F456947

General Info

Members Datasets Scaffolds Average Seq Length
509 227 509 122

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100188250|Ga0068854_1001882502
Length 140
Sequence MAFGTSRSWQGAFRKGRPIMFLGLRTVIYHAPDLTAAKAWYSAAFGVAPYFDQPFYVGFEIGGFELGLDPDTSGVTVGNNAVAYWGVADIDDAFGRLVASGAQPRDPVKEVGGDIKVATVTDPFGNVIGLIQNPHFKVKA

Samples

Sample ID Description Type Environment
1 2088090001 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
136 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
137 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
141 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
145 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
146 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
151 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
201 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
211 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
218 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 2.16
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNB_F6ESG4R02HWPVU 2088090001 Unclassified 519
2 rootH1_10008402 3300003316 Bacteria 1437
3 rootL2_10244749 3300003322 Bacteria 1261
4 Ga0065715_10508134 3300005293 Unclassified 774
5 Ga0065707_10273364 3300005295 Unclassified 1066
6 Ga0070676_10507766 3300005328 Bacteria 857
7 Ga0070676_10634643 3300005328 Bacteria 774
8 Ga0070683_100301911 3300005329 Bacteria 1523
9 Ga0070690_100033085 3300005330 Bacteria 3234
10 Ga0070670_100153072 3300005331 Unclassified 1996
11 Ga0070677_10113928 3300005333 Unclassified 1211
12 Ga0068869_100005980 3300005334 Bacteria 7693
13 Ga0070666_10013191 3300005335 Bacteria 5239
14 Ga0070666_10115348 3300005335 Bacteria 1860
15 Ga0070682_100243965 3300005337 Bacteria 1291
16 Ga0068868_100024980 3300005338 Bacteria 4538
17 Ga0070689_100265672 3300005340 Bacteria 1419
18 Ga0070692_10553750 3300005345 Bacteria 754
19 Ga0070668_100260782 3300005347 Bacteria 1441
20 Ga0070669_100015157 3300005353 Bacteria 5490
21 Ga0070675_100002098 3300005354 Bacteria 14761
22 Ga0070675_101184866 3300005354 Bacteria 703
23 Ga0070671_100016938 3300005355 Bacteria 5894
24 Ga0070671_100071666 3300005355 Bacteria 2892
25 Ga0070671_100599183 3300005355 Bacteria 952
26 Ga0070674_100045702 3300005356 Bacteria 2992
27 Ga0070674_100091868 3300005356 Bacteria 2193
28 Ga0070674_100234853 3300005356 Bacteria 1433
29 Ga0070673_100009034 3300005364 Bacteria 6673
30 Ga0070673_100052353 3300005364 Bacteria 3203
31 Ga0070673_100870496 3300005364 Bacteria 834
32 Ga0070688_100058984 3300005365 Bacteria 2418
33 Ga0070667_100038864 3300005367 Bacteria 3989
34 Ga0070714_100400242 3300005435 Bacteria 1297
35 Ga0070701_10790681 3300005438 Unclassified 646
36 Ga0070701_10897294 3300005438 Unclassified 611
37 Ga0070705_100257378 3300005440 Unclassified 1229
38 Ga0070694_100036916 3300005444 Bacteria 3238
39 Ga0070694_101168430 3300005444 Unclassified 644
40 Ga0070708_100001699 3300005445 Bacteria 16919
41 Ga0070708_100057040 3300005445 Bacteria 3475
42 Ga0070708_101991496 3300005445 Unclassified 538
43 Ga0070663_100360082 3300005455 Bacteria 1180
44 Ga0070663_100438011 3300005455 Bacteria 1075
45 Ga0070678_100001242 3300005456 Bacteria 13494
46 Ga0070678_100758943 3300005456 Bacteria 878
47 Ga0068867_100000367 3300005459 Bacteria 30094
48 Ga0068867_100281540 3300005459 Bacteria 1364
