Ga0105238_10339220
618 Ga0105249_10006411
619 Ga0105239_10000020
620 Ga0105239_10006790
621 Ga0105239_10011929
622 Ga0105239_10764193
623 Ga0105239_10877742
624 Ga0157314_1000121
625 Ga0157373_10006314
626 Ga0157373_10173189
627 Ga0157371_10009310
628 Ga0157371_10035315
629 Ga0157371_10401658
630 Ga0157370_10002130
631 Ga0157370_10020669
632 Ga0157370_10099536
633 Ga0157370_10107943
634 Ga0157370_10530824
635 Ga0157369_10002156
636 Ga0157369_10045520
637 Ga0157369_10301161
638 Ga0163162_10044415
639 Ga0157372_10006658
640 Ga0157372_10033436
641 Ga0157372_10093224
642 Ga0157375_10279119
643 Ga0182008_10017242
644 Ga0182006_1000027
645 Ga0182006_1014707
646 Ga0182007_10006605
647 Ga0182007_10016559
648 Ga0182007_10019323
649 Ga0182005_1000055
650 Ga0182005_1012001
651 Ga0183369_1006
652 Ga0183368_1003
653 Ga0163161_10003028
654 Ga0163161_10022440
655 Ga0206353_11728937
656 Ga0209760_101075
657 Ga0209784_100068
658 Ga0209674_100012
659 Ga0209674_100148
660 Ga0209674_100336
661 Ga0209672_100005
662 Ga0209672_100045
663 Ga0209672_100100
664 Ga0209672_100350
665 Ga0209672_100676
666 Ga0209563_100023
667 Ga0207427_100120
668 Ga0207427_100139
669 Ga0207427_100140
670 Ga0207427_103928
671 Ga0209437_100020
672 Ga0209437_100147
673 Ga0209437_100231
674 Ga0209437_100462
675 Ga0209437_100463
676 Ga0209437_103189
677 Ga0209258_100006
678 Ga0209258_100024
679 Ga0209258_100111
680 Ga0209258_100200
681 Ga0209258_100360
682 Ga0209258_100992
683 Ga0209258_101855
684 Ga0209646_1000448
685 Ga0209646_1000896
686 Ga0209026_1000037
687 Ga0209026_1000074
688 Ga0209026_1000099
689 Ga0209026_1000737
690 Ga0209026_1003781
691 Ga0209677_103326
692 Ga0209148_1000002
693 Ga0209148_1000009
694 Ga0209148_1000010
695 Ga0209148_1000012
696 Ga0209148_1000045
697 Ga0209148_1000099
698 Ga0209759_1000110
699 Ga0209759_1000247
700 Ga0209759_1000605
701 Ga0209129_1003076
702 Ga0209233_1000009
703 Ga0209233_1000020
704 Ga0209233_1000147
705 Ga0209233_1000251
706 Ga0209233_1048694
707 Ga0209455_1000008
708 Ga0209455_1000029
709 Ga0209455_1000035
710 Ga0209455_1000086
711 Ga0209455_1000357
712 Ga0209455_1010368
713 Ga0209676_1002272
714 Ga0209025_1000064
715 Ga0209758_1000276
716 Ga0209758_1019556
717 Ga0209050_1004144
718 Ga0209051_1003630
719 Ga0207710_10024020
720 Ga0207647_10003260
721 Ga0207647_10005829
722 Ga0207647_10012861
723 Ga0207647_10017287
724 Ga0207699_10417378
725 Ga0207654_10535426
726 Ga0207707_10089106
727 Ga0207695_10000408
728 Ga0207695_10001214
729 Ga0207695_10002857
730 Ga0207695_10003147
731 Ga0207695_10008177
732 Ga0207695_10073644
733 Ga0207671_10000031
734 Ga0207671_10000074
735 Ga0207693_10057743
736 Ga0207649_10074569
737 Ga0207649_10339646
738 Ga0207694_10091905
739 Ga0207694_10318907
740 Ga0207700_10015921
741 Ga0207664_10000026
742 Ga0207664_10000857
743 Ga0207664_10003572
744 Ga0207690_10002130
745 Ga0207690_10008096
746 Ga0207690_10029336
747 Ga0207690_10049497
748 Ga0207706_10286677
749 Ga0207670_10001036
750 Ga0207667_10000082
751 Ga0207667_10000313
752 Ga0207667_10008318
753 Ga0207667_10153769
754 Ga0207667_10215557
755 Ga0207667_10633242
756 Ga0207640_10000018
757 Ga0207640_10000667
758 Ga0207640_10438516
759 Ga0207658_10359795
760 Ga0207703_10082493
761 Ga0207639_10000523
762 Ga0207639_10014615
763 Ga0207639_10618123
764 Ga0207678_10009903
765 Ga0207678_10038396
766 Ga0207678_10062700
767 Ga0207678_10435920
768 Ga0207702_10001333
769 Ga0207702_10005090
770 Ga0207702_10572497
771 Ga0207641_10087495
772 Ga0207641_10545001
773 Ga0207674_10000397
774 Ga0207674_10009479
775 Ga0207674_10188153
776 Ga0207698_10246421
777 Ga0209371_1014494
778 Ga0268266_10258370
779 Ga0268264_10150106
780 Ga0268264_10751391
781 Ga0268256_1016060
782 Ga0395899_0006931
783 Ga0395899_0025641
784 Ga0395899_0316578
785 Ga0395900_0242103
786 Ga0395898_0000305
787 Ga0395898_0000526
788 Ga0395901_0000356
789 Ga0395901_0025511
790 Ga0395901_0045690
791 Ga0395901_0047914
792 Ga0395901_0058975
793 Ga0395901_0084915
794 Ga0395901_0531328
795 Ga0451789_1328922
796 Ga0451793_0874712
797 Ga0451802_0469131
798 Ga0451804_0453964
799 Ga0451807_1838081
800 Ga0451835_0794154
801 Ga0451839_1084144
802 Ga0451847_0914510
803 Ga0451853_2209289
804 Ga0439459_0000693
805 Ga0466969_0008755
806 Ga0466975_0190098
807 Ga0466989_0125302
808 Ga0466982_0000004
809 Ga0466966_0003802
810 Ga0466966_0007499
811 Ga0466966_0018436
812 Ga0466966_0083951
