F456898

General Info

Members Datasets Scaffolds Average Seq Length
508 453 1014 298

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154107|2515607383
Length 361
Sequence SGRRPLTLSPQGGDSAACPLLPARGEKMPQADEGPHCGILGAPKTKLRTDCPEQTTQQKAKHMIRYGTNPIAWSNDDDHSIGAHLTLEDCLSDCKKIGFDGIEKGHKMPSDPEALKQKLSSYDLVFVSGWHSTNLLTHDVEAEKKAIQPHLDLLKHNGCRVAIVCETSNAIHGDDSKSLVKDKPVLPADKWEKFGADLEAIAQYCAGQGIDLVYHHHMGTIVQTGEEIDLLMRNTGPATKLLLDTGHAWFGGSDPADVARRYMDRVRHIHCKNVRPAVRAVVESEGLSFLEGVRRGVFTVPGDAEGGVDFLPVLKIAAQHGYDGWLVIEAEQDSAVRNPFEYQSLGLKSLKAFAKEAGLDA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
32 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
33 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
34 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
35 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
39 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
40 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
69 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
77 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
78 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
79 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
80 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
83 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
90 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
101 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
102 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
105 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
106 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
107 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
108 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
109 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
112 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
113 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
114 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
115 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
116 2509276019 Ensifer aridi TW10 Isolate Nodule
117 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
118 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
119 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
120 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
121 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
122 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
123 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
124 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
125 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
126 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
127 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
128 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
129 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
130 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
131 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
132 2516143018 Ensifer sp. BR816 Isolate Nodule
133 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
134 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
135 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
136 2534681786 Brucella suis 92/29 Isolate Unclassified
137 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
138 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
139 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
140 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
141 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
142 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
143 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
144 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
145 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
146 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
147 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
148 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
149 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
150 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
151 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
152 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
153 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
154 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
155 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
156 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
157 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
158 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
159 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
160 2643221557 Ensifer sp. Root558 Isolate Unclassified
161 2643221558 Rhizobium sp. Root149 Isolate Unclassified
162 2643221568 Rhizobium sp. Root564 Isolate Unclassified
163 2643221582 Rhizobium sp. Root651 Isolate Unclassified
164 2643221610 Ensifer sp. Root74 Isolate Unclassified
165 2643221618 Ensifer sp. Root231 Isolate Unclassified
166 2643221626 Ensifer sp. Root31 Isolate Unclassified
167 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
168 2643221655 Ensifer sp. Root1252 Isolate Unclassified
169 2643221659 Ensifer sp. Root127 Isolate Unclassified
170 2643221668 Ensifer sp. Root423 Isolate Unclassified
171 2643221675 Ensifer sp. Root1298 Isolate Unclassified
172 2643221680 Ensifer sp. Root1312 Isolate Unclassified
173 2643221688 Rhizobium sp. Root482 Isolate Unclassified
174 2643221693 Rhizobium sp. Root491 Isolate Unclassified
175 2643221698 Ensifer sp. Root142 Isolate Unclassified
176 2643221712 Ensifer sp. Root258 Isolate Unclassified
177 2643221719 Rhizobium sp. Root274 Isolate Unclassified
178 2643221723 Ensifer sp. Root278 Isolate Unclassified
179 2643221726 Ensifer sp. Root954 Isolate Unclassified
180 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
181 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
182 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
183 2751185800 Brucella pituitosa AA2 Isolate Unclassified
184 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
185 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
186 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
187 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
188 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
189 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
190 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
191 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
192 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
193 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
194 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
195 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
196 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
197 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
198 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
199 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