49 Ga0068867_100646083 3300005459 Unclassified 928
50 Ga0070685_10095318 3300005466 Bacteria 1809
51 Ga0070706_100018051 3300005467 Bacteria 6507
52 Ga0070706_100777559 3300005467 Unclassified 887
53 Ga0070707_100033649 3300005468 Bacteria 4887
54 Ga0070707_100092162 3300005468 Bacteria 2934
55 Ga0070707_101136656 3300005468 Bacteria 747
56 Ga0070698_101035673 3300005471 Bacteria 768
57 Ga0070699_100409423 3300005518 Bacteria 1227
58 Ga0070699_100415084 3300005518 Bacteria 1218
59 Ga0070697_100073024 3300005536 Bacteria 2816
60 Ga0070695_100296211 3300005545 Bacteria 1194
61 Ga0070695_101195768 3300005545 Bacteria 625
62 Ga0070696_100125025 3300005546 Bacteria 1865
63 Ga0070696_100150207 3300005546 Unclassified 1709
64 Ga0070665_100001624 3300005548 Bacteria 25892
65 Ga0070704_100944743 3300005549 Bacteria 777
66 Ga0070664_100390391 3300005564 Bacteria 1272
67 Ga0068854_100188250 3300005578 Bacteria 1616
68 Ga0070702_100074494 3300005615 Bacteria 2014
69 Ga0068859_100001501 3300005617 Bacteria 23770
70 Ga0068859_100050634 3300005617 Bacteria 4172
71 Ga0068859_100172415 3300005617 Bacteria 2245
72 Ga0068859_102965558 3300005617 Unclassified 519
73 Ga0068864_100004247 3300005618 Bacteria 11790
74 Ga0068864_100604929 3300005618 Unclassified 1064
75 Ga0068864_100896629 3300005618 Bacteria 875
76 Ga0068861_100332957 3300005719 Bacteria 1326
77 Ga0068861_100715636 3300005719 Bacteria 932
78 Ga0068861_101534481 3300005719 Unclassified 654
79 Ga0068870_10344118 3300005840 Unclassified 955
80 Ga0068863_100025066 3300005841 Bacteria 5688
81 Ga0068863_100577934 3300005841 Bacteria 1111
82 Ga0068863_101007207 3300005841 Bacteria 836
83 Ga0068858_100001313 3300005842 Bacteria 25678
84 Ga0068858_100408074 3300005842 Bacteria 1306
85 Ga0068858_101188076 3300005842 Unclassified 750
86 Ga0068860_100014541 3300005843 Bacteria 7701
87 Ga0068860_100164032 3300005843 Unclassified 2144
88 Ga0068860_100536328 3300005843 Bacteria 1171
89 Ga0068860_100688315 3300005843 Bacteria 1032
90 Ga0068862_100021241 3300005844 Bacteria 5425
91 Ga0068862_100118279 3300005844 Unclassified 2333
92 Ga0068862_100132699 3300005844 Bacteria 2204
93 Ga0068862_100148997 3300005844 Bacteria 2081
94 Ga0068862_101800394 3300005844 Unclassified 622
95 Ga0081540_1149605 3300005983 Bacteria 923
96 Ga0070716_101639833 3300006173 Bacteria 529
97 Ga0097621_100031107 3300006237 Bacteria 4232
98 Ga0068871_100144358 3300006358 Bacteria 2025
99 Ga0075428_100016532 3300006844 Bacteria 8147
100 Ga0075428_100317189 3300006844 Bacteria 1675
101 Ga0075428_100460520 3300006844 Unclassified 1362
102 Ga0075430_100302833 3300006846 Unclassified 1322
103 Ga0075431_100078582 3300006847 Unclassified 3406
104 Ga0075434_100093014 3300006871 Bacteria 3018
105 Ga0068865_100005226 3300006881 Bacteria 7851
106 Ga0068865_100275792 3300006881 Bacteria 1337
107 Ga0068865_100281417 3300006881 Bacteria 1324
108 Ga0068865_100557130 3300006881 Bacteria 963
109 Ga0097620_100001501 3300006931 Bacteria 23770
110 Ga0097620_100050643 3300006931 Bacteria 4172
111 Ga0097620_100172421 3300006931 Bacteria 2245
112 Ga0105245_10185937 3300009098 Bacteria 1988
113 Ga0105245_11348768 3300009098 Bacteria 763
114 Ga0105247_10007747 3300009101 Bacteria 6571
115 Ga0105243_10165445 3300009148 Bacteria 1911
116 Ga0105243_11202854 3300009148 Bacteria 771
117 Ga0105241_10086376 3300009174 Bacteria 2467
