F456934

General Info

Members Datasets Scaffolds Average Seq Length
509 186 506 257

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10057054|Ga0070709_100570542
Length 292
Sequence LEGRRCETEPLSGASRHLLAAEKEKLAQVSMEPCLKQIQPNPASADVETSTLRLPRHVAIVMDGNGRWARQRHRPRSFGHRAGQKSVRAAIEFCLRQGIEALTLFAFSSENWQRPPGEVGALMTLFLKALDREVDELHGHGVCIRFVGELAAFAPALRARMTQAMEQTAGNAKLALNIAVNYGGRWDIANAARLAAQACERGALASDTIDEATLAPYFALADRPPVDLFIRTGGEQRISNFLLWQLAYSEFVFSNVLWPDFDPECLRQAVEEFSRRERRFGKTSAQVAVPGR

Samples

Sample ID Description Type Environment
1 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
2 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
3 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 2.16
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 0.79
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001906 3300001915 Bacteria 5643
2 JGI24741J21665_1001955 3300001915 Bacteria 5557
3 JGI24741J21665_1005057 3300001915 Bacteria 2820
4 JGI24740J21852_10000295 3300001979 Bacteria 21265
5 JGI24740J21852_10000728 3300001979 Bacteria 14334
6 JGI24740J21852_10023630 3300001979 Bacteria 2097
7 JGI24738J21930_10010626 3300002075 Bacteria 2043
8 Ga0070658_10011453 3300005327 Bacteria 7113
9 Ga0070658_10042211 3300005327 Bacteria 3682
10 Ga0070658_10084922 3300005327 Bacteria 2603
11 Ga0070658_10295285 3300005327 Bacteria 1381
12 Ga0070658_10388756 3300005327 Bacteria 1197
13 Ga0070683_100026852 3300005329 Bacteria 5189
14 Ga0070683_100049159 3300005329 Bacteria 3900
15 Ga0070666_10066942 3300005335 Bacteria 2439
16 Ga0070666_10113759 3300005335 Bacteria 1873
17 Ga0070680_100000287 3300005336 Bacteria 33654
18 Ga0070680_100015090 3300005336 Bacteria 6049
19 Ga0070680_100015861 3300005336 Bacteria 5914
20 Ga0070680_100017738 3300005336 Bacteria 5615
21 Ga0070680_100047927 3300005336 Bacteria 3481
22 Ga0070680_100060013 3300005336 Bacteria 3113
23 Ga0070682_100001082 3300005337 Bacteria 15696
24 Ga0068868_100138097 3300005338 Bacteria 1999
25 Ga0068868_100188379 3300005338 Bacteria 1715
26 Ga0070660_100036003 3300005339 Bacteria 3747
27 Ga0070660_100069290 3300005339 Bacteria 2750
28 Ga0070660_100087615 3300005339 Bacteria 2450
29 Ga0070660_100436326 3300005339 Bacteria 1085
30 Ga0070691_10006128 3300005341 Bacteria 5488
31 Ga0070691_10015643 3300005341 Bacteria 3485
32 Ga0070691_10028351 3300005341 Bacteria 2615
33 Ga0070661_100007789 3300005344 Bacteria 7393
34 Ga0070661_100028532 3300005344 Bacteria 4025
35 Ga0070661_100047389 3300005344 Bacteria 3145
36 Ga0070661_100087884 3300005344 Bacteria 2300
37 Ga0070692_10000184 3300005345 Bacteria 16448
38 Ga0070692_10007662 3300005345 Bacteria 4771
39 Ga0070692_10012796 3300005345 Bacteria 3897
40 Ga0070692_10127703 3300005345 Bacteria 1425
41 Ga0070668_100227182 3300005347 Bacteria 1542
42 Ga0070671_100289769 3300005355 Bacteria 1393
43 Ga0070671_100421256 3300005355 Bacteria 1143
44 Ga0070674_100248750 3300005356 Bacteria 1395
45 Ga0070673_100134827 3300005364 Bacteria 2077
46 Ga0070659_100028956 3300005366 Bacteria 4278
47 Ga0070659_100256860 3300005366 Bacteria 1449
48 Ga0070667_100243846 3300005367 Bacteria 1605
49 Ga0070667_100262531 3300005367 Bacteria 1547
50 Ga0070709_10057054 3300005434 Bacteria 2472
51 Ga0070663_100013775 3300005455 Bacteria 5171
52 Ga0070663_100066318 3300005455 Bacteria 2615
53 Ga0070663_100069220 3300005455 Bacteria 2563
54 Ga0070663_100078765 3300005455 Bacteria 2416
55 Ga0070663_100200167 3300005455 Bacteria 1558
56 Ga0070663_100516485 3300005455 Bacteria 994
57 Ga0070681_10000007 3300005458 Bacteria 159821
58 Ga0070681_10000613 3300005458 Bacteria 29320
59 Ga0070681_10013522 3300005458 Bacteria 8115
60 Ga0070681_10017502 3300005458 Bacteria 7163
61 Ga0070681_10106145 3300005458 Bacteria 2750
62 Ga0070681_10108129 3300005458 Bacteria 2721
63 Ga0068867_100092080 3300005459 Bacteria 2302
64 Ga0070706_100146432 3300005467 Bacteria 2205
65 Ga0070679_100000184 3300005530 Bacteria 50485
66 Ga0070679_100000311 3300005530 Bacteria 41294
67 Ga0070679_100000533 3300005530 Bacteria 32374
68 Ga0070679_100074702 3300005530 Bacteria 3380
69 Ga0070684_100016864 3300005535 Bacteria 5982
70 Ga0070684_100024205 3300005535 Bacteria 5090
71 Ga0068853_100013956 3300005539 Bacteria 6570
72 Ga0068853_100143473 3300005539 Bacteria 2145
73 Ga0068853_100315867 3300005539 Bacteria 1447
74 Ga0068853_100325551 3300005539 Bacteria 1425
75 Ga0070696_100007448 3300005546 Bacteria 7320
76 Ga0070696_100024305 3300005546 Bacteria 4118
77 Ga0070696_100028573 3300005546 Bacteria 3806
78 Ga0070696_100076306 3300005546 Bacteria 2366
79 Ga0070693_100121699 3300005547 Bacteria 1619
80 Ga0070665_100000326 3300005548 Bacteria 73416
81 Ga0070665_100049140 3300005548 Bacteria 4232
82 Ga0070665_100149033 3300005548 Bacteria 2342
83 Ga0070665_100273339 3300005548 Bacteria 1691
84 Ga0070665_100563378 3300005548 Bacteria 1152
85 Ga0068855_100003226 3300005563 Bacteria 19961
86 Ga0068855_100140792 3300005563 Bacteria 2750
87 Ga0068855_100198415 3300005563 Bacteria 2260
88 Ga0068855_100357011 3300005563 Bacteria 1609
89 Ga0068855_100439268 3300005563 Bacteria 1425
90 Ga0068855_100481752 3300005563 Bacteria 1350
91 Ga0068855_100733402 3300005563 Bacteria 1055
92 Ga0070664_100014611 3300005564 Bacteria 6408
93 Ga0070664_100131397 3300005564 Bacteria 2199
94 Ga0068857_100026704 3300005577 Bacteria 5089
95 Ga0068857_100096117 3300005577 Bacteria 2655
96 Ga0068857_100110683 3300005577 Bacteria 2468
97 Ga0068857_100196739 3300005577 Bacteria 1837
98 Ga0068854_100017935 3300005578 Bacteria 4744
99 Ga0068854_100092886 3300005578 Bacteria 2248
100 Ga0068854_100129770 3300005578 Bacteria 1923
101 Ga0068856_100037190 3300005614 Bacteria 4775
102 Ga0068856_100083777 3300005614 Bacteria 3167
103 Ga0068856_100109229 3300005614 Bacteria 2762
104 Ga0068856_100196384 3300005614 Bacteria 2032
105 Ga0068852_100029005 3300005616 Bacteria 4539
106 Ga0068852_100035978 3300005616 Bacteria 4138
107 Ga0068852_100045436 3300005616 Bacteria 3735
108 Ga0068852_100062170 3300005616 Bacteria 3247
109 Ga0068852_100119858 3300005616 Bacteria 2406
110 Ga0068859_100161617 3300005617 Bacteria 2319
111 Ga0068864_100028625 3300005618 Bacteria 4712
112 Ga0068851_10001007 3300005834 Bacteria 12219
113 Ga0068851_10005832 3300005834 Bacteria 5610
114 Ga0068851_10140032 3300005834 Bacteria 1315
115 Ga0068870_10161746 3300005840 Bacteria 1328
116 Ga0068863_100027570 3300005841 Bacteria 5419
117 Ga0068858_100006626 3300005842 Bacteria 11268
118 Ga0068860_100006934 3300005843 Bacteria 11354
119 Ga0068860_100029665 3300005843 Bacteria 5262
120 Ga0068862_100144921 3300005844 Bacteria 2110
121 Ga0081540_1002968 3300005983 Bacteria 13595
122 Ga0075365_10000021 3300006038 Bacteria 64483
123 Ga0097621_100086822 3300006237 Bacteria 2612
124 Ga0075370_10086382 3300006353 Bacteria 1807
125 Ga0068871_100238659 3300006358 Bacteria 1580
126 Ga0068865_100046280 3300006881 Bacteria 2985
127 Ga0068865_100148533 3300006881 Bacteria 1775
128 Ga0097620_100161620 3300006931 Bacteria 2319
129 Ga0105240_10030045 3300009093 Bacteria 7068
130 Ga0105240_10084512 3300009093 Bacteria 3891
131 Ga0105240_10087403 3300009093 Bacteria 3818
132 Ga0105240_10104128 3300009093 Bacteria 3446
133 Ga0105240_10197466 3300009093 Bacteria 2360