200 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
201 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
202 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
203 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
204 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
205 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
206 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
207 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
208 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
209 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
210 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
211 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
212 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
213 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
214 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
215 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
216 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
217 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
218 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
219 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
220 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
221 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
222 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
223 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
224 2844163670 Ensifer sp. 1H6 Isolate Unclassified
225 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
226 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
227 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
228 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
229 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
230 2854911287 Brucella lupini LUP21 Isolate Unclassified
231 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
232 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
233 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
234 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
235 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
236 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
237 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
238 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
239 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
240 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
241 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
242 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
243 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
244 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
245 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
246 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
247 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
248 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
249 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
250 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
251 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
252 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
253 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
254 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
255 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
256 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
257 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
258 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
259 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
260 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
261 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
262 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
263 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
264 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
265 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
266 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
267 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
268 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
269 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
270 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
271 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
272 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
273 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
274 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
275 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
276 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
277 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
278 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
279 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
280 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
281 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
282 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
283 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
284 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
285 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
286 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
287 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
288 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
289 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
290 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
291 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
292 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
293 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
294 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
295 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
296 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
297 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
298 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
299 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
300 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
301 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
302 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
303 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
304 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
305 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
306 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
307 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
308 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
309 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
310 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
311 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
312 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
313 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
314 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
315 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
316 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