118 Ga0105241_10266413 3300009174 Bacteria 1458
119 Ga0105248_10004124 3300009177 Bacteria 16080
120 Ga0105248_10689858 3300009177 Bacteria 1152
121 Ga0105237_10643933 3300009545 Unclassified 1067
122 Ga0105238_10837978 3300009551 Bacteria 936
123 Ga0105249_10355598 3300009553 Bacteria 1485
124 Ga0157374_10002767 3300013296 Bacteria 14721
125 Ga0163162_10020421 3300013306 Bacteria 6509
126 Ga0163162_10733507 3300013306 Bacteria 1108
127 Ga0157375_10267740 3300013308 Unclassified 1870
128 Ga0157375_12088667 3300013308 Bacteria 674
129 Ga0157375_12644730 3300013308 Unclassified 600
130 Ga0157380_10003419 3300014326 Bacteria 10900
131 Ga0157379_10081584 3300014968 Bacteria 2897
132 Ga0157379_10218277 3300014968 Bacteria 1727
133 Ga0157376_10217713 3300014969 Bacteria 1767
134 Ga0163161_10016677 3300017792 Bacteria 5132
135 Ga0207682_10108769 3300025893 Unclassified 1219
136 Ga0207710_10003720 3300025900 Bacteria 6755
137 Ga0207680_10178582 3300025903 Bacteria 1434
138 Ga0207647_10156040 3300025904 Bacteria 1333
139 Ga0207645_10000234 3300025907 Bacteria 45978
140 Ga0207645_10237465 3300025907 Bacteria 1204
141 Ga0207645_10332440 3300025907 Bacteria 1015
142 Ga0207643_10309959 3300025908 Unclassified 984
143 Ga0207684_10020492 3300025910 Bacteria 5650
144 Ga0207654_10238536 3300025911 Bacteria 1214
145 Ga0207654_11368703 3300025911 Bacteria 516
146 Ga0207662_10192179 3300025918 Bacteria 1318
147 Ga0207646_10174461 3300025922 Bacteria 1941
148 Ga0207646_10178833 3300025922 Unclassified 1916
149 Ga0207650_10812497 3300025925 Unclassified 793
150 Ga0207659_10194794 3300025926 Bacteria 1615
151 Ga0207659_10649481 3300025926 Bacteria 901
152 Ga0207687_10885901 3300025927 Bacteria 763
153 Ga0207664_10091862 3300025929 Bacteria 2490
154 Ga0207644_10044750 3300025931 Bacteria 3146
155 Ga0207644_10113453 3300025931 Unclassified 2052
156 Ga0207706_11038153 3300025933 Bacteria 687
157 Ga0207706_11415134 3300025933 Bacteria 570
158 Ga0207709_10214107 3300025935 Bacteria 1385
159 Ga0207669_10046307 3300025937 Bacteria 2569
160 Ga0207669_10060053 3300025937 Bacteria 2329
161 Ga0207669_11081345 3300025937 Bacteria 676
162 Ga0207704_10060920 3300025938 Bacteria 2338
163 Ga0207691_10000195 3300025940 Bacteria 58081
164 Ga0207711_10017039 3300025941 Bacteria 6035
165 Ga0207711_10385659 3300025941 Bacteria 1300
166 Ga0207689_10008885 3300025942 Bacteria 8717
167 Ga0207661_11100690 3300025944 Bacteria 732
168 Ga0207679_10080620 3300025945 Bacteria 2485
169 Ga0207651_10072127 3300025960 Bacteria 2450
170 Ga0207651_10090887 3300025960 Bacteria 2233
171 Ga0207712_10264543 3300025961 Bacteria 1396
172 Ga0207712_10549018 3300025961 Bacteria 994
173 Ga0207668_10238399 3300025972 Bacteria 1470
174 Ga0207668_11807885 3300025972 Bacteria 551
175 Ga0207658_10021855 3300025986 Bacteria 4447
176 Ga0207658_10322922 3300025986 Bacteria 1337
177 Ga0207658_11465228 3300025986 Bacteria 624
178 Ga0207677_11351892 3300026023 Bacteria 655
179 Ga0207677_11928530 3300026023 Unclassified 549
180 Ga0207703_10292724 3300026035 Bacteria 1482
181 Ga0207703_10309013 3300026035 Bacteria 1444
182 Ga0207703_10545166 3300026035 Bacteria 1093
183 Ga0207703_12196007 3300026035 Unclassified 528
184 Ga0207708_10045404 3300026075 Bacteria 3348
185 Ga0207708_10726866 3300026075 Bacteria 850
186 Ga0207641_10005044 3300026088 Bacteria 11313