813 Ga0466961_0001025
814 Ga0466961_0006712
815 Ga0466961_0010644
816 Ga0466961_0016012
817 Ga0466964_0006952
818 Ga0466971_0002157
819 Ga0466970_0011697
820 Ga0466970_0031224
821 Ga0466957_0015282
822 Ga0466959_0017018
823 Ga0466959_0062636
824 Ga0466959_0154806
825 Ga0466958_0003546
826 Ga0466958_0106802
827 Ga0466958_0204088
828 Ga0466967_0262397
829 Ga0466967_0817044
830 Ga0495617_000084
831 Ga0495617_000403
832 Ga0495638_0000007
833 Ga0495638_0000165
834 Ga0495638_0000194
835 Ga0495638_0000213
836 Ga0495650_0000202
837 Ga0495650_0000851
838 Ga0495650_0009169
839 Ga0495584_0007765
840 Ga0495585_0000069
841 Ga0495607_0000019
842 Ga0495607_0000072
843 Ga0495607_0026517
844 Ga0495583_0122284
845 Ga0495606_0000164
846 Ga0495606_0000385
847 Ga0495606_0001151
848 Ga0495606_0004574
849 Ga0495606_0031421
850 Ga0495616_0000100
851 Ga0495620_0000775
852 Ga0495620_0002355
853 Ga0495631_0000070
854 Ga0495631_0000081
855 Ga0495632_0017957
856 Ga0495632_0268209
857 Ga0495637_0015829
858 Ga0495648_0000335
859 Ga0495609_0001171
860 Ga0495622_0026738
861 Ga0495668_0005943
862 Ga0495611_0000001
863 Ga0495611_0000043
864 Ga0495625_0000001
865 Ga0495625_0006063
866 Ga0495661_0000103
867 Ga0495670_0003996
868 Ga0495670_0005423
869 Ga0495671_0000429
870 Ga0495649_0109714
871 Ga0495589_0000063
872 Ga0495660_0000275
873 Ga0495660_0000594
874 Ga0495683_0001467
875 Ga0495679_000001
876 Ga0495673_0000001
877 Ga0495673_0000010
878 Ga0495673_0000172
879 Ga0495686_0000085
880 Ga0495686_0000198
881 Ga0495686_0007691
882 Ga0495686_0046232
883 Ga0495686_0066838
884 Ga0496100_0019530
885 Ga0496100_0042561
886 Ga0496101_0003105
887 Ga0496104_0125557
888 Ga0496106_0000161
889 Ga0496107_0077551
890 Ga0496107_0348587
891 Ga0496108_0171195
892 Ga0496113_0091669
893 Ga0496115_0000337
894 Ga0496115_0000901
895 Ga0496115_0029269
896 Ga0496116_0005628
897 Ga0496117_0011258
898 Ga0496117_0053301
899 Ga0496117_0108031
900 Ga0496117_0223499
901 Ga0496118_0001148
902 Ga0496118_0004831
903 Ga0496118_0005494
904 Ga0496118_0014840
905 Ga0496118_0032027
906 Ga0496118_0099188
907 Ga0496118_0165819
908 Ga0496118_0210073
909 Ga0496119_0000058
910 Ga0496119_0003751
911 Ga0496119_0092425
912 Ga0496120_0000184
913 Ga0496120_0000335
914 Ga0496120_0048378
915 Ga0496121_0000369
916 Ga0496121_0000851
917 Ga0496121_0001051
918 Ga0496121_0001092
919 Ga0496121_0015297
920 Ga0496121_0021200
921 Ga0496121_0040555
922 Ga0496121_0057554
923 Ga0496121_0081294
924 Ga0496121_0093216
925 Ga0496121_0114089
926 Ga0496122_0000701
927 Ga0496122_0015881
928 Ga0496122_0023577
929 Ga0496122_0040922
930 Ga0496122_0048555
931 Ga0496122_0252132
932 Ga0496123_0002017
933 Ga0496123_0061798
934 Ga0496123_0136439
935 Ga0496123_0166057
936 Ga0496123_0194598
937 Ga0496124_0000004
938 Ga0496124_0000006
939 Ga0496124_0000763
940 Ga0496124_0157922
941 Ga0496125_0000499
942 Ga0496125_0000768
943 Ga0496125_0004928
944 Ga0496125_0154132
945 Ga0496126_0005474
946 Ga0496126_0017941
947 Ga0496126_0044835
948 Ga0496126_0077273
949 Ga0496126_0260125
950 Ga0496126_0327806
951 Ga0495678_000180
952 Ga0495682_0001655
953 Ga0495682_0035897
954 Ga0501033_0005955
955 Ga0501033_0098968
956 Ga0501033_0645209
957 Ga0501034_0193831
958 Ga0501034_0203625
959 Ga0501034_0225638
960 Ga0501036_0169744
961 Ga0501037_0364308
962 Ga0501038_0139668
963 Ga0501039_0087328
964 Ga0501043_0045314
965 Ga0501043_0045595
966 Ga0501046_0024828
967 Ga0501047_0015911
968 Ga0501047_0021576
969 Ga0501048_0070752
970 Ga0501048_0079700
971 Ga0501048_0461039
972 Ga0501070_0439440
973 Ga0501073_0064465
974 Ga0501080_0112371
975 Ga0501035_0036810
976 Ga0501035_0055538
977 Ga0501035_0087791
978 Ga0501035_0175856
979 Ga0501044_0026092
980 Ga0501044_0089478
981 Ga0501044_0228600
982 Ga0501045_0207191
983 Ga0500643_000080
984 Ga0500555_000031
985 Ga0500633_0000822
986 Ga0500638_129711
987 Ga0500645_000525
988 Ga0500661_003348
989 Ga0466962_0004777
990 Ga0466962_0010301
991 2599907298
992 2643863955
993 2643893946
994 2643982531
995 2644121460
996 2644476165
997 2687583444
998 2721028084
999 2735836351
1000 2739227570
1001 2739732012
1002 2809034641
1003 2842782849
1004 2842915442
1005 2855734877
1006 2855770661
1007 2857547347
1008 2858953763
1009 2881413202
1010 2884340024
1011 2884413848
1012 2919085911
1013 2928964705
1014 2939612564
1015 2941475102
1016 2941480384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07077