134 Ga0105245_10564899 3300009098 Bacteria 1161
135 Ga0105241_10001442 3300009174 Bacteria 18219
136 Ga0105241_10002081 3300009174 Bacteria 15108
137 Ga0105241_10008562 3300009174 Bacteria 7520
138 Ga0105241_10534908 3300009174 Bacteria 1050
139 Ga0105248_10142525 3300009177 Bacteria 2703
140 Ga0105237_10002311 3300009545 Bacteria 23700
141 Ga0105237_10101666 3300009545 Bacteria 2866
142 Ga0105237_10177313 3300009545 Bacteria 2131
143 Ga0105237_10444507 3300009545 Bacteria 1302
144 Ga0105238_10003551 3300009551 Bacteria 15548
145 Ga0105238_10005242 3300009551 Bacteria 12814
146 Ga0105238_10008598 3300009551 Bacteria 10215
147 Ga0105238_10016572 3300009551 Bacteria 7461
148 Ga0105238_10126133 3300009551 Bacteria 2538
149 Ga0105249_10011914 3300009553 Bacteria 7646
150 Ga0105239_10018213 3300010375 Bacteria 7764
151 Ga0105239_10019864 3300010375 Bacteria 7415
152 Ga0105239_10030082 3300010375 Bacteria 5971
153 Ga0157373_10014908 3300013100 Bacteria 5692
154 Ga0157373_10049347 3300013100 Bacteria 2999
155 Ga0157371_10004042 3300013102 Bacteria 12973
156 Ga0157371_10028310 3300013102 Bacteria 4058
157 Ga0157371_10030154 3300013102 Bacteria 3914
158 Ga0157371_10153253 3300013102 Bacteria 1644
159 Ga0157370_10001400 3300013104 Bacteria 29908
160 Ga0157370_10040232 3300013104 Bacteria 4513
161 Ga0157370_10077835 3300013104 Bacteria 3123
162 Ga0157370_10124020 3300013104 Bacteria 2412
163 Ga0157370_10566773 3300013104 Bacteria 1041
164 Ga0157369_10000086 3300013105 Bacteria 128515
165 Ga0157369_10001294 3300013105 Bacteria 31084
166 Ga0157369_10011967 3300013105 Bacteria 9856
167 Ga0157369_10022515 3300013105 Bacteria 7029
168 Ga0157369_10029363 3300013105 Bacteria 6076
169 Ga0157369_10042514 3300013105 Bacteria 4957
170 Ga0157369_10160432 3300013105 Bacteria 2374
171 Ga0157374_10032236 3300013296 Bacteria 4769
172 Ga0157374_10094394 3300013296 Bacteria 2859
173 Ga0157378_10000619 3300013297 Bacteria 33473
174 Ga0157378_10082662 3300013297 Bacteria 2904
175 Ga0163162_10000021 3300013306 Bacteria 214873
176 Ga0157372_10002348 3300013307 Bacteria 20470
177 Ga0157372_10004810 3300013307 Bacteria 14353
178 Ga0157372_10013783 3300013307 Bacteria 8639
179 Ga0157372_10032875 3300013307 Bacteria 5692
180 Ga0157372_10050517 3300013307 Bacteria 4625
181 Ga0157372_10051737 3300013307 Bacteria 4572
182 Ga0157372_10069072 3300013307 Bacteria 3974
183 Ga0157372_10132309 3300013307 Bacteria 2871
184 Ga0157372_10308605 3300013307 Bacteria 1841
185 Ga0157372_10599330 3300013307 Bacteria 1284
186 Ga0157375_10644636 3300013308 Bacteria 1216
187 Ga0163163_10004231 3300014325 Bacteria 12233
188 Ga0182008_10000262 3300014497 Bacteria 41194
189 Ga0157379_10010562 3300014968 Bacteria 8051
190 Ga0157376_10001452 3300014969 Bacteria 15614
191 Ga0157376_10025766 3300014969 Bacteria 4636
192 Ga0157376_10102992 3300014969 Bacteria 2498
193 Ga0157376_10227438 3300014969 Bacteria 1731
194 Ga0157376_10354149 3300014969 Bacteria 1406
195 Ga0157376_10619777 3300014969 Bacteria 1079
196 Ga0182006_1001047 3300015261 Bacteria 17867
197 Ga0182007_10018645 3300015262 Bacteria 2510
198 Ga0182005_1000777 3300015265 Bacteria 14507
199 Ga0182005_1002340 3300015265 Bacteria 6844
200 Ga0197907_10066863 3300020069 Bacteria 1805
201 Ga0197907_11283620 3300020069 Bacteria 1213
202 Ga0206356_10374221 3300020070 Bacteria 4806
203 Ga0206356_11811416 3300020070 Bacteria 2845
204 Ga0206352_10796229 3300020078 Bacteria 2375
205 Ga0206354_10157811 3300020081 Bacteria 1881
206 Ga0206354_10571241 3300020081 Bacteria 6374
207 Ga0206354_10759747 3300020081 Bacteria 2020
208 Ga0206353_10447243 3300020082 Bacteria 2023
209 Ga0206353_10732906 3300020082 Bacteria 7015
210 Ga0206353_11439705 3300020082 Bacteria 1988
211 Ga0213875_10000542 3300021388 Bacteria 30939
212 Ga0207656_10001911 3300025321 Bacteria 6931
213 Ga0207656_10008490 3300025321 Bacteria 3783
214 Ga0207656_10018614 3300025321 Bacteria 2737
215 Ga0207656_10020902 3300025321 Bacteria 2607
216 Ga0207680_10000109 3300025903 Bacteria 37453
217 Ga0207680_10152762 3300025903 Bacteria 1540
218 Ga0207647_10000858 3300025904 Bacteria 23572
219 Ga0207647_10001297 3300025904 Bacteria 19234
220 Ga0207647_10004858 3300025904 Bacteria 9939
221 Ga0207647_10048500 3300025904 Bacteria 2637
222 Ga0207643_10157922 3300025908 Bacteria 1363
223 Ga0207705_10001251 3300025909 Bacteria 20431
224 Ga0207705_10001521 3300025909 Bacteria 18403
225 Ga0207705_10001662 3300025909 Bacteria 17678
226 Ga0207705_10001681 3300025909 Bacteria 17606
227 Ga0207705_10014582 3300025909 Bacteria 5655
228 Ga0207705_10037248 3300025909 Bacteria 3480
229 Ga0207705_10054134 3300025909 Bacteria 2892
230 Ga0207705_10090172 3300025909 Bacteria 2244
231 Ga0207654_10000065 3300025911 Bacteria 69237
232 Ga0207654_10013861 3300025911 Bacteria 4154
233 Ga0207654_10016049 3300025911 Bacteria 3895
234 Ga0207654_10029426 3300025911 Bacteria 3007
235 Ga0207654_10040769 3300025911 Bacteria 2618
236 Ga0207707_10000058 3300025912 Bacteria 111904
237 Ga0207707_10000070 3300025912 Bacteria 103288
238 Ga0207707_10000167 3300025912 Bacteria 69037
239 Ga0207707_10000274 3300025912 Bacteria 55548
240 Ga0207707_10000296 3300025912 Bacteria 53027
241 Ga0207707_10001746 3300025912 Bacteria 19970
242 Ga0207707_10014086 3300025912 Bacteria 6971
243 Ga0207707_10104754 3300025912 Bacteria 2472
244 Ga0207695_10000864 3300025913 Bacteria 55428
245 Ga0207695_10003863 3300025913 Bacteria 20735
246 Ga0207695_10004260 3300025913 Bacteria 19645
247 Ga0207695_10007210 3300025913 Bacteria 14213
248 Ga0207695_10024897 3300025913 Bacteria 6718
249 Ga0207695_10025236 3300025913 Bacteria 6659
250 Ga0207695_10048628 3300025913 Bacteria 4478
251 Ga0207671_10002473 3300025914 Bacteria 19740
252 Ga0207671_10006597 3300025914 Bacteria 10302
253 Ga0207671_10020985 3300025914 Bacteria 4965
254 Ga0207671_10036641 3300025914 Bacteria 3638
255 Ga0207671_10141225 3300025914 Bacteria 1855
256 Ga0207660_10000278 3300025917 Bacteria 33836
257 Ga0207660_10001582 3300025917 Bacteria 15270
258 Ga0207660_10005619 3300025917 Bacteria 8143
259 Ga0207660_10021800 3300025917 Bacteria 4311
260 Ga0207660_10023533 3300025917 Bacteria 4161
261 Ga0207660_10024897 3300025917 Bacteria 4056
262 Ga0207660_10034347 3300025917 Bacteria 3514
263 Ga0207660_10099887 3300025917 Bacteria 2166
264 Ga0207657_10000612 3300025919 Bacteria 37848
265 Ga0207657_10025099 3300025919 Bacteria 5504
266 Ga0207657_10029361 3300025919 Bacteria 5006
267 Ga0207657_10029458 3300025919 Bacteria 4997
268 Ga0207657_10051744 3300025919 Bacteria 3569
269 Ga0207657_10052154 3300025919 Bacteria 3552
270 Ga0207649_10001908 3300025920 Bacteria 11900
271 Ga0207649_10003964 3300025920 Bacteria 8071
272 Ga0207649_10006809 3300025920 Bacteria 6209
273 Ga0207649_10008698 3300025920 Bacteria 5542
274 Ga0207649_10038480 3300025920 Bacteria 2896
275 Ga0207652_10000078 3300025921 Bacteria 106265
276 Ga0207652_10000209 3300025921 Bacteria 61861
277 Ga0207652_10000552 3300025921 Bacteria 37934
278 Ga0207652_10001361 3300025921 Bacteria 21745
279 Ga0207652_10001550 3300025921 Bacteria 20252
280 Ga0207652_10001758 3300025921 Bacteria 18921
281 Ga0207652_10054422 3300025921 Bacteria 3440
282 Ga0207694_10006422 3300025924 Bacteria 8959
283 Ga0207694_10013104 3300025924 Bacteria 6243