317 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
318 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
319 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
320 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
321 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
322 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
323 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
324 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
325 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
326 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
327 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
328 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
329 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
330 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
331 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
332 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
333 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
334 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
335 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
336 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
337 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
338 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
339 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
340 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
341 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
342 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
343 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
344 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
345 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
346 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
347 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
348 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
349 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
350 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
351 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
352 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
353 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
354 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
355 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
356 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
357 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
358 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
359 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
360 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
361 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
362 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
363 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
364 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
365 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
366 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
367 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
368 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
369 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
370 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
371 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
372 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
373 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
374 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
375 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
376 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
377 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
378 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
379 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
380 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
381 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
382 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
383 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
384 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
385 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
386 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
387 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
388 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
389 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
390 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
391 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
392 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
393 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
394 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
395 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
396 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
397 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
398 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
399 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
400 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
401 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
402 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
403 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
404 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
405 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
406 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
407 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
408 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
409 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
410 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
411 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
412 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
413 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
414 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
415 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
416 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
417 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
418 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
419 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
420 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
421 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
422 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
423 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
424 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
425 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
426 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
427 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
428 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
429 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
430 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
431 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
432 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
433 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
434 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
435 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
436 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
437 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
438 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
439 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
440 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
441 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
442 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
443 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
444 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
445 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
446 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
447 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
448 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
449 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
450 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
451 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
452 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
453 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 32.09
Metatranscriptomes 0.2
Isolates 67.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.98
Bulb 0
Endosphere 11.61
Nodule 50.59
Rhizoplane 1.77
Rhizosphere 13.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000015 3300002987 Bacteria 142431
2 JGI25151J46595_10014369 3300003187 Bacteria 3529
3 JGI25151J46595_10036865 3300003187 Bacteria 1840
4 JGI25160J50197_1000003 3300003354 Bacteria 482719
5 JGI25161J50226_1010749 3300003374 Bacteria 1199
6 Ga0006562J51391_1025412 3300003578 Bacteria 1835
7 Ga0055526_1000639 3300003771 Bacteria 27197
8 Ga0055524_1009869 3300003775 Bacteria 3844
9 Ga0055536_1002504 3300003781 Bacteria 10308
10 Ga0055530_10016286 3300003791 Bacteria 2382
11 Ga0055530_10024331 3300003791 Bacteria 1719
12 Ga0055540_1016226 3300003792 Bacteria 2129
13 Ga0055531_10011659 3300003794 Bacteria 4211
14 Ga0055531_10023196 3300003794 Bacteria 2336
15 Ga0058692_1002395 3300003856 Bacteria 6294
16 Ga0058692_1006334 3300003856 Bacteria 3269
17 Ga0058692_1009689 3300003856 Bacteria 2414
18 Ga0055543_1000223 3300004625 Bacteria 45570
19 Ga0065165_1000025 3300005262 Bacteria 246909
20 Ga0065165_1003404 3300005262 Bacteria 11229
21 Ga0070665_100017919 3300005548 Bacteria 7111
22 Ga0070665_100532773 3300005548 Bacteria 1186
23 Ga0081455_10182131 3300005937 Bacteria 1589
24 Ga0075368_10024199 3300006042 Bacteria 2324
25 Ga0075363_100194610 3300006048 Bacteria 1157
26 Ga0075364_10000024 3300006051 Bacteria 51969
27 Ga0075364_10000126 3300006051 Bacteria 31821
28 Ga0075364_10005078 3300006051 Bacteria 7631
29 Ga0075362_10048384 3300006177 Bacteria 1897
30 Ga0075369_10021244 3300006186 Bacteria 2665
31 Ga0075366_10014039 3300006195 Bacteria 4569
32 Ga0079104_1000563 3300006946 Bacteria 37845
33 Ga0079104_1000993 3300006946 Bacteria 21991
34 Ga0099826_10000151 3300006948 Bacteria 29495
35 Ga0099826_10077051 3300006948 Bacteria 2093
36 Ga0099794_10005691 3300007265 Bacteria 5021
37 Ga0105243_10004159 3300009148 Bacteria 11483
38 Ga0157373_10050586 3300013100 Bacteria 2959
39 Ga0157373_10052862 3300013100 Bacteria 2889
40 Ga0157371_10000005 3300013102 Bacteria 416456
41 Ga0157371_10002763 3300013102 Bacteria 16489
42 Ga0157370_10000036 3300013104 Bacteria 136933
43 Ga0157369_10115946 3300013105 Bacteria 2845
44 Ga0171463_1001 3300013249 Bacteria 1406070
45 Ga0183363_1135 3300015690 Bacteria 18828
46 Ga0214544_1002513 3300021320 Bacteria 38572
47 Ga0214542_1000029 3300021321 Bacteria 174097
48 Ga0214543_1000040 3300021327 Bacteria 174142
49 Ga0214543_1000049 3300021327 Bacteria 149506
50 Ga0213872_10086812 3300021361 Bacteria 1402
51 Ga0213875_10004084 3300021388 Bacteria 8120
52 Ga0228711_1000013 3300022739 Bacteria 132585
53 Ga0228710_1000008 3300022740 Bacteria 174306
54 Ga0209565_1023313 3300025263 Bacteria 1272
55 Ga0209130_1000005 3300025284 Bacteria 599620
56 Ga0209676_1001942 3300025292 Bacteria 16657
57 Ga0209025_1000105 3300025294 Bacteria 224157
58 Ga0209025_1000478 3300025294 Bacteria 77516
59 Ga0209564_1000217 3300025295 Bacteria 131090
60 Ga0209758_1001220 3300025297 Bacteria 32262
61 Ga0209050_1000773 3300025298 Bacteria 45942
62 Ga0209256_1000027 3300025299 Bacteria 423283
63 Ga0209256_1001301 3300025299 Bacteria 26880
64 Ga0207426_1000015 3300025302 Bacteria 599316
65 Ga0209051_1001459 3300025303 Bacteria 20047
66 Ga0209051_1008214 3300025303 Bacteria 5561
67 Ga0209257_1002498 3300025304 Bacteria 18159
68 Ga0209257_1003036 3300025304 Bacteria 15160
69 Ga0207681_10106149 3300025923 Bacteria 2035
70 Ga0207709_10022053 3300025935 Bacteria 3610
71 Ga0209281_1000032 3300027111 Bacteria 401727
72 Ga0209281_1000134 3300027111 Bacteria 185406
73 Ga0209281_1000319 3300027111 Bacteria 84764
74 Ga0209371_1000003 3300027312 Bacteria 1122971
75 Ga0209371_1006839 3300027312 Bacteria 4123
76 Ga0209282_1000029 3300027666 Bacteria 157883
77 Ga0209282_1000339 3300027666 Bacteria 23222
78 Ga0209282_1071066 3300027666 Bacteria 1895
79 Ga0209813_10088492 3300027866 Bacteria 1035
80 Ga0268266_10013966 3300028379 Bacteria 6915
81 Ga0268266_10461738 3300028379 Bacteria 1208
82 Ga0265319_1023451 3300028563 Bacteria 2237
83 Ga0265334_10027991 3300028573 Bacteria 2267
84 Ga0265323_10003830 3300028653 Bacteria 6554
85 Ga0265336_10000362 3300028666 Bacteria 29324
86 Ga0265338_10001385 3300028800 Bacteria 39441
87 Ga0268256_1000004 3300030500 Bacteria 1122967
88 Ga0268256_1005821 3300030500 Bacteria 4739
89 Ga0268256_1007016 3300030500 Bacteria 4090
90 Ga0307408_100264992 3300031548 Bacteria 1424
91 Ga0307405_10221940 3300031731 Bacteria 1387
92 Ga0315914_1000021 3300031967 Bacteria 119592
93 Ga0307411_10195071 3300032005 Bacteria 1550
94 Ga0315913_1000014 3300033430 Bacteria 120114
95 Ga0315915_1000003 3300033464 Bacteria 407996
96 Ga0395899_0000044 3300037312 Bacteria 248735
97 Ga0395900_0000042 3300037418 Bacteria 242667
98 Ga0395898_0000080 3300037466 Bacteria 242667
99 Ga0395905_0000044 3300037471 Bacteria 242916
100 Ga0436364_1189831 3300037853 Bacteria 8264
101 Ga0395901_0000027 3300038443 Bacteria 244204
102 Ga0400484_32435 3300038725 Bacteria 7628
103 Ga0400490_38094 3300038726 Bacteria 26956
104 Ga0400488_31474 3300038741 Bacteria 2685
105 Ga0400488_51429 3300038741 Bacteria 4778
106 Ga0400483_247668 3300039062 Bacteria 26775
107 Ga0400487_13197 3300039110 Bacteria 19734
108 Ga0400487_42531 3300039110 Bacteria 1333
109 Ga0436361_0515516 3300039447 Bacteria 1490
110 Ga0439436_0004755 3300041404 Bacteria 4165
111 Ga0439465_0012896 3300041413 Bacteria 2612
112 Ga0466960_0060278 3300044901 Bacteria 1859
113 Ga0451576_0029552 3300045051 Bacteria 5864
114 Ga0495588_0001539 3300046674 Bacteria 9865