187 Ga0207641_10618194 3300026088 Bacteria 1062
188 Ga0207641_10878342 3300026088 Bacteria 890
189 Ga0207648_10000793 3300026089 Bacteria 35597
190 Ga0207648_10167513 3300026089 Bacteria 1942
191 Ga0207648_10282698 3300026089 Bacteria 1484
192 Ga0207648_10528607 3300026089 Bacteria 1081
193 Ga0207676_10008225 3300026095 Bacteria 7424
194 Ga0207676_11306826 3300026095 Unclassified 720
195 Ga0207675_100050657 3300026118 Bacteria 3874
196 Ga0207675_100188916 3300026118 Bacteria 1975
197 Ga0207675_100218876 3300026118 Bacteria 1834
198 Ga0207675_101548174 3300026118 Unclassified 684
199 Ga0207683_10000921 3300026121 Bacteria 27051
200 Ga0268266_10448941 3300028379 Bacteria 1226
201 Ga0268265_10008572 3300028380 Bacteria 6910
202 Ga0268265_10280209 3300028380 Bacteria 1491
203 Ga0268265_10962408 3300028380 Bacteria 841
204 Ga0268265_11531068 3300028380 Bacteria 671
205 Ga0268264_10005209 3300028381 Bacteria 11012
206 Ga0268264_10058579 3300028381 Bacteria 3226
207 Ga0268264_10504440 3300028381 Bacteria 1181
208 Ga0265318_10066907 3300028577 Unclassified 1334
209 Ga0265323_10071435 3300028653 Bacteria 1186
210 Ga0265338_10052750 3300028800 Bacteria 3645
211 Ga0265320_10071770 3300031240 Unclassified 1630
212 Ga0307405_10047269 3300031731 Unclassified 2649
213 Ga0307405_10064844 3300031731 Bacteria 2323
214 Ga0307413_10088360 3300031824 Unclassified 2010
215 Ga0307413_11183000 3300031824 Bacteria 664
216 Ga0307410_10171559 3300031852 Unclassified 1635
217 Ga0307407_10929278 3300031903 Bacteria 669
218 Ga0307412_10150171 3300031911 Unclassified 1718
219 Ga0307412_10253937 3300031911 Unclassified 1367
220 Ga0307412_11011258 3300031911 Bacteria 735
221 Ga0307409_102262302 3300031995 Bacteria 573
222 Ga0307416_100120156 3300032002 Bacteria 2339
223 Ga0307416_100463169 3300032002 Bacteria 1323
224 Ga0307416_101277031 3300032002 Unclassified 840
225 Ga0307416_101738815 3300032002 Bacteria 728
226 Ga0307415_100097123 3300032126 Unclassified 2149
227 Ga0307415_100280968 3300032126 Bacteria 1369
228 Ga0307415_100666212 3300032126 Unclassified 935
229 Ga0373934_0168065 3300035086 Bacteria 900
230 Ga0373955_0606969 3300035172 Bacteria 670
231 Ga0373931_0674936 3300035691 Bacteria 681
232 Ga0373937_0520530 3300036401 Bacteria 1130
233 Ga0373937_0765396 3300036401 Bacteria 913
234 Ga0395905_0017401 3300037471 Bacteria 6824
235 Ga0439453_0094382 3300041408 Unclassified 660
236 Ga0451798_0499475 3300041458 Bacteria 853
237 Ga0451800_0097960 3300041459 Unclassified 660
238 Ga0451802_0637869 3300041460 Bacteria 839
239 Ga0451802_1218583 3300041460 Unclassified 616
240 Ga0451807_0288429 3300041486 Unclassified 2349
241 Ga0451807_1385818 3300041486 Bacteria 806
242 Ga0451807_1555911 3300041486 Bacteria 1303
243 Ga0451807_1787862 3300041486 Unclassified 526
244 Ga0451833_0756336 3300041491 Bacteria 1564
245 Ga0451839_0598727 3300041496 Unclassified 974
246 Ga0451853_0739330 3300041512 Unclassified 1218
247 Ga0451853_2651384 3300041512 Unclassified 758
248 Ga0439431_0076194 3300041997 Bacteria 900
249 Ga0439443_122031 3300042003 Unclassified 512
250 Ga0450913_026457 3300042117 Unclassified 556
251 Ga0450888_043989 3300042126 Bacteria 627
252 Ga0450898_008088 3300042134 Bacteria 1651
253 Ga0450908_061023 3300042184 Unclassified 662
254 Ga0439435_0003806 3300042436 Bacteria 3184
255 Ga0439435_0034636 3300042436 Unclassified 1389