284 Ga0207694_10075470 3300025924 Bacteria 2639
285 Ga0207694_10092905 3300025924 Bacteria 2382
286 Ga0207694_10194108 3300025924 Bacteria 1650
287 Ga0207650_10005058 3300025925 Bacteria 8997
288 Ga0207650_10565413 3300025925 Bacteria 954
289 Ga0207650_10592007 3300025925 Bacteria 932
290 Ga0207687_10158411 3300025927 Bacteria 1735
291 Ga0207644_10236668 3300025931 Bacteria 1453
292 Ga0207690_10000371 3300025932 Bacteria 29794
293 Ga0207690_10007382 3300025932 Bacteria 6526
294 Ga0207706_10014188 3300025933 Bacteria 7222
295 Ga0207704_10023471 3300025938 Bacteria 3325
296 Ga0207691_10006050 3300025940 Bacteria 11684
297 Ga0207691_10101139 3300025940 Bacteria 2572
298 Ga0207689_10012766 3300025942 Bacteria 7178
299 Ga0207689_10070361 3300025942 Bacteria 2874
300 Ga0207661_10001380 3300025944 Bacteria 16307
301 Ga0207661_10005991 3300025944 Bacteria 8586
302 Ga0207661_10014565 3300025944 Bacteria 5768
303 Ga0207661_10052462 3300025944 Bacteria 3258
304 Ga0207679_10307212 3300025945 Bacteria 1369
305 Ga0207667_10000740 3300025949 Bacteria 42529
306 Ga0207667_10000932 3300025949 Bacteria 37335
307 Ga0207667_10002142 3300025949 Bacteria 24749
308 Ga0207667_10002819 3300025949 Bacteria 21554
309 Ga0207667_10037260 3300025949 Bacteria 5200
310 Ga0207667_10042509 3300025949 Bacteria 4829
311 Ga0207667_10280527 3300025949 Bacteria 1702
312 Ga0207667_10557951 3300025949 Bacteria 1158
313 Ga0207651_10105012 3300025960 Bacteria 2106
314 Ga0207651_10355840 3300025960 Bacteria 1234
315 Ga0207712_10000340 3300025961 Bacteria 42379
316 Ga0207712_10030582 3300025961 Bacteria 3621
317 Ga0207668_10143897 3300025972 Bacteria 1837
318 Ga0207640_10000264 3300025981 Bacteria 35237
319 Ga0207640_10001219 3300025981 Bacteria 14015
320 Ga0207640_10001768 3300025981 Bacteria 11602
321 Ga0207640_10015465 3300025981 Bacteria 4417
322 Ga0207640_10024172 3300025981 Bacteria 3662
323 Ga0207658_10066618 3300025986 Bacteria 2709
324 Ga0207658_10179315 3300025986 Bacteria 1752
325 Ga0207658_10253444 3300025986 Bacteria 1496
326 Ga0207677_10096480 3300026023 Bacteria 2163
327 Ga0207677_10130146 3300026023 Bacteria 1909
328 Ga0207703_10004638 3300026035 Bacteria 11229
329 Ga0207703_10134797 3300026035 Bacteria 2137
330 Ga0207639_10000399 3300026041 Bacteria 29931
331 Ga0207639_10001582 3300026041 Bacteria 15289
332 Ga0207639_10002331 3300026041 Bacteria 12745
333 Ga0207639_10004509 3300026041 Bacteria 9389
334 Ga0207639_10026244 3300026041 Bacteria 4232
335 Ga0207639_10112548 3300026041 Bacteria 2221
336 Ga0207639_10425660 3300026041 Bacteria 1201
337 Ga0207678_10019481 3300026067 Bacteria 5961
338 Ga0207678_10024454 3300026067 Bacteria 5275
339 Ga0207678_10025343 3300026067 Bacteria 5177
340 Ga0207678_10083008 3300026067 Bacteria 2741
341 Ga0207678_10096606 3300026067 Bacteria 2525
342 Ga0207678_10104441 3300026067 Bacteria 2418
343 Ga0207678_10157760 3300026067 Bacteria 1938
344 Ga0207678_10664706 3300026067 Bacteria 916
345 Ga0207702_10002775 3300026078 Bacteria 16405
346 Ga0207702_10010206 3300026078 Bacteria 7862
347 Ga0207702_10262946 3300026078 Bacteria 1625
348 Ga0207702_10382153 3300026078 Bacteria 1354
349 Ga0207702_10694811 3300026078 Bacteria 1002
350 Ga0207648_10129238 3300026089 Bacteria 2223
351 Ga0207676_10057651 3300026095 Bacteria 3060
352 Ga0207676_10175849 3300026095 Bacteria 1869
353 Ga0207674_10000973 3300026116 Bacteria 37480
354 Ga0207674_10002862 3300026116 Bacteria 21434
355 Ga0207674_10057744 3300026116 Bacteria 3934
356 Ga0207674_10061173 3300026116 Bacteria 3805
357 Ga0207674_10248902 3300026116 Bacteria 1724
358 Ga0207674_10434335 3300026116 Bacteria 1269
359 Ga0207698_10001013 3300026142 Bacteria 16369
360 Ga0207698_10001297 3300026142 Bacteria 14570
361 Ga0207698_10001673 3300026142 Bacteria 12935
362 Ga0207698_10059215 3300026142 Bacteria 2972
363 Ga0207698_10167973 3300026142 Bacteria 1928
364 Ga0207698_10184105 3300026142 Bacteria 1853
365 Ga0207698_10191991 3300026142 Bacteria 1820
366 Ga0207698_10759274 3300026142 Bacteria 969
367 Ga0268266_10000013 3300028379 Bacteria 649715
368 Ga0268266_10138378 3300028379 Bacteria 2183
369 Ga0268264_10003604 3300028381 Bacteria 13337
370 Ga0268264_10030849 3300028381 Bacteria 4394
371 Ga0307508_10039008 3300031616 Bacteria 4268
372 Ga0307516_10141923 3300031730 Bacteria 2170
373 Ga0307412_10005781 3300031911 Bacteria 6954
374 Ga0307412_10151903 3300031911 Bacteria 1710
375 Ga0395899_0013560 3300037312 Bacteria 6230
376 Ga0395900_0007509 3300037418 Bacteria 11265
377 Ga0395900_0010725 3300037418 Bacteria 9372
378 Ga0395900_0536879 3300037418 Bacteria 1116
379 Ga0395898_0102926 3300037466 Bacteria 2740
380 Ga0395898_0120555 3300037466 Bacteria 2513
381 Ga0436364_1187307 3300037853 Bacteria 22707
382 Ga0395901_0016767 3300038443 Bacteria 7464
383 Ga0439436_0000022 3300041404 Bacteria 60408
384 Ga0451853_0534717 3300041512 Bacteria 1629
385 Ga0451577_0001910 3300042876 Bacteria 26415
386 Ga0451577_0005601 3300042876 Bacteria 12775
387 Ga0451577_0097035 3300042876 Bacteria 2632
388 Ga0451577_0344819 3300042876 Bacteria 1351
389 Ga0453683_0044651 3300044673 Bacteria 2780
390 Ga0453684_0000229 3300044712 Bacteria 241494
391 Ga0453684_0004942 3300044712 Bacteria 27181
392 Ga0453684_0010417 3300044712 Bacteria 15906
393 Ga0453684_0011788 3300044712 Bacteria 14570
394 Ga0453684_0014884 3300044712 Bacteria 12373
395 Ga0453684_0480596 3300044712 Bacteria 1378
396 Ga0466970_0216088 3300044765 Bacteria 1069
397 Ga0451576_0000451 3300045051 Bacteria 93335
398 Ga0451576_0102523 3300045051 Bacteria 2977
399 Ga0495638_0000007 3300046460 Bacteria 602783
400 Ga0495580_0440052 3300046472 Bacteria 875
401 Ga0495606_0041938 3300046507 Bacteria 3065
402 Ga0495610_0000341 3300046512 Bacteria 49154
403 Ga0495645_0451066 3300046543 Bacteria 811
404 Ga0495625_0204885 3300046660 Bacteria 1300
405 Ga0495670_0011482 3300046691 Bacteria 4357
406 Ga0496104_0000016 3300048907 Bacteria 335025
407 Ga0496105_0000035 3300048908 Bacteria 123037
408 Ga0496114_0120787 3300048917 Bacteria 2253
409 Ga0496115_0000746 3300048918 Bacteria 23938
410 Ga0496116_0030788 3300048919 Bacteria 3851
411 Ga0496118_0129518 3300048921 Bacteria 1624
412 Ga0496119_0065405 3300048922 Bacteria 2154
413 Ga0496120_0200649 3300048923 Bacteria 966
414 Ga0496125_0211255 3300048928 Bacteria 1260
415 Ga0496126_0000033 3300048929 Bacteria 368851
416 Ga0496126_0301856 3300048929 Bacteria 1321
417 Ga0501031_0181116 3300049568 Bacteria 1376
418 Ga0501032_0116024 3300049569 Bacteria 1771
419 Ga0501034_0006178 3300049571 Bacteria 12914
420 Ga0501034_0327994 3300049571 Bacteria 1462
421 Ga0501034_0487272 3300049571 Bacteria 1148
422 Ga0501034_0653181 3300049571 Bacteria 953
423 Ga0501036_0121669 3300049572 Bacteria 2204
424 Ga0501036_0129120 3300049572 Bacteria 2134
425 Ga0501036_0405680 3300049572 Bacteria 1137
426 Ga0501037_0138081 3300049573 Bacteria 1745
427 Ga0501037_0272434 3300049573 Bacteria 1181
428 Ga0501037_0337040 3300049573 Bacteria 1042
429 Ga0501038_0010027 3300049574 Bacteria 8677
430 Ga0501039_0510214 3300049575 Bacteria 944
431 Ga0501043_0084851 3300049579 Bacteria 2489
432 Ga0501043_0115077 3300049579 Bacteria 2111
433 Ga0501043_0397549 3300049579 Bacteria 1042
434 Ga0501046_0007603 3300049580 Bacteria 9507