115 Ga0495681_0003093 3300047470 Bacteria 11666
116 Ga0496113_0043474 3300048916 Bacteria 3325
117 Ga0496116_0000026 3300048919 Bacteria 450803
118 Ga0496116_0049343 3300048919 Bacteria 2816
119 Ga0496116_0081122 3300048919 Bacteria 2012
120 Ga0496117_0000030 3300048920 Bacteria 389141
121 Ga0496117_0024986 3300048920 Bacteria 4706
122 Ga0496117_0036202 3300048920 Bacteria 3696
123 Ga0496118_0040388 3300048921 Bacteria 3711
124 Ga0496118_0052432 3300048921 Bacteria 3111
125 Ga0496119_0030142 3300048922 Bacteria 3663
126 Ga0496119_0042728 3300048922 Bacteria 2872
127 Ga0496120_0000148 3300048923 Bacteria 116605
128 Ga0496121_0000005 3300048924 Bacteria 1034486
129 Ga0496121_0000337 3300048924 Bacteria 97711
130 Ga0496122_0000050 3300048925 Bacteria 267874
131 Ga0496122_0000172 3300048925 Bacteria 153862
132 Ga0496122_0006423 3300048925 Bacteria 13499
133 Ga0496122_0040255 3300048925 Bacteria 3717
134 Ga0496122_0052093 3300048925 Bacteria 3103
135 Ga0496123_0000023 3300048926 Bacteria 346894
136 Ga0496123_0000132 3300048926 Bacteria 153568
137 Ga0496124_0000091 3300048927 Bacteria 189706
138 Ga0496124_0007933 3300048927 Bacteria 11176
139 Ga0496124_0128092 3300048927 Bacteria 2020
140 Ga0496125_0000107 3300048928 Bacteria 197483
141 Ga0496125_0025520 3300048928 Bacteria 5409
142 Ga0496125_0054214 3300048928 Bacteria 3279
143 Ga0496126_0000069 3300048929 Bacteria 246935
144 Ga0501238_002793 3300049671 Bacteria 2114
145 nmdc:mga03683_11389_c1 3300050489 Bacteria 3220
146 nmdc:mga03n38_19375_c1 3300050490 Bacteria 2704
147 nmdc:mga00v17_168_c1 3300050491 Bacteria 38334
148 nmdc:mga00v17_29377_c1 3300050491 Bacteria 3226
149 nmdc:mga00v17_36_c1 3300050491 Bacteria 85171
150 nmdc:mga00v17_755_c1 3300050491 Bacteria 17551
151 nmdc:mga0yw44_1184_c1 3300050492 Bacteria 10182
152 nmdc:mga0k408_13892_c1 3300050493 Bacteria 4426
153 nmdc:mga0sz30_16163_c1 3300050516 Bacteria 2958
154 nmdc:mga0sz30_74_c1 3300050516 Bacteria 15880
155 Ga0500572_001498 3300053111 Bacteria 6308
156 Ga0500618_000244 3300053125 Bacteria 43257
157 Ga0500573_0024322 3300053140 Bacteria 3482
158 Ga0500616_0000771 3300053153 Bacteria 36893
159 Ga0500624_000609 3300053157 Bacteria 9780
160 Ga0500634_0024557 3300053161 Bacteria 3277
161 Ga0500634_0081711 3300053161 Bacteria 1663
162 Ga0500636_0000009 3300053177 Bacteria 155504
163 Ga0500636_0000262 3300053177 Bacteria 29181
164 2515607383 2515154107 Bacteria 6795637
165 2509108917 2508501122 Bacteria 6292184
166 2509375361 2509276019 Bacteria 6802256
167 2510307296 2510065057 Bacteria 6649661
168 2510842178 2510461069 Bacteria 5505000
169 2511172366 2510917026 Bacteria 7046020
170 2511498963 2511231052 Bacteria 6974333
171 2512535092 2512047086 Bacteria 6850303
172 2512973084 2512875026 Bacteria 6861065
173 2513586178 2513237086 Bacteria 7265287
174 2513604334 2513237089 Bacteria 6553624
175 2513616180 2513237091 Bacteria 6900273
176 2513718996 2513237104 Bacteria 10034502
177 2513882667 2513237140 Bacteria 7076289
178 2513906467 2513237143 Bacteria 6664116
179 2513925642 2513237146 Bacteria 7166346
180 2513983146 2513237156 Bacteria 6402557
181 2514008151 2513237160 Bacteria 6650282
182 2516204669 2516143018 Bacteria 6951533
183 2516895238 2516653046 Bacteria 6989037
184 2517571915 2517487022 Bacteria 7227575
185 2524450878 2524023207 Bacteria 6813453
186 2535486671 2534681786 Bacteria 3308809
187 2537873158 2537561587 Bacteria 5425293
188 2551679912 2551306084 Bacteria 8942552
189 2551683733 2551306085 Bacteria 7347181
190 2551693780 2551306086 Bacteria 6843938
191 2551703318 2551306087 Bacteria 7351905
192 2551708648 2551306089 Bacteria 7162724
193 2551722923 2551306090 Bacteria 7953713
194 2551726595 2551306091 Bacteria 7086830
195 2551735358 2551306092 Bacteria 6992595
196 2551743505 2551306093 Bacteria 7064773
197 2554244507 2554235003 Bacteria 5877155
198 2558866451 2558860100 Bacteria 8458965
199 2559297650 2558860242 Bacteria 5568029
200 2561467833 2558860983 Bacteria 4133860
201 2585993738 2585427633 Bacteria 6413184
202 2586004587 2585427634 Bacteria 6455027
203 2599332461 2599185156 Bacteria 5403036
204 2599336405 2599185156 Bacteria 5403036
205 2599418659 2599185170 Bacteria 7295545
206 2599606600 2599185210 Bacteria 5624189
207 2599722770 2599185236 Bacteria 6875203
208 2600194957 2599185352 Bacteria 7228948
209 2601612444 2600255279 Bacteria 5605316
210 2601748985 2600255308 Bacteria 5611129
211 2643805930 2643221557 Bacteria 7184309
212 2643813448 2643221558 Bacteria 5460675
213 2643853843 2643221568 Bacteria 5187270
214 2643917522 2643221582 Bacteria 5804683
215 2644066106 2643221610 Bacteria 7480339
216 2644103651 2643221618 Bacteria 7717186
217 2644144530 2643221626 Bacteria 8069654
218 2644299415 2643221653 Bacteria 4569637
219 2644306581 2643221655 Bacteria 7722067
220 2644330771 2643221659 Bacteria 7890716
221 2644377190 2643221668 Bacteria 7306521
222 2644417437 2643221675 Bacteria 7473456
223 2644450833 2643221680 Bacteria 7473610
224 2644495469 2643221688 Bacteria 5260751
225 2644522696 2643221693 Bacteria 5513853
226 2644542423 2643221698 Bacteria 7756764
227 2644612192 2643221712 Bacteria 7729434
228 2644657643 2643221719 Bacteria 4568197
229 2644671615 2643221723 Bacteria 7095460
230 2644692744 2643221726 Bacteria 7455827
231 2657682894 2657244999 Bacteria 5946535
232 2692317625 2690316117 Bacteria 6800650
233 2738944695 2738541317 Bacteria 5340176
234 2753358094 2751185800 Bacteria 5467370
235 2753459828 2751185821 Bacteria 6189929
236 2757572253 2757320392 Bacteria 3737298
237 2758639128 2758568016 Bacteria 5645291
238 2776910363 2775507049 Bacteria 6284736
239 2792583228 2791355082 Bacteria 5973319
240 2792621090 2791355091 Bacteria 6135441
241 2792625304 2791355092 Bacteria 6248105
242 2792637734 2791355094 Bacteria 7011481
243 2793283549 2791355253 Bacteria 5171699
244 2802718651 2802428858 Bacteria 6636079
245 2802724332 2802428859 Bacteria 6667919
246 2802730006 2802428860 Bacteria 6525526
247 2802737349 2802428861 Bacteria 6534206
248 2802742265 2802428862 Bacteria 6633353
249 2802748948 2802428863 Bacteria 6410669
250 2804754113 2802429268 Bacteria 6094027
251 2808989160 2808606387 Bacteria 5697198
252 2819243988 2818991272 Bacteria 4622173
253 2819557698 2818991439 Bacteria 6907412
254 2819687905 2818991461 Bacteria 7026071
255 2821129669 2821123053 Bacteria 7836056
256 2838037651 2838035591 Bacteria 7166484
257 2838075002 2838074704 Bacteria 6785777
258 2838662400 2838661181 Bacteria 7385261
259 2838662658 2838661181 Bacteria 7385261
260 2838679918 2838675328 Bacteria 4909118
261 2838717715 2838714209 Bacteria 5525906
262 2838724489 2838719591 Bacteria 5523910
263 2838729569 2838724970 Bacteria 4908691
264 2841850007 2841846520 Bacteria 5345850
265 2841861205 2841859092 Bacteria 5436171
266 2842128479 2842124991 Bacteria 5346824