DUF1345

Protein of unknown function (DUF1345)

78

247

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h37-assembly1.cif.gz_A crystal structure of a voltage-gated k+ channel pore domain in a closed state in lipid membranes 0.8212 163 219
2qks-assembly2.cif.gz_B crystal structure of a kir3.1-prokaryotic kir channel chimera 0.8056 107 222
4lp8-assembly1.cif.gz_A a novel open-state crystal structure of the prokaryotic inward rectifier kirbac3.1 0.7982 109 220
2wlj-assembly1.cif.gz_A-2 potassium channel from magnetospirillum magnetotacticum 0.7846 116 219
2wll-assembly1.cif.gz_B-2 potassium channel from burkholderia pseudomallei 0.7844 107 222
ID Description Score Start End Superfamily
4h37A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8212 163 219 1.10.287.70
4h37B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8207 163 219 1.10.287.70
4h33A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8035 161 224 1.10.287.70
2wllA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7844 107 222 1.10.287.70
1xl4B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7681 109 219 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A370KDB9-F1-model_v4 DUF1345 domain-containing protein 0.9548 27 224 GO:0016020
AF-A0A7X0E714-F1-model_v4 Putative membrane protein 0.9534 27 225 GO:0016020
AF-A0A7X0E714-F1-model_v4 Putative membrane protein 0.9442 27 225 GO:0016020
AF-A0A1I2CBU4-F1-model_v4 Uncharacterized membrane protein 0.9404 1 225 GO:0016020
AF-A0A839WLE0-F1-model_v4 Putative membrane protein 0.9381 79 225 GO:0016020

Map