435 Ga0501046_0033164 3300049580 Bacteria 4175
436 Ga0501047_0000349 3300049581 Bacteria 52184
437 Ga0501047_0000442 3300049581 Bacteria 45876
438 Ga0501047_0010758 3300049581 Bacteria 8650
439 Ga0501047_0011035 3300049581 Bacteria 8549
440 Ga0501047_0236328 3300049581 Bacteria 1679
441 Ga0501047_0314796 3300049581 Bacteria 1405
442 Ga0501067_0000269 3300049583 Bacteria 28395
443 Ga0501068_0009983 3300049584 Bacteria 5324
444 Ga0501068_0039107 3300049584 Bacteria 2844
445 Ga0501069_0002152 3300049585 Bacteria 9916
446 Ga0501069_0002562 3300049585 Bacteria 9280
447 Ga0501069_0022100 3300049585 Bacteria 3457
448 Ga0501069_0039876 3300049585 Bacteria 2595
449 Ga0501069_0177994 3300049585 Bacteria 1229
450 Ga0501070_0001603 3300049586 Bacteria 20075
451 Ga0501070_0002554 3300049586 Bacteria 15940
452 Ga0501070_0006863 3300049586 Bacteria 9688
453 Ga0501070_0008525 3300049586 Bacteria 8666
454 Ga0501070_0008703 3300049586 Bacteria 8581
455 Ga0501070_0016621 3300049586 Bacteria 6181
456 Ga0501070_0025817 3300049586 Bacteria 4928
457 Ga0501070_0035738 3300049586 Bacteria 4149
458 Ga0501070_0039522 3300049586 Bacteria 3935
459 Ga0501070_0198383 3300049586 Bacteria 1648
460 Ga0501071_0004059 3300049587 Bacteria 9252
461 Ga0501072_0000955 3300049588 Bacteria 21306
462 Ga0501073_0000424 3300049589 Bacteria 28912
463 Ga0501073_0008259 3300049589 Bacteria 7721
464 Ga0501073_0031213 3300049589 Bacteria 3802
465 Ga0501073_0036445 3300049589 Bacteria 3495
466 Ga0501073_0057716 3300049589 Bacteria 2713
467 Ga0501073_0085252 3300049589 Bacteria 2198
468 Ga0501073_0121341 3300049589 Bacteria 1811
469 Ga0501074_0008658 3300049590 Bacteria 7370
470 Ga0501074_0010754 3300049590 Bacteria 6648
471 Ga0501074_0022348 3300049590 Bacteria 4594
472 Ga0501074_0092896 3300049590 Bacteria 2160
473 Ga0501074_0149595 3300049590 Bacteria 1669
474 Ga0501074_0330940 3300049590 Bacteria 1081
475 Ga0501077_0001230 3300049593 Bacteria 15458
476 Ga0501077_0437299 3300049593 Bacteria 837
477 Ga0501079_0019061 3300049741 Bacteria 5240
478 Ga0501079_0080108 3300049741 Bacteria 2525
479 Ga0501079_0496690 3300049741 Bacteria 959
480 Ga0501080_0000828 3300049742 Bacteria 25266
481 Ga0501080_0002423 3300049742 Bacteria 16279
482 Ga0501080_0004456 3300049742 Bacteria 12463
483 Ga0501080_0027187 3300049742 Bacteria 5320
484 Ga0501080_0034157 3300049742 Bacteria 4746
485 Ga0501080_0047857 3300049742 Bacteria 3981
486 Ga0501080_0129961 3300049742 Bacteria 2331
487 Ga0501083_0003137 3300049744 Bacteria 11496
488 Ga0501035_0063315 3300049822 Bacteria 3290
489 Ga0501035_0089508 3300049822 Bacteria 2711
490 Ga0501035_0610916 3300049822 Bacteria 888
491 Ga0501044_0069319 3300049823 Bacteria 3590
492 Ga0501044_0131069 3300049823 Bacteria 2501
493 Ga0501044_0145696 3300049823 Bacteria 2354
494 Ga0501044_0158915 3300049823 Bacteria 2238
495 Ga0501044_0170762 3300049823 Bacteria 2146
496 Ga0501044_0530928 3300049823 Bacteria 1075
497 nmdc:mga0yw44_13_c1 3300050492 Bacteria 120183
498 nmdc:mga07m45_44240_c1 3300050496 Bacteria 2498
499 Ga0500568_0001038 3300053139 Bacteria 18974
500 Ga0501084_0055020 3300054114 Bacteria 3329
501 Ga0501084_0064768 3300054114 Bacteria 3058
502 Ga0501084_0189300 3300054114 Bacteria 1736
503 Ga0501084_0514946 3300054114 Bacteria 1011
504 Ga0501082_0000356 3300060353 Bacteria 40443
505 Ga0501082_0069998 3300060353 Bacteria 3021
506 Ga0501082_0445869 3300060353 Bacteria 1131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0097035 Ga0451577_0097035_1888_2586 214
2 3300042876 Ga0451577_0001910 Ga0451577_0001910_25692_26393 216
3 3300044712 Ga0453684_0000229 Ga0453684_0000229_215597_216298 216
4 3300045051 Ga0451576_0000451 Ga0451576_0000451_10098_10799 216
5 3300006038 Ga0075365_10000021 Ga0075365_1000002120 230
6 3300006353 Ga0075370_10086382 Ga0075370_100863822 230
7 3300050492 nmdc:mga0yw44_13_c1 nmdc:mga0yw44_13_c1_65777_66478 230
8 3300050496 nmdc:mga07m45_44240_c1 nmdc:mga07m45_44240_c1_716_1417 230
9 3300042876 Ga0451577_0005601 Ga0451577_0005601_1857_2558 231
10 3300044712 Ga0453684_0010417 Ga0453684_0010417_3763_4464 231
11 3300044673 Ga0453683_0044651 Ga0453683_0044651_1793_2494 233
12 3300044712 Ga0453684_0011788 Ga0453684_0011788_3260_3961 233
13 3300045051 Ga0451576_0102523 Ga0451576_0102523_93_794 233
14 3300049593 Ga0501077_0001230 Ga0501077_0001230_5906_6622 233
15 3300005844 Ga0068862_100144921 Ga0068862_1001449213 234
16 3300015262 Ga0182007_10018645 Ga0182007_100186451 236
17 3300005335 Ga0070666_10066942 Ga0070666_100669423 238
18 3300005338 Ga0068868_100188379 Ga0068868_1001883791 238
19 3300005355 Ga0070671_100289769 Ga0070671_1002897691 238
20 3300005356 Ga0070674_100248750 Ga0070674_1002487502 238
21 3300005364 Ga0070673_100134827 Ga0070673_1001348273 238
22 3300005367 Ga0070667_100243846 Ga0070667_1002438462 238
23 3300005459 Ga0068867_100092080 Ga0068867_1000920801 238
24 3300005548 Ga0070665_100000326 Ga0070665_10000032617 238
25 3300005548 Ga0070665_100149033 Ga0070665_1001490331 238
26 3300005548 Ga0070665_100563378 Ga0070665_1005633782 238
27 3300005563 Ga0068855_100733402 Ga0068855_1007334022 238
28 3300005577 Ga0068857_100096117 Ga0068857_1000961172 238
29 3300005614 Ga0068856_100196384 Ga0068856_1001963841 238
30 3300005616 Ga0068852_100062170 Ga0068852_1000621703 238
31 3300005617 Ga0068859_100161617 Ga0068859_1001616172 238
32 3300005618 Ga0068864_100028625 Ga0068864_1000286255 238
33 3300005834 Ga0068851_10001007 Ga0068851_100010075 238
34 3300005840 Ga0068870_10161746 Ga0068870_101617461 238
35 3300005841 Ga0068863_100027570 Ga0068863_1000275705 238
36 3300005842 Ga0068858_100006626 Ga0068858_1000066265 238
37 3300005843 Ga0068860_100006934 Ga0068860_1000069348 238
38 3300006881 Ga0068865_100046280 Ga0068865_1000462803 238
39 3300006881 Ga0068865_100148533 Ga0068865_1001485332 238
40 3300006931 Ga0097620_100161620 Ga0097620_1001616202 238
41 3300009174 Ga0105241_10534908 Ga0105241_105349082 238
42 3300009177 Ga0105248_10142525 Ga0105248_101425252 238
43 3300009545 Ga0105237_10101666 Ga0105237_101016662 238
44 3300009551 Ga0105238_10016572 Ga0105238_100165725 238
45 3300009553 Ga0105249_10011914 Ga0105249_100119143 238
46 3300013102 Ga0157371_10153253 Ga0157371_101532531 238
47 3300013105 Ga0157369_10160432 Ga0157369_101604322 238
48 3300013296 Ga0157374_10032236 Ga0157374_100322365 238
49 3300013307 Ga0157372_10013783 Ga0157372_100137836 238
50 3300013307 Ga0157372_10032875 Ga0157372_100328756 238
51 3300014325 Ga0163163_10004231 Ga0163163_1000423110 238
52 3300014968 Ga0157379_10010562 Ga0157379_100105622 238
53 3300014969 Ga0157376_10227438 Ga0157376_102274382 238
54 3300025321 Ga0207656_10001911 Ga0207656_100019113 238
55 3300025903 Ga0207680_10152762 Ga0207680_101527622 238
56 3300025904 Ga0207647_10000858 Ga0207647_1000085814 238
57 3300025908 Ga0207643_10157922 Ga0207643_101579222 238
58 3300025911 Ga0207654_10040769 Ga0207654_100407692 238
59 3300025913 Ga0207695_10025236 Ga0207695_100252364 238
60 3300025914 Ga0207671_10020985 Ga0207671_100209856 238
61 3300025924 Ga0207694_10006422 Ga0207694_100064228 238
62 3300025925 Ga0207650_10005058 Ga0207650_100050584 238
63 3300025925 Ga0207650_10565413 Ga0207650_105654131 238
64 3300025931 Ga0207644_10236668 Ga0207644_102366682 238