267 2842134600 2842130223 Bacteria 4909145
268 2842156568 2842152218 Bacteria 4908957
269 2842173960 2842170452 Bacteria 5525737
270 2842180189 2842175837 Bacteria 4908771
271 2842192188 2842187318 Bacteria 5524014
272 2842216532 2842211629 Bacteria 5523832
273 2842229224 2842224351 Bacteria 5524473
274 2842518528 2842515876 Bacteria 5436280
275 2842922730 2842922631 Bacteria 5824079
276 2842927479 2842922631 Bacteria 5824079
277 2844170073 2844163670 Bacteria 7266046
278 2847421395 2847417321 Bacteria 6913799
279 2848996180 2848992105 Bacteria 6810864
280 2850079573 2850079185 Bacteria 6848280
281 2854681322 2854681122 Bacteria 4548679
282 2854898981 2854896431 Bacteria 5869725
283 2854899784 2854896431 Bacteria 5869725
284 2854916343 2854911287 Bacteria 5582813
285 2854920996 2854916844 Bacteria 5725939
286 2855827876 2855825444 Bacteria 6785811
287 2855843244 2855839649 Bacteria 7135830
288 2855875270 2855872281 Bacteria 6964271
289 2857536019 2857531043 Bacteria 6754041
290 2858802972 2858800743 Bacteria 6603254
291 2889792021 2889790730 Bacteria 5689708
292 2889918350 2889914905 Bacteria 5702301
293 2891051649 2891048133 Bacteria 4447501
294 2894817632 2894817345 Bacteria 4892941
295 2896384714 2896384573 Bacteria 7700774
296 2899278919 2899275550 Bacteria 3958688
297 2899793111 2899792073 Bacteria 4926588
298 2899808418 2899803654 Bacteria 5577784
299 2899849686 2899845264 Bacteria 5672268
300 2913298294 2913295892 Bacteria 6333755
301 2913309316 2913308742 Bacteria 5350706
302 2915652764 2915650412 Bacteria 4288180
303 2915986576 2915980308 Bacteria 6624279
304 2915989409 2915986958 Bacteria 6739310
305 2915995949 2915993759 Bacteria 7016183
306 2916004882 2916000859 Bacteria 6865702
307 2916008285 2916007675 Bacteria 6898660
308 2916015038 2916014648 Bacteria 6946486
309 2916026161 2916021584 Bacteria 6854472
310 2916032805 2916028427 Bacteria 6748433
311 2916038317 2916035215 Bacteria 6755766
312 2916044568 2916041962 Bacteria 6820487
313 2916054753 2916048683 Bacteria 6543552
314 2916057143 2916055098 Bacteria 6758838
315 2916065908 2916061851 Bacteria 6737736
316 2916071840 2916068649 Bacteria 6943657
317 2916079644 2916076590 Bacteria 6596108
318 2919117996 2919114240 Bacteria 5700270
319 2919168318 2919166419 Bacteria 4952238
320 2919174042 2919171160 Bacteria 6499771
321 2920763744 2920760137 Bacteria 7427611
322 2920822968 2920822456 Bacteria 6897201
323 2921204041 2921201388 Bacteria 6926299
324 2921208931 2921208531 Bacteria 6745326
325 2921242239 2921237296 Bacteria 6876710
326 2921249832 2921244191 Bacteria 6568419
327 2921254893 2921250672 Bacteria 6677771
328 2921259954 2921257292 Bacteria 6808382
329 2921267342 2921263974 Bacteria 6864552
330 2921287418 2921282425 Bacteria 6826397
331 2921292158 2921289301 Bacteria 7316391
332 2921301284 2921296804 Bacteria 7176999
333 2924146166 2924144063 Bacteria 6883928
334 2924157320 2924150972 Bacteria 7169444
335 2924164568 2924158325 Bacteria 7188855
336 2924166528 2924165586 Bacteria 7260590
337 2924179567 2924172951 Bacteria 6749356
338 2924180750 2924179722 Bacteria 6843264
339 2924190975 2924186466 Bacteria 6876637
340 2924200264 2924193448 Bacteria 6955718
341 2924202583 2924200457 Bacteria 6757188
342 2924209488 2924207177 Bacteria 6917007
343 2924215460 2924214083 Bacteria 7080103
344 2924227029 2924221636 Bacteria 7113495
345 2924230115 2924228884 Bacteria 6633132
346 2926757763 2926754445 Bacteria 5964435
347 2926764612 2926760298 Bacteria 5505990
348 2929143504 2929138655 Bacteria 5810547
349 2933010378 2933006813 Bacteria 4912075
350 2933014154 2933011516 Bacteria 5439334
351 2933597247 2933594066 Bacteria 5594265
352 2936998630 2936996657 Bacteria 6298727
353 2937006348 2937002841 Bacteria 6934057
354 2937011706 2937009748 Bacteria 6746052
355 2937018412 2937016420 Bacteria 6782579
356 2937023548 2937023124 Bacteria 6815156
357 2937033593 2937029754 Bacteria 6424026
358 2937040372 2937036028 Bacteria 6846469
359 2937047677 2937042894 Bacteria 6741576
360 2937051713 2937049772 Bacteria 6757901
361 2937061856 2937056579 Bacteria 7107896
362 2937069937 2937063883 Bacteria 7199456
363 2937072897 2937071275 Bacteria 6984483
364 2937082682 2937078374 Bacteria 6610289
365 2937089488 2937084907 Bacteria 6618516
366 2937093874 2937091812 Bacteria 6979387
367 2937104544 2937098957 Bacteria 7249374
368 2937108309 2937106411 Bacteria 6947143
369 2937116358 2937113482 Bacteria 6505872
370 2937121897 2937119839 Bacteria 6597547
371 2937129645 2937126314 Bacteria 6771275
372 2941501075 2941499720 Bacteria 7599444
373 2957377882 2957375807 Bacteria 6425588
374 2957384357 2957382221 Bacteria 6737050
375 2957393205 2957388812 Bacteria 6778072
376 2957402219 2957395598 Bacteria 6822399
377 2957403476 2957402308 Bacteria 6741770
378 2957413497 2957408893 Bacteria 6558585
379 2957417328 2957415311 Bacteria 6991633
380 2957426542 2957422303 Bacteria 7172205
381 2957434648 2957430029 Bacteria 7022557
382 2957443821 2957437181 Bacteria 6568994
383 2957446848 2957443900 Bacteria 6869977
384 2957452850 2957450854 Bacteria 6765715
385 2957458948 2957457609 Bacteria 6967680
386 2957467190 2957464669 Bacteria 6568877
387 2957474661 2957471148 Bacteria 6797643
388 2957481248 2957478035 Bacteria 6756658
389 2957486702 2957484790 Bacteria 6703082
390 2957493805 2957491536 Bacteria 6695180
391 2957503053 2957498199 Bacteria 7126688
392 2957510231 2957505466 Bacteria 7253085
393 2960585562 2960584000 Bacteria 6864594
394 2960593285 2960591022 Bacteria 6622873
395 2960598028 2960597568 Bacteria 6550735
396 2960604426 2960603979 Bacteria 6898737
397 2960613725 2960610863 Bacteria 6691244
398 2960620376 2960617483 Bacteria 6727748
399 2960626228 2960624210 Bacteria 6875384
400 2960637071 2960631154 Bacteria 6732508
401 2960642525 2960637947 Bacteria 7296468
402 2960650924 2960645483 Bacteria 7211087
403 2960654613 2960652885 Bacteria 7083688
404 2960660755 2960660292 Bacteria 7041660
405 2960670199 2960667422 Bacteria 6763020
406 2960676777 2960674078 Bacteria 6609048
407 2960685227 2960680706 Bacteria 6624464
408 2960689659 2960687367 Bacteria 6535474
409 2960697396 2960693952 Bacteria 6749742
410 2964611536 2964607997 Bacteria 7101408
411 2964618253 2964615318 Bacteria 6809089
412 2964626590 2964621998 Bacteria 6834995
413 2964634115 2964628898 Bacteria 7083044
414 2964641439 2964636051 Bacteria 7091832
415 2964644986 2964643177 Bacteria 6820887
416 2964649971 2964649959 Bacteria 6675118
417 2964659505 2964656573 Bacteria 7100150
418 2964670323 2964663802 Bacteria 7019362
419 2964672757 2964670856 Bacteria 6851364
420 2964678445 2964678106 Bacteria 6792020
421 2964685322 2964685014 Bacteria 6839111
422 2964696277 2964691889 Bacteria 6802758
423 2964699503 2964698721 Bacteria 6765331
424 2964708191 2964705432 Bacteria 7114648