65 3300025933 Ga0207706_10014188 Ga0207706_100141884 238
66 3300025938 Ga0207704_10023471 Ga0207704_100234712 238
67 3300025940 Ga0207691_10101139 Ga0207691_101011392 238
68 3300025942 Ga0207689_10012766 Ga0207689_100127665 238
69 3300025942 Ga0207689_10070361 Ga0207689_100703612 238
70 3300025949 Ga0207667_10557951 Ga0207667_105579512 238
71 3300025960 Ga0207651_10355840 Ga0207651_103558402 238
72 3300025961 Ga0207712_10000340 Ga0207712_1000034024 238
73 3300025981 Ga0207640_10001768 Ga0207640_1000176811 238
74 3300025986 Ga0207658_10179315 Ga0207658_101793152 238
75 3300025986 Ga0207658_10253444 Ga0207658_102534442 238
76 3300026023 Ga0207677_10096480 Ga0207677_100964803 238
77 3300026035 Ga0207703_10004638 Ga0207703_100046387 238
78 3300026041 Ga0207639_10000399 Ga0207639_1000039914 238
79 3300026078 Ga0207702_10382153 Ga0207702_103821532 238
80 3300026078 Ga0207702_10694811 Ga0207702_106948112 238
81 3300026089 Ga0207648_10129238 Ga0207648_101292382 238
82 3300026095 Ga0207676_10175849 Ga0207676_101758492 238
83 3300026116 Ga0207674_10248902 Ga0207674_102489022 238
84 3300026142 Ga0207698_10167973 Ga0207698_101679732 238
85 3300028379 Ga0268266_10000013 Ga0268266_1000001326 238
86 3300028379 Ga0268266_10138378 Ga0268266_101383783 238
87 3300028381 Ga0268264_10030849 Ga0268264_100308493 238
88 3300049568 Ga0501031_0181116 Ga0501031_0181116_564_1310 238
89 3300049741 Ga0501079_0496690 Ga0501079_0496690_17_733 238
90 3300013306 Ga0163162_10000021 Ga0163162_100000219 239
91 3300025986 Ga0207658_10066618 Ga0207658_100666183 239
92 3300031730 Ga0307516_10141923 Ga0307516_101419233 239
93 3300044765 Ga0466970_0216088 Ga0466970_0216088_175_927 239
94 3300046543 Ga0495645_0451066 Ga0495645_0451066_44_790 239
95 3300049571 Ga0501034_0006178 Ga0501034_0006178_10496_11236 239
96 3300049572 Ga0501036_0129120 Ga0501036_0129120_1064_1804 239
97 3300049573 Ga0501037_0138081 Ga0501037_0138081_63_803 239
98 3300049574 Ga0501038_0010027 Ga0501038_0010027_1666_2406 239
99 3300049581 Ga0501047_0000349 Ga0501047_0000349_28213_28953 239
100 3300049583 Ga0501067_0000269 Ga0501067_0000269_26008_26748 239
101 3300049584 Ga0501068_0009983 Ga0501068_0009983_2887_3627 239
102 3300049585 Ga0501069_0002562 Ga0501069_0002562_1689_2429 239
103 3300049586 Ga0501070_0008703 Ga0501070_0008703_1697_2437 239
104 3300049588 Ga0501072_0000955 Ga0501072_0000955_18898_19638 239
105 3300049589 Ga0501073_0000424 Ga0501073_0000424_26476_27216 239
106 3300049590 Ga0501074_0022348 Ga0501074_0022348_2163_2903 239
107 3300049741 Ga0501079_0019061 Ga0501079_0019061_971_1711 239
108 3300049742 Ga0501080_0000828 Ga0501080_0000828_14221_14961 239
109 3300049744 Ga0501083_0003137 Ga0501083_0003137_840_1580 239
110 3300049823 Ga0501044_0170762 Ga0501044_0170762_958_1698 239
111 3300060353 Ga0501082_0069998 Ga0501082_0069998_1433_2173 239
112 3300005355 Ga0070671_100421256 Ga0070671_1004212562 240
113 3300048928 Ga0496125_0211255 Ga0496125_0211255_66_806 240
114 iso_pu_bacteria 2842918807 2842920178 240
115 3300002075 JGI24738J21930_10010626 JGI24738J21930_100106263 241
116 3300009545 Ga0105237_10444507 Ga0105237_104445072 241
117 3300014497 Ga0182008_10000262 Ga0182008_1000026240 241
118 3300015261 Ga0182006_1001047 Ga0182006_100104717 241
119 3300015265 Ga0182005_1002340 Ga0182005_10023404 241
120 3300025914 Ga0207671_10141225 Ga0207671_101412252 241
121 3300031911 Ga0307412_10005781 Ga0307412_100057815 241
122 3300041404 Ga0439436_0000022 Ga0439436_0000022_27780_28517 241
123 3300046507 Ga0495606_0041938 Ga0495606_0041938_1162_1899 241
124 3300046512 Ga0495610_0000341 Ga0495610_0000341_47810_48547 241
125 3300046691 Ga0495670_0011482 Ga0495670_0011482_2452_3189 241
126 3300048922 Ga0496119_0065405 Ga0496119_0065405_287_1024 241
127 3300048923 Ga0496120_0200649 Ga0496120_0200649_135_872 241
128 3300015265 Ga0182005_1000777 Ga0182005_10007775 242
129 3300025924 Ga0207694_10075470 Ga0207694_100754703 242
130 3300046472 Ga0495580_0440052 Ga0495580_0440052_73_843 242
131 3300048919 Ga0496116_0030788 Ga0496116_0030788_2311_3051 242
132 3300048921 Ga0496118_0129518 Ga0496118_0129518_550_1290 242
133 3300049572 Ga0501036_0121669 Ga0501036_0121669_38_775 242
134 3300049573 Ga0501037_0337040 Ga0501037_0337040_243_977 242
135 3300049585 Ga0501069_0022100 Ga0501069_0022100_78_812 242
136 3300049586 Ga0501070_0025817 Ga0501070_0025817_3837_4571 242
137 3300049590 Ga0501074_0008658 Ga0501074_0008658_2768_3502 242
138 3300049823 Ga0501044_0069319 Ga0501044_0069319_217_954 242
139 3300060353 Ga0501082_0445869 Ga0501082_0445869_174_920 242
140 3300005335 Ga0070666_10113759 Ga0070666_101137592 243
141 3300005338 Ga0068868_100138097 Ga0068868_1001380973 243
142 3300005347 Ga0070668_100227182 Ga0070668_1002271822 243
143 3300005367 Ga0070667_100262531 Ga0070667_1002625311 243
144 3300005548 Ga0070665_100049140 Ga0070665_1000491403 243
145 3300005983 Ga0081540_1002968 Ga0081540_10029686 243
146 3300010375 Ga0105239_10018213 Ga0105239_100182133 243
147 3300025911 Ga0207654_10000065 Ga0207654_1000006551 243
148 3300025972 Ga0207668_10143897 Ga0207668_101438972 243
149 3300044712 Ga0453684_0004942 Ga0453684_0004942_18714_19475 243
150 3300044712 Ga0453684_0014884 Ga0453684_0014884_4959_5714 243
151 3300046460 Ga0495638_0000007 Ga0495638_0000007_536331_537071 243
152 3300049571 Ga0501034_0327994 Ga0501034_0327994_372_1142 243
153 3300049572 Ga0501036_0405680 Ga0501036_0405680_81_851 243
154 3300049573 Ga0501037_0272434 Ga0501037_0272434_241_1011 243
155 3300049579 Ga0501043_0084851 Ga0501043_0084851_401_1171 243
156 3300049580 Ga0501046_0007603 Ga0501046_0007603_1935_2705 243
157 3300049581 Ga0501047_0000442 Ga0501047_0000442_19794_20564 243
158 3300049584 Ga0501068_0039107 Ga0501068_0039107_2032_2802 243
159 3300049586 Ga0501070_0008525 Ga0501070_0008525_5312_6082 243
160 3300049586 Ga0501070_0039522 Ga0501070_0039522_722_1492 243
161 3300049586 Ga0501070_0198383 Ga0501070_0198383_427_1197 243
162 3300049589 Ga0501073_0057716 Ga0501073_0057716_1037_1807 243
163 3300049589 Ga0501073_0085252 Ga0501073_0085252_831_1601 243
164 3300049590 Ga0501074_0092896 Ga0501074_0092896_808_1578 243
165 3300049741 Ga0501079_0080108 Ga0501079_0080108_1373_2143 243
166 3300049742 Ga0501080_0002423 Ga0501080_0002423_7573_8343 243
167 3300049742 Ga0501080_0034157 Ga0501080_0034157_721_1491 243
168 3300049742 Ga0501080_0129961 Ga0501080_0129961_1155_1925 243
169 3300049822 Ga0501035_0063315 Ga0501035_0063315_1801_2571 243
170 3300054114 Ga0501084_0064768 Ga0501084_0064768_624_1394 243
171 3300054114 Ga0501084_0189300 Ga0501084_0189300_550_1320 243
172 iso_pu_bacteria 2643221697 2644537018 243
173 3300005455 Ga0070663_100516485 Ga0070663_1005164851 244
174 3300005458 Ga0070681_10000007 Ga0070681_10000007128 244
175 3300005458 Ga0070681_10108129 Ga0070681_101081293 244
176 3300005547 Ga0070693_100121699 Ga0070693_1001216992 244
177 3300005548 Ga0070665_100273339 Ga0070665_1002733392 244
178 3300005563 Ga0068855_100357011 Ga0068855_1003570113 244
179 3300006237 Ga0097621_100086822 Ga0097621_1000868223 244
180 3300006358 Ga0068871_100238659 Ga0068871_1002386592 244
181 3300009098 Ga0105245_10564899 Ga0105245_105648991 244
182 3300013104 Ga0157370_10566773 Ga0157370_105667732 244
183 3300013296 Ga0157374_10094394 Ga0157374_100943944 244
184 3300013307 Ga0157372_10308605 Ga0157372_103086052 244
185 3300013307 Ga0157372_10599330 Ga0157372_105993302 244
186 3300014969 Ga0157376_10619777 Ga0157376_106197772 244
187 3300021388 Ga0213875_10000542 Ga0213875_1000054226 244
188 3300025909 Ga0207705_10037248 Ga0207705_100372483 244
189 3300025912 Ga0207707_10000058 Ga0207707_1000005822 244
190 3300025917 Ga0207660_10034347 Ga0207660_100343472 244
191 3300025921 Ga0207652_10054422 Ga0207652_100544224 244
192 3300025925 Ga0207650_10592007 Ga0207650_105920071 244
193 3300025927 Ga0207687_10158411 Ga0207687_101584111 244
194 3300025949 Ga0207667_10280527 Ga0207667_102805272 244
195 3300025960 Ga0207651_10105012 Ga0207651_101050122 244
196 3300026023 Ga0207677_10130146 Ga0207677_101301462 244
197 3300026035 Ga0207703_10134797 Ga0207703_101347972 244
198 3300026067 Ga0207678_10157760 Ga0207678_101577602 244
199 3300026067 Ga0207678_10664706 Ga0207678_106647061 244
200 3300026095 Ga0207676_10057651 Ga0207676_100576513 244
201 3300026116 Ga0207674_10061173 Ga0207674_100611733 244
202 3300026116 Ga0207674_10434335 Ga0207674_104343352 244
203 3300026142 Ga0207698_10184105 Ga0207698_101841053 244
204 3300026142 Ga0207698_10759274 Ga0207698_107592741 244
205 3300037418 Ga0395900_0007509 Ga0395900_0007509_1163_1903 244
206 3300037853 Ga0436364_1187307 Ga0436364_1187307_20134_20889 244
207 3300041512 Ga0451853_0534717 Ga0451853_0534717_551_1291 244
208 3300042876 Ga0451577_0344819 Ga0451577_0344819_205_963 244
209 3300044712 Ga0453684_0480596 Ga0453684_0480596_411_1169 244
210 3300046660 Ga0495625_0204885 Ga0495625_0204885_187_924 244
211 3300048917 Ga0496114_0120787 Ga0496114_0120787_547_1287 244
212 3300048918 Ga0496115_0000746 Ga0496115_0000746_1804_2556 244
213 3300048929 Ga0496126_0000033 Ga0496126_0000033_366278_367030 244
214 3300048929 Ga0496126_0301856 Ga0496126_0301856_462_1202 244
215 3300049571 Ga0501034_0653181 Ga0501034_0653181_101_841 244
216 3300049575 Ga0501039_0510214 Ga0501039_0510214_132_872 244
217 3300049579 Ga0501043_0115077 Ga0501043_0115077_329_1069 244
218 3300049580 Ga0501046_0033164 Ga0501046_0033164_762_1502 244
219 3300049581 Ga0501047_0236328 Ga0501047_0236328_806_1546 244
220 3300049581 Ga0501047_0314796 Ga0501047_0314796_37_777 244
221 3300049585 Ga0501069_0177994 Ga0501069_0177994_380_1120 244
222 3300049586 Ga0501070_0006863 Ga0501070_0006863_7953_8690 244
223 3300049589 Ga0501073_0031213 Ga0501073_0031213_1153_1893 244
224 3300049589 Ga0501073_0121341 Ga0501073_0121341_588_1328 244
225 3300049590 Ga0501074_0330940 Ga0501074_0330940_112_852 244
226 3300049742 Ga0501080_0047857 Ga0501080_0047857_1734_2471 244
227 3300049822 Ga0501035_0610916 Ga0501035_0610916_100_840 244
228 3300049823 Ga0501044_0131069 Ga0501044_0131069_101_841 244
229 3300053139 Ga0500568_0001038 Ga0500568_0001038_14041_14781 244
230 3300054114 Ga0501084_0055020 Ga0501084_0055020_1273_2013 244
231 3300060353 Ga0501082_0000356 Ga0501082_0000356_9731_10471 244
232 iso_pu_bacteria 2984592036 2984594283 244
233 3300005577 Ga0068857_100196739 Ga0068857_1001967392 245
234 3300009174 Ga0105241_10002081 Ga0105241_100020813 245
235 3300009545 Ga0105237_10002311 Ga0105237_1000231116 245
236 3300009551 Ga0105238_10003551 Ga0105238_1000355110 245
237 3300010375 Ga0105239_10019864 Ga0105239_100198644 245
238 3300013105 Ga0157369_10001294 Ga0157369_1000129422 245
239 3300013307 Ga0157372_10004810 Ga0157372_100048102 245
240 3300025911 Ga0207654_10013861 Ga0207654_100138614 245
241 3300025913 Ga0207695_10000864 Ga0207695_1000086425 245
242 3300025914 Ga0207671_10002473 Ga0207671_100024732 245
243 3300025920 Ga0207649_10001908 Ga0207649_100019082 245
244 3300025924 Ga0207694_10194108 Ga0207694_101941082 245
245 3300025949 Ga0207667_10000932 Ga0207667_100009322 245
246 3300026041 Ga0207639_10002331 Ga0207639_100023313 245
247 3300031911 Ga0307412_10151903 Ga0307412_101519032 246
248 3300013297 Ga0157378_10000619 Ga0157378_100006193 247
249 3300049586 Ga0501070_0001603 Ga0501070_0001603_14911_15687 247
250 3300005843 Ga0068860_100029665 Ga0068860_1000296653 248
251 3300009551 Ga0105238_10126133 Ga0105238_101261333 248
252 3300013105 Ga0157369_10042514 Ga0157369_100425144 248
253 3300013297 Ga0157378_10082662 Ga0157378_100826622 248
254 3300013308 Ga0157375_10644636 Ga0157375_106446361 248
255 3300014969 Ga0157376_10025766 Ga0157376_100257665 248
256 3300014969 Ga0157376_10102992 Ga0157376_101029922 248
257 3300025321 Ga0207656_10008490 Ga0207656_100084903 248
258 3300025903 Ga0207680_10000109 Ga0207680_1000010914 248
259 3300025904 Ga0207647_10048500 Ga0207647_100485003 248
260 3300025909 Ga0207705_10090172 Ga0207705_100901723 248
261 3300025911 Ga0207654_10029426 Ga0207654_100294263 248
262 3300025912 Ga0207707_10104754 Ga0207707_101047543 248
263 3300025913 Ga0207695_10048628 Ga0207695_100486283 248
264 3300025914 Ga0207671_10006597 Ga0207671_100065977 248
265 3300025919 Ga0207657_10000612 Ga0207657_1000061220 248
266 3300025924 Ga0207694_10092905 Ga0207694_100929052 248
267 3300025944 Ga0207661_10052462 Ga0207661_100524623 248
268 3300025945 Ga0207679_10307212 Ga0207679_103072122 248
269 3300025961 Ga0207712_10030582 Ga0207712_100305822 248
270 3300026041 Ga0207639_10112548 Ga0207639_101125482 248
271 3300026041 Ga0207639_10425660 Ga0207639_104256602 248
272 3300026142 Ga0207698_10191991 Ga0207698_101919913 248
273 3300028381 Ga0268264_10003604 Ga0268264_100036044 248
274 3300049569 Ga0501032_0116024 Ga0501032_0116024_745_1509 248
275 3300049571 Ga0501034_0487272 Ga0501034_0487272_47_811 248
276 3300049579 Ga0501043_0397549 Ga0501043_0397549_262_1026 248
277 3300009545 Ga0105237_10177313 Ga0105237_101773131 249
278 3300014969 Ga0157376_10001452 Ga0157376_1000145210 249
279 3300025940 Ga0207691_10006050 Ga0207691_1000605010 249
280 3300031616 Ga0307508_10039008 Ga0307508_100390082 249
281 3300037418 Ga0395900_0536879 Ga0395900_0536879_98_898 249
282 3300048907 Ga0496104_0000016 Ga0496104_0000016_221752_222561 249
283 3300048908 Ga0496105_0000035 Ga0496105_0000035_112112_112921 249
284 3300049581 Ga0501047_0011035 Ga0501047_0011035_6416_7183 249
285 3300049585 Ga0501069_0039876 Ga0501069_0039876_93_860 249
286 3300049586 Ga0501070_0035738 Ga0501070_0035738_1105_1872 249
287 3300049589 Ga0501073_0036445 Ga0501073_0036445_2242_3009 249
288 3300049590 Ga0501074_0149595 Ga0501074_0149595_524_1291 249
289 3300049742 Ga0501080_0004456 Ga0501080_0004456_2887_3654 249
290 3300049823 Ga0501044_0145696 Ga0501044_0145696_1173_1940 249
291 3300005467 Ga0070706_100146432 Ga0070706_1001464322 250
292 3300014969 Ga0157376_10354149 Ga0157376_103541492 251
293 3300049581 Ga0501047_0010758 Ga0501047_0010758_4487_5368 252
294 3300049586 Ga0501070_0002554 Ga0501070_0002554_5635_6516 252
295 3300049587 Ga0501071_0004059 Ga0501071_0004059_6120_7001 252
296 3300049589 Ga0501073_0008259 Ga0501073_0008259_1362_2243 252
297 3300049590 Ga0501074_0010754 Ga0501074_0010754_1516_2397 252
298 3300049742 Ga0501080_0027187 Ga0501080_0027187_3000_3881 252
299 3300049822 Ga0501035_0089508 Ga0501035_0089508_874_1755 252
300 3300049823 Ga0501044_0158915 Ga0501044_0158915_880_1761 252
301 3300054114 Ga0501084_0514946 Ga0501084_0514946_57_938 252