425 2964713869 2964712639 Bacteria 6695970
426 2964723294 2964719344 Bacteria 7286602
427 2967668442 2967664464 Bacteria 6948836
428 2967676387 2967671571 Bacteria 7021409
429 2967682162 2967678726 Bacteria 7264382
430 2967689937 2967686174 Bacteria 6678622
431 2967695307 2967693043 Bacteria 6804451
432 2967700579 2967699805 Bacteria 6854538
433 2967709930 2967706974 Bacteria 7186053
434 2967717869 2967714385 Bacteria 7000047
435 2967723643 2967721400 Bacteria 7073753
436 2967732808 2967728569 Bacteria 6641507
437 2967740624 2967735183 Bacteria 6827012
438 2967745052 2967742019 Bacteria 6794534
439 2967749571 2967748971 Bacteria 6733771
440 2967757321 2967755722 Bacteria 6814706
441 2967768700 2967762386 Bacteria 6923502
442 2967771384 2967769361 Bacteria 6587838
443 2967777971 2967775926 Bacteria 6738189
444 2970023069 2970019648 Bacteria 7072033
445 2970031075 2970026789 Bacteria 6785236
446 2970039986 2970033650 Bacteria 7118744
447 2970042397 2970040964 Bacteria 6731123
448 2970051866 2970047711 Bacteria 7088379
449 2970058258 2970054988 Bacteria 6611507
450 2970066389 2970061556 Bacteria 7099761
451 2970072449 2970068827 Bacteria 7123112
452 2970076654 2970076120 Bacteria 6697332
453 2970088011 2970082768 Bacteria 6183754
454 2970091674 2970088815 Bacteria 6933825
455 2970102513 2970095765 Bacteria 6936963
456 2970106160 2970102677 Bacteria 6812532
457 2970113523 2970109326 Bacteria 6863976
458 2970116966 2970116247 Bacteria 6501857
459 2970127956 2970122695 Bacteria 6625855
460 2970131224 2970129317 Bacteria 6806560
461 2970139669 2970136068 Bacteria 7207982
462 2970148885 2970143518 Bacteria 6446480
463 2970153631 2970149975 Bacteria 6779706
464 2970164088 2970156795 Bacteria 7168044
465 2970169650 2970164137 Bacteria 6861252
466 2970173736 2970170962 Bacteria 6876229
467 2970179030 2970177841 Bacteria 6768001
468 2970187821 2970184632 Bacteria 7054431
469 2970194871 2970191845 Bacteria 7032787
470 2977521905 2977516862 Bacteria 6940108
471 2977528371 2977523885 Bacteria 6960446
472 2977531016 2977530762 Bacteria 6951399
473 2977538590 2977537788 Bacteria 6929320
474 2977548665 2977544691 Bacteria 6875412
475 2977554189 2977551784 Bacteria 7125765
476 2977561292 2977558990 Bacteria 6863948
477 2977569995 2977565890 Bacteria 6901543
478 2977577532 2977572785 Bacteria 6763888
479 2977584048 2977579622 Bacteria 6772100
480 2978970939 2978969890 Bacteria 5400756
481 2979090279 2979089926 Bacteria 5670289
482 2979095808 2979095461 Bacteria 5669583
483 2979102738 2979100975 Bacteria 5423623
484 2984509374 2984509177 Bacteria 5274802
485 2984519927 2984518228 Bacteria 5277463
486 2984537706 2984537506 Bacteria 5277481
487 2984588047 2984587000 Bacteria 5263363
488 2984604451 2984601300 Bacteria 5455244
489 2989771974 2989771324 Bacteria 5605128
490 2989780527 2989776772 Bacteria 4843317
491 2995394709 2995392953 Bacteria 4539380
492 3000021166 3000017691 Bacteria 3772574
493 3003935455 3003930520 Bacteria 5667563
494 643592368 643348564 Bacteria 8839022
495 643827885 643692032 Bacteria 6891900
496 648736699 648276728 Bacteria 6968865
497 650844093 650716007 Bacteria 5573770
498 8003573283 8003570095 Bacteria 5747666
499 8003995826 8003992118 Bacteria 7266902
500 8004003586 8003999396 Bacteria 7063185
501 8005250315 8005246636 Bacteria 4933972
502 8005662546 8005658619 Bacteria 4500593
503 8018150966 8018150411 Bacteria 5549903
504 8045868041 8045864390 Bacteria 5043873
505 8049296730 8049293176 Bacteria 6128433
506 8054465422 8054460903 Bacteria 4872905
507 8055433876 8055431914 Bacteria 4551896
508 JGI25159J45721_1000015
509 JGI25151J46595_10014369
510 JGI25151J46595_10036865
511 JGI25160J50197_1000003
512 JGI25161J50226_1010749
513 Ga0006562J51391_1025412
514 Ga0055526_1000639
515 Ga0055524_1009869
516 Ga0055536_1002504
517 Ga0055530_10016286
518 Ga0055530_10024331
519 Ga0055540_1016226
520 Ga0055531_10011659
521 Ga0055531_10023196
522 Ga0058692_1002395
523 Ga0058692_1006334
524 Ga0058692_1009689
525 Ga0055543_1000223
526 Ga0065165_1000025
527 Ga0065165_1003404
528 Ga0070665_100017919
529 Ga0070665_100532773
530 Ga0081455_10182131
531 Ga0075368_10024199
532 Ga0075363_100194610
533 Ga0075364_10000024
534 Ga0075364_10000126
535 Ga0075364_10005078
536 Ga0075362_10048384
537 Ga0075369_10021244
538 Ga0075366_10014039
539 Ga0079104_1000563
540 Ga0079104_1000993
541 Ga0099826_10000151
542 Ga0099826_10077051
543 Ga0099794_10005691
544 Ga0105243_10004159
545 Ga0157373_10050586
546 Ga0157373_10052862
547 Ga0157371_10000005
548 Ga0157371_10002763
549 Ga0157370_10000036
550 Ga0157369_10115946
551 Ga0171463_1001
552 Ga0183363_1135
553 Ga0214544_1002513
554 Ga0214542_1000029
555 Ga0214543_1000040
556 Ga0214543_1000049
557 Ga0213872_10086812
558 Ga0213875_10004084
559 Ga0228711_1000013
560 Ga0228710_1000008
561 Ga0209565_1023313
562 Ga0209130_1000005
563 Ga0209676_1001942
564 Ga0209025_1000105
565 Ga0209025_1000478
566 Ga0209564_1000217
567 Ga0209758_1001220
568 Ga0209050_1000773
569 Ga0209256_1000027
570 Ga0209256_1001301
571 Ga0207426_1000015
572 Ga0209051_1001459
573 Ga0209051_1008214
574 Ga0209257_1002498
575 Ga0209257_1003036
576 Ga0207681_10106149
577 Ga0207709_10022053
578 Ga0209281_1000032
579 Ga0209281_1000134
580 Ga0209281_1000319
581 Ga0209371_1000003
582 Ga0209371_1006839
583 Ga0209282_1000029
584 Ga0209282_1000339
585 Ga0209282_1071066
586 Ga0209813_10088492
587 Ga0268266_10013966
588 Ga0268266_10461738
589 Ga0265319_1023451
590 Ga0265334_10027991
591 Ga0265323_10003830
592 Ga0265336_10000362
593 Ga0265338_10001385
594 Ga0268256_1000004
595 Ga0268256_1005821
596 Ga0268256_1007016
597 Ga0307408_100264992
598 Ga0307405_10221940
599 Ga0315914_1000021
600 Ga0307411_10195071
601 Ga0315913_1000014
602 Ga0315915_1000003
603 Ga0395899_0000044
604 Ga0395900_0000042
605 Ga0395898_0000080
606 Ga0395905_0000044
607 Ga0436364_1189831
608 Ga0395901_0000027
609 Ga0400484_32435
610 Ga0400490_38094
611 Ga0400488_31474
612 Ga0400488_51429
613 Ga0400483_247668
614 Ga0400487_13197
615 Ga0400487_42531
616 Ga0436361_0515516
617 Ga0439436_0004755
618 Ga0439465_0012896
619 Ga0466960_0060278
620 Ga0451576_0029552
621 Ga0495588_0001539
622 Ga0495681_0003093
623 Ga0496113_0043474
624 Ga0496116_0000026
625 Ga0496116_0049343
626 Ga0496116_0081122
627 Ga0496117_0000030
628 Ga0496117_0024986
629 Ga0496117_0036202
630 Ga0496118_0040388
631 Ga0496118_0052432
632 Ga0496119_0030142
633 Ga0496119_0042728
634 Ga0496120_0000148
635 Ga0496121_0000005
636 Ga0496121_0000337
637 Ga0496122_0000050
638 Ga0496122_0000172
639 Ga0496122_0006423
640 Ga0496122_0040255
641 Ga0496122_0052093
642 Ga0496123_0000023
643 Ga0496123_0000132
644 Ga0496124_0000091
645 Ga0496124_0007933
646 Ga0496124_0128092
647 Ga0496125_0000107
648 Ga0496125_0025520
649 Ga0496125_0054214
650 Ga0496126_0000069
651 Ga0501238_002793