302 3300001979 JGI24740J21852_10000728 JGI24740J21852_100007284 253
303 3300005327 Ga0070658_10084922 Ga0070658_100849222 253
304 3300005329 Ga0070683_100026852 Ga0070683_1000268523 253
305 3300005336 Ga0070680_100015861 Ga0070680_1000158612 253
306 3300005339 Ga0070660_100069290 Ga0070660_1000692903 253
307 3300005341 Ga0070691_10028351 Ga0070691_100283512 253
308 3300005344 Ga0070661_100047389 Ga0070661_1000473892 253
309 3300005345 Ga0070692_10000184 Ga0070692_100001844 253
310 3300005455 Ga0070663_100066318 Ga0070663_1000663183 253
311 3300005458 Ga0070681_10106145 Ga0070681_101061453 253
312 3300005530 Ga0070679_100074702 Ga0070679_1000747024 253
313 3300005535 Ga0070684_100024205 Ga0070684_1000242053 253
314 3300005539 Ga0068853_100143473 Ga0068853_1001434733 253
315 3300005546 Ga0070696_100024305 Ga0070696_1000243053 253
316 3300005563 Ga0068855_100140792 Ga0068855_1001407923 253
317 3300005577 Ga0068857_100026704 Ga0068857_1000267044 253
318 3300005578 Ga0068854_100129770 Ga0068854_1001297702 253
319 3300005614 Ga0068856_100109229 Ga0068856_1001092292 253
320 3300005616 Ga0068852_100035978 Ga0068852_1000359784 253
321 3300005834 Ga0068851_10140032 Ga0068851_101400322 253
322 3300009093 Ga0105240_10197466 Ga0105240_101974662 253
323 3300009174 Ga0105241_10001442 Ga0105241_100014424 253
324 3300009551 Ga0105238_10005242 Ga0105238_100052423 253
325 3300010375 Ga0105239_10030082 Ga0105239_100300823 253
326 3300013100 Ga0157373_10049347 Ga0157373_100493473 253
327 3300013102 Ga0157371_10028310 Ga0157371_100283103 253
328 3300013104 Ga0157370_10077835 Ga0157370_100778353 253
329 3300013105 Ga0157369_10000086 Ga0157369_1000008644 253
330 3300013105 Ga0157369_10022515 Ga0157369_100225156 253
331 3300013307 Ga0157372_10051737 Ga0157372_100517374 253
332 3300020069 Ga0197907_10066863 Ga0197907_100668632 253
333 3300020070 Ga0206356_11811416 Ga0206356_118114162 253
334 3300020078 Ga0206352_10796229 Ga0206352_107962293 253
335 3300020081 Ga0206354_10571241 Ga0206354_105712416 253
336 3300020082 Ga0206353_10732906 Ga0206353_107329066 253
337 3300025321 Ga0207656_10018614 Ga0207656_100186142 253
338 3300025904 Ga0207647_10001297 Ga0207647_100012974 253
339 3300025909 Ga0207705_10001521 Ga0207705_1000152111 253
340 3300025912 Ga0207707_10014086 Ga0207707_100140863 253
341 3300025913 Ga0207695_10004260 Ga0207695_100042607 253
342 3300025917 Ga0207660_10023533 Ga0207660_100235333 253
343 3300025919 Ga0207657_10029361 Ga0207657_100293613 253
344 3300025920 Ga0207649_10008698 Ga0207649_100086986 253
345 3300025921 Ga0207652_10001758 Ga0207652_1000175814 253
346 3300025944 Ga0207661_10005991 Ga0207661_100059915 253
347 3300025949 Ga0207667_10002819 Ga0207667_100028197 253
348 3300025981 Ga0207640_10000264 Ga0207640_1000026420 253
349 3300026067 Ga0207678_10104441 Ga0207678_101044413 253
350 3300026078 Ga0207702_10002775 Ga0207702_1000277514 253
351 3300026116 Ga0207674_10002862 Ga0207674_100028624 253
352 3300026142 Ga0207698_10001013 Ga0207698_100010136 253
353 3300049585 Ga0501069_0002152 Ga0501069_0002152_2068_2856 253
354 3300049823 Ga0501044_0530928 Ga0501044_0530928_149_997 253
355 3300001915 JGI24741J21665_1001955 JGI24741J21665_10019554 254
356 3300001979 JGI24740J21852_10023630 JGI24740J21852_100236302 254
357 3300005327 Ga0070658_10042211 Ga0070658_100422113 254
358 3300005329 Ga0070683_100049159 Ga0070683_1000491593 254
359 3300005336 Ga0070680_100015090 Ga0070680_1000150903 254
360 3300005336 Ga0070680_100060013 Ga0070680_1000600133 254
361 3300005339 Ga0070660_100087615 Ga0070660_1000876152 254
362 3300005341 Ga0070691_10015643 Ga0070691_100156432 254
363 3300005344 Ga0070661_100028532 Ga0070661_1000285323 254
364 3300005345 Ga0070692_10012796 Ga0070692_100127963 254
365 3300005366 Ga0070659_100028956 Ga0070659_1000289563 254
366 3300005434 Ga0070709_10057054 Ga0070709_100570542 254
367 3300005455 Ga0070663_100069220 Ga0070663_1000692203 254
368 3300005455 Ga0070663_100078765 Ga0070663_1000787652 254
369 3300005458 Ga0070681_10013522 Ga0070681_100135224 254
370 3300005530 Ga0070679_100000311 Ga0070679_10000031114 254
371 3300005535 Ga0070684_100016864 Ga0070684_1000168642 254
372 3300005539 Ga0068853_100013956 Ga0068853_1000139564 254
373 3300005546 Ga0070696_100028573 Ga0070696_1000285733 254
374 3300005563 Ga0068855_100198415 Ga0068855_1001984153 254
375 3300005564 Ga0070664_100014611 Ga0070664_1000146114 254
376 3300005577 Ga0068857_100110683 Ga0068857_1001106832 254
377 3300005578 Ga0068854_100092886 Ga0068854_1000928862 254
378 3300005614 Ga0068856_100037190 Ga0068856_1000371904 254
379 3300005616 Ga0068852_100045436 Ga0068852_1000454364 254
380 3300009093 Ga0105240_10030045 Ga0105240_100300453 254
381 3300013100 Ga0157373_10014908 Ga0157373_100149085 254
382 3300013102 Ga0157371_10004042 Ga0157371_100040424 254
383 3300013104 Ga0157370_10040232 Ga0157370_100402324 254
384 3300013105 Ga0157369_10011967 Ga0157369_100119673 254
385 3300013307 Ga0157372_10050517 Ga0157372_100505173 254
386 3300020082 Ga0206353_11439705 Ga0206353_114397052 254
387 3300025909 Ga0207705_10001251 Ga0207705_1000125115 254
388 3300025912 Ga0207707_10000167 Ga0207707_1000016731 254
389 3300025912 Ga0207707_10000296 Ga0207707_1000029621 254
390 3300025913 Ga0207695_10003863 Ga0207695_1000386315 254
391 3300025917 Ga0207660_10001582 Ga0207660_1000158210 254
392 3300025917 Ga0207660_10005619 Ga0207660_100056196 254
393 3300025919 Ga0207657_10029458 Ga0207657_100294583 254
394 3300025920 Ga0207649_10038480 Ga0207649_100384802 254
395 3300025921 Ga0207652_10001361 Ga0207652_100013616 254
396 3300025921 Ga0207652_10001550 Ga0207652_1000155014 254
397 3300025944 Ga0207661_10014565 Ga0207661_100145654 254
398 3300025949 Ga0207667_10002142 Ga0207667_100021423 254
399 3300025981 Ga0207640_10001219 Ga0207640_1000121910 254
400 3300026041 Ga0207639_10004509 Ga0207639_100045094 254
401 3300026067 Ga0207678_10025343 Ga0207678_100253433 254
402 3300026067 Ga0207678_10096606 Ga0207678_100966062 254
403 3300026116 Ga0207674_10057744 Ga0207674_100577443 254
404 3300026142 Ga0207698_10059215 Ga0207698_100592153 254
405 3300049586 Ga0501070_0016621 Ga0501070_0016621_2453_3295 254
406 3300005336 Ga0070680_100000287 Ga0070680_1000002873 255
407 3300005341 Ga0070691_10006128 Ga0070691_100061282 255
408 3300005458 Ga0070681_10017502 Ga0070681_100175025 255
409 3300005530 Ga0070679_100000184 Ga0070679_10000018416 255
410 3300013104 Ga0157370_10124020 Ga0157370_101240202 255
411 3300013307 Ga0157372_10132309 Ga0157372_101323092 255
412 3300025912 Ga0207707_10000274 Ga0207707_100002745 255
413 3300025917 Ga0207660_10021800 Ga0207660_100218005 255
414 3300025921 Ga0207652_10000209 Ga0207652_1000020920 255
415 3300026078 Ga0207702_10010206 Ga0207702_100102066 255
416 3300037466 Ga0395898_0102926 Ga0395898_0102926_1737_2504 255
417 3300001915 JGI24741J21665_1001906 JGI24741J21665_10019065 256
418 3300001915 JGI24741J21665_1005057 JGI24741J21665_10050573 256
419 3300001979 JGI24740J21852_10000295 JGI24740J21852_100002952 256
420 3300005327 Ga0070658_10011453 Ga0070658_100114535 256
421 3300005327 Ga0070658_10295285 Ga0070658_102952851 256
422 3300005327 Ga0070658_10388756 Ga0070658_103887562 256
423 3300005336 Ga0070680_100017738 Ga0070680_1000177384 256