652 nmdc:mga03683_11389_c1
653 nmdc:mga03n38_19375_c1
654 nmdc:mga00v17_168_c1
655 nmdc:mga00v17_29377_c1
656 nmdc:mga00v17_36_c1
657 nmdc:mga00v17_755_c1
658 nmdc:mga0yw44_1184_c1
659 nmdc:mga0k408_13892_c1
660 nmdc:mga0sz30_16163_c1
661 nmdc:mga0sz30_74_c1
662 Ga0500572_001498
663 Ga0500618_000244
664 Ga0500573_0024322
665 Ga0500616_0000771
666 Ga0500624_000609
667 Ga0500634_0024557
668 Ga0500634_0081711
669 Ga0500636_0000009
670 Ga0500636_0000262
671 2515607383
672 2509108917
673 2509375361
674 2510307296
675 2510842178
676 2511172366
677 2511498963
678 2512535092
679 2512973084
680 2513586178
681 2513604334
682 2513616180
683 2513718996
684 2513882667
685 2513906467
686 2513925642
687 2513983146
688 2514008151
689 2516204669
690 2516895238
691 2517571915
692 2524450878
693 2535486671
694 2537873158
695 2551679912
696 2551683733
697 2551693780
698 2551703318
699 2551708648
700 2551722923
701 2551726595
702 2551735358
703 2551743505
704 2554244507
705 2558866451
706 2559297650
707 2561467833
708 2585993738
709 2586004587
710 2599332461
711 2599336405
712 2599418659
713 2599606600
714 2599722770
715 2600194957
716 2601612444
717 2601748985
718 2643805930
719 2643813448
720 2643853843
721 2643917522
722 2644066106
723 2644103651
724 2644144530
725 2644299415
726 2644306581
727 2644330771
728 2644377190
729 2644417437
730 2644450833
731 2644495469
732 2644522696
733 2644542423
734 2644612192
735 2644657643
736 2644671615
737 2644692744
738 2657682894
739 2692317625
740 2738944695
741 2753358094
742 2753459828
743 2757572253
744 2758639128
745 2776910363
746 2792583228
747 2792621090
748 2792625304
749 2792637734
750 2793283549
751 2802718651
752 2802724332
753 2802730006
754 2802737349
755 2802742265
756 2802748948
757 2804754113
758 2808989160
759 2819243988
760 2819557698
761 2819687905
762 2821129669
763 2838037651
764 2838075002
765 2838662400
766 2838662658
767 2838679918
768 2838717715
769 2838724489
770 2838729569
771 2841850007
772 2841861205
773 2842128479
774 2842134600
775 2842156568
776 2842173960
777 2842180189
778 2842192188
779 2842216532
780 2842229224
781 2842518528
782 2842922730
783 2842927479
784 2844170073
785 2847421395
786 2848996180
787 2850079573
788 2854681322
789 2854898981
790 2854899784
791 2854916343
792 2854920996
793 2855827876
794 2855843244
795 2855875270
796 2857536019
797 2858802972
798 2889792021
799 2889918350
800 2891051649
801 2894817632
802 2896384714
803 2899278919
804 2899793111
805 2899808418
806 2899849686
807 2913298294
808 2913309316
809 2915652764
810 2915986576
811 2915989409
812 2915995949
813 2916004882
814 2916008285
815 2916015038
816 2916026161
817 2916032805
818 2916038317
819 2916044568
820 2916054753
821 2916057143
822 2916065908
823 2916071840
824 2916079644
825 2919117996
826 2919168318
827 2919174042
828 2920763744
829 2920822968
830 2921204041
831 2921208931
832 2921242239
833 2921249832
834 2921254893
835 2921259954
836 2921267342
837 2921287418
838 2921292158
839 2921301284
840 2924146166
841 2924157320
842 2924164568
843 2924166528
844 2924179567
845 2924180750
846 2924190975
847 2924200264
848 2924202583
849 2924209488
850 2924215460
851 2924227029
852 2924230115
853 2926757763
854 2926764612
855 2929143504
856 2933010378
857 2933014154
858 2933597247
859 2936998630
860 2937006348
861 2937011706
862 2937018412
863 2937023548
864 2937033593
865 2937040372
866 2937047677
867 2937051713
868 2937061856
869 2937069937
870 2937072897
871 2937082682
872 2937089488
873 2937093874
874 2937104544
875 2937108309
876 2937116358
877 2937121897
878 2937129645
879 2941501075
880 2957377882
881 2957384357
882 2957393205
883 2957402219
884 2957403476
885 2957413497
886 2957417328
887 2957426542
888 2957434648
889 2957443821
890 2957446848
891 2957452850
892 2957458948
893 2957467190
894 2957474661
895 2957481248
896 2957486702
897 2957493805
898 2957503053
899 2957510231
900 2960585562
901 2960593285
902 2960598028
903 2960604426
904 2960613725
905 2960620376
906 2960626228
907 2960637071
908 2960642525
909 2960650924
910 2960654613
911 2960660755
912 2960670199
913 2960676777
914 2960685227
915 2960689659
916 2960697396
917 2964611536
918 2964618253
919 2964626590
920 2964634115
921 2964641439
922 2964644986
923 2964649971
924 2964659505
925 2964670323
926 2964672757
927 2964678445
928 2964685322
929 2964696277
930 2964699503
931 2964708191
932 2964713869
933 2964723294
934 2967668442
935 2967676387
936 2967682162
937 2967689937
938 2967695307
939 2967700579
940 2967709930
941 2967717869
942 2967723643
943 2967732808
944 2967740624
945 2967745052
946 2967749571
947 2967757321
948 2967768700
949 2967771384
950 2967777971
951 2970023069
952 2970031075
953 2970039986
954 2970042397
955 2970051866
956 2970058258
957 2970066389
958 2970072449
959 2970076654
960 2970088011
961 2970091674
962 2970102513
963 2970106160
964 2970113523
965 2970116966
966 2970127956
967 2970131224
968 2970139669
969 2970148885
970 2970153631
971 2970164088
972 2970169650
973 2970173736
974 2970179030
975 2970187821
976 2970194871
977 2977521905
978 2977528371
979 2977531016
980 2977538590
981 2977548665
982 2977554189
983 2977561292
984 2977569995
985 2977577532
986 2977584048
987 2978970939
988 2979090279
989 2979095808
990 2979102738
991 2984509374
992 2984519927
993 2984537706
994 2984588047
995 2984604451
996 2989771974
997 2989780527
998 2995394709
999 3000021166
1000 3003935455
1001 643592368
1002 643827885
1003 648736699
1004 650844093
1005 8003573283
1006 8003995826
1007 8004003586
1008 8005250315
1009 8005662546
1010 8018150966
1011 8045868041
1012 8049296730
1013 8054465422
1014 8055433876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

91

353

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.9627 2 289
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.9189 2 289
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8079 2 292
5hmq-assembly3.cif.gz_E xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.7757 2 295
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.7728 1 267
ID Description Score Start End Superfamily
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.957 2 289 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9128 2 289 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7937 3 292 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7496 3 292 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7454 3 295 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A4V4HKN9-F1-model_v4 deleted 0.997 1 297
AF-Q9ACA7-F1-model_v4 Mannityl opine catabolism protein MocC-like protein 0.9963 96 270
AF-A0A3B0TA09-F1-model_v4 Inosose dehydratase (EC 4.2.1.44) 0.995 1 228 GO:0050114
AF-A0A255XT99-F1-model_v4 Myo-inosose-2 dehydratase 0.994 2 297
AF-A0A4V4HKN9-F1-model_v4 deleted 0.9903 1 297

Map