424 3300005336 Ga0070680_100047927 Ga0070680_1000479273 256
425 3300005337 Ga0070682_100001082 Ga0070682_1000010827 256
426 3300005339 Ga0070660_100036003 Ga0070660_1000360033 256
427 3300005339 Ga0070660_100436326 Ga0070660_1004363262 256
428 3300005344 Ga0070661_100007789 Ga0070661_1000077893 256
429 3300005344 Ga0070661_100087884 Ga0070661_1000878841 256
430 3300005345 Ga0070692_10007662 Ga0070692_100076622 256
431 3300005345 Ga0070692_10127703 Ga0070692_101277032 256
432 3300005366 Ga0070659_100256860 Ga0070659_1002568602 256
433 3300005455 Ga0070663_100013775 Ga0070663_1000137755 256
434 3300005455 Ga0070663_100200167 Ga0070663_1002001671 256
435 3300005458 Ga0070681_10000613 Ga0070681_1000061322 256
436 3300005530 Ga0070679_100000533 Ga0070679_1000005335 256
437 3300005539 Ga0068853_100315867 Ga0068853_1003158672 256
438 3300005539 Ga0068853_100325551 Ga0068853_1003255512 256
439 3300005546 Ga0070696_100007448 Ga0070696_1000074484 256
440 3300005546 Ga0070696_100076306 Ga0070696_1000763062 256
441 3300005563 Ga0068855_100003226 Ga0068855_1000032265 256
442 3300005563 Ga0068855_100439268 Ga0068855_1004392681 256
443 3300005563 Ga0068855_100481752 Ga0068855_1004817521 256
444 3300005564 Ga0070664_100131397 Ga0070664_1001313972 256
445 3300005578 Ga0068854_100017935 Ga0068854_1000179354 256
446 3300005614 Ga0068856_100083777 Ga0068856_1000837773 256
447 3300005616 Ga0068852_100029005 Ga0068852_1000290053 256
448 3300005616 Ga0068852_100119858 Ga0068852_1001198583 256
449 3300005834 Ga0068851_10005832 Ga0068851_100058324 256
450 3300009093 Ga0105240_10084512 Ga0105240_100845123 256
451 3300009093 Ga0105240_10087403 Ga0105240_100874033 256
452 3300009093 Ga0105240_10104128 Ga0105240_101041283 256
453 3300009174 Ga0105241_10008562 Ga0105241_100085623 256
454 3300009551 Ga0105238_10008598 Ga0105238_100085983 256
455 3300013102 Ga0157371_10030154 Ga0157371_100301543 256
456 3300013104 Ga0157370_10001400 Ga0157370_100014005 256
457 3300013105 Ga0157369_10029363 Ga0157369_100293634 256
458 3300013307 Ga0157372_10002348 Ga0157372_100023485 256
459 3300013307 Ga0157372_10069072 Ga0157372_100690724 256
460 3300020069 Ga0197907_11283620 Ga0197907_112836201 256
461 3300020070 Ga0206356_10374221 Ga0206356_103742212 256
462 3300020081 Ga0206354_10157811 Ga0206354_101578112 256
463 3300020081 Ga0206354_10759747 Ga0206354_107597472 256
464 3300020082 Ga0206353_10447243 Ga0206353_104472431 256
465 3300025321 Ga0207656_10020902 Ga0207656_100209022 256
466 3300025904 Ga0207647_10004858 Ga0207647_100048589 256
467 3300025909 Ga0207705_10001662 Ga0207705_100016623 256
468 3300025909 Ga0207705_10001681 Ga0207705_1000168112 256
469 3300025909 Ga0207705_10014582 Ga0207705_100145823 256
470 3300025909 Ga0207705_10054134 Ga0207705_100541342 256
471 3300025911 Ga0207654_10016049 Ga0207654_100160493 256
472 3300025912 Ga0207707_10000070 Ga0207707_1000007078 256
473 3300025912 Ga0207707_10001746 Ga0207707_1000174614 256
474 3300025913 Ga0207695_10007210 Ga0207695_100072103 256
475 3300025913 Ga0207695_10024897 Ga0207695_100248973 256
476 3300025914 Ga0207671_10036641 Ga0207671_100366413 256
477 3300025917 Ga0207660_10000278 Ga0207660_1000027815 256
478 3300025917 Ga0207660_10024897 Ga0207660_100248974 256
479 3300025917 Ga0207660_10099887 Ga0207660_100998873 256
480 3300025919 Ga0207657_10025099 Ga0207657_100250995 256
481 3300025919 Ga0207657_10051744 Ga0207657_100517443 256
482 3300025919 Ga0207657_10052154 Ga0207657_100521543 256
483 3300025920 Ga0207649_10003964 Ga0207649_100039643 256
484 3300025920 Ga0207649_10006809 Ga0207649_100068093 256
485 3300025921 Ga0207652_10000078 Ga0207652_1000007827 256
486 3300025921 Ga0207652_10000552 Ga0207652_1000055214 256
487 3300025924 Ga0207694_10013104 Ga0207694_100131041 256
488 3300025932 Ga0207690_10000371 Ga0207690_100003718 256
489 3300025932 Ga0207690_10007382 Ga0207690_100073823 256
490 3300025944 Ga0207661_10001380 Ga0207661_1000138014 256
491 3300025949 Ga0207667_10000740 Ga0207667_1000074022 256
492 3300025949 Ga0207667_10037260 Ga0207667_100372605 256
493 3300025949 Ga0207667_10042509 Ga0207667_100425094 256
494 3300025981 Ga0207640_10015465 Ga0207640_100154653 256
495 3300025981 Ga0207640_10024172 Ga0207640_100241722 256
496 3300026041 Ga0207639_10001582 Ga0207639_100015828 256
497 3300026041 Ga0207639_10026244 Ga0207639_100262443 256
498 3300026067 Ga0207678_10019481 Ga0207678_100194815 256
499 3300026067 Ga0207678_10024454 Ga0207678_100244545 256
500 3300026067 Ga0207678_10083008 Ga0207678_100830082 256
501 3300026078 Ga0207702_10262946 Ga0207702_102629462 256
502 3300026116 Ga0207674_10000973 Ga0207674_1000097318 256
503 3300026142 Ga0207698_10001297 Ga0207698_1000129711 256
504 3300026142 Ga0207698_10001673 Ga0207698_100016732 256
505 3300037312 Ga0395899_0013560 Ga0395899_0013560_2053_2823 256
506 3300037418 Ga0395900_0010725 Ga0395900_0010725_7195_7965 256
507 3300037466 Ga0395898_0120555 Ga0395898_0120555_810_1580 256
508 3300038443 Ga0395901_0016767 Ga0395901_0016767_1158_1928 256
509 3300049593 Ga0501077_0437299 Ga0501077_0437299_38_808 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

61

281

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9727 18 240
1x09-assembly1.cif.gz_A crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate 0.9712 19 239
5cqj-assembly1.cif.gz_B crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with clomiphene 0.9668 19 240
6szg-assembly1.cif.gz_A acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 0.9655 16 236
3sgv-assembly1.cif.gz_B crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with bph-1290 0.9634 18 240
ID Description Score Start End Superfamily
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9715 13 237 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9683 17 246 3.40.1180.10
af_Q58767_31_280_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9607 14 245 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9592 17 239 3.40.1180.10
af_A0A1D8PFD1_28_274_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9576 13 238 3.40.1180.10
ID Description Score Start End GO Terms
AF-B8L344-F1-model_v4 Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (EC 2.5.1.31) (Ditrans,polycis-undecaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) (Undecaprenyl pyrophosphate synthase) (UPP synthase) 0.9792 25 246 GO:0000287
GO:0005829
GO:0008360
GO:0008834
GO:0009252
GO:0016094
GO:0045547
GO:0071555
AF-L0GUR1-F1-model_v4 Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (EC 2.5.1.31) (Ditrans,polycis-undecaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) (Undecaprenyl pyrophosphate synthase) (UPP synthase) 0.9789 17 246 GO:0000287
GO:0005829
GO:0008360
GO:0008834
GO:0009252
GO:0016094
GO:0045547
GO:0071555
AF-A0A7R8WV50-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9786 16 239 GO:0016020
GO:0016024
GO:0016765
GO:0016779
GO:0019288
GO:0030145
GO:0030604
GO:0070402
AF-A0A661J3R4-F1-model_v4 Isoprenyl transferase 0.9775 17 233 GO:0016094
GO:0045547
GO:0046872
AF-A0A1Z9DBU2-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9772 14 240 GO:0016094
GO:0045547
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.95 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map