256 Ga0439460_0058206 3300042461 Unclassified 1174
257 Ga0450893_0080311 3300042532 Unclassified 644
258 Ga0466965_0018830 3300044683 Bacteria 3313
259 Ga0451576_0958319 3300045051 Bacteria 897
260 Ga0495590_0027070 3300046457 Bacteria 2012
261 Ga0495638_0042929 3300046460 Unclassified 2855
262 Ga0495638_0064971 3300046460 Bacteria 2247
263 Ga0495584_0051777 3300046491 Bacteria 2067
264 Ga0495616_0001799 3300046513 Bacteria 14554
265 Ga0495632_0150556 3300046519 Bacteria 1076
266 Ga0495668_0149755 3300046616 Bacteria 1277
267 Ga0495625_0129725 3300046660 Unclassified 1709
268 Ga0495669_0261183 3300046684 Bacteria 832
269 Ga0495649_0062062 3300046694 Bacteria 2009
270 Ga0495686_0034470 3300047472 Bacteria 3260
271 Ga0495686_0140711 3300047472 Bacteria 1424
272 Ga0496108_0079441 3300048911 Bacteria 2778
273 Ga0496110_0102016 3300048913 Bacteria 2573
274 Ga0496114_0152189 3300048917 Bacteria 2007
275 Ga0501031_0001424 3300049568 Bacteria 14810
276 Ga0501031_0025890 3300049568 Bacteria 3827
277 Ga0501031_0063582 3300049568 Unclassified 2404
278 Ga0501031_0083942 3300049568 Bacteria 2076
279 Ga0501031_0096317 3300049568 Bacteria 1931
280 Ga0501031_0489640 3300049568 Bacteria 793
281 Ga0501032_0003005 3300049569 Bacteria 13083
282 Ga0501032_0009842 3300049569 Bacteria 6915
283 Ga0501032_0024500 3300049569 Bacteria 4166
284 Ga0501032_0139392 3300049569 Bacteria 1597
285 Ga0501032_0230792 3300049569 Bacteria 1203
286 Ga0501033_0000613 3300049570 Bacteria 33033
287 Ga0501033_0018352 3300049570 Bacteria 5285
288 Ga0501033_0020603 3300049570 Bacteria 4982
289 Ga0501033_0159295 3300049570 Bacteria 1625
290 Ga0501033_0238544 3300049570 Bacteria 1290
291 Ga0501034_0005129 3300049571 Bacteria 14368
292 Ga0501034_0014676 3300049571 Bacteria 8065
293 Ga0501034_0018000 3300049571 Bacteria 7248
294 Ga0501034_0020267 3300049571 Bacteria 6790
295 Ga0501034_0080530 3300049571 Bacteria 3260
296 Ga0501036_0000820 3300049572 Bacteria 23060
297 Ga0501036_0002241 3300049572 Bacteria 15109
298 Ga0501036_0005381 3300049572 Bacteria 10368
299 Ga0501036_0032145 3300049572 Bacteria 4433
300 Ga0501036_0069349 3300049572 Bacteria 2982
301 Ga0501036_0152124 3300049572 Bacteria 1951
302 Ga0501036_0328076 3300049572 Bacteria 1279
303 Ga0501037_0006980 3300049573 Bacteria 8248
304 Ga0501037_0127455 3300049573 Bacteria 1826
305 Ga0501037_0147132 3300049573 Bacteria 1685
306 Ga0501037_0218874 3300049573 Bacteria 1340
307 Ga0501037_0458967 3300049573 Bacteria 868
308 Ga0501037_0506459 3300049573 Bacteria 818
309 Ga0501038_0001533 3300049574 Bacteria 21322
310 Ga0501038_0001876 3300049574 Bacteria 19413
311 Ga0501038_0010497 3300049574 Bacteria 8470
312 Ga0501038_0018606 3300049574 Bacteria 6274
313 Ga0501038_0105374 3300049574 Bacteria 2342
314 Ga0501038_0135687 3300049574 Bacteria 2016
315 Ga0501039_0002361 3300049575 Bacteria 14059
316 Ga0501039_0026034 3300049575 Bacteria 4496
317 Ga0501039_0051994 3300049575 Bacteria 3170
318 Ga0501039_0205880 3300049575 Bacteria 1547
319 Ga0501039_0211278 3300049575 Unclassified 1526
320 Ga0501039_0269478 3300049575 Bacteria 1338
321 Ga0501040_0050654 3300049576 Unclassified 2841
322 Ga0501040_0070432 3300049576 Bacteria 2413
323 Ga0501041_0000587 3300049577 Bacteria 18994
324 Ga0501042_0000391 3300049578 Bacteria 22243
325 Ga0501042_0004969 3300049578 Bacteria 8514
326 Ga0501042_0194529 3300049578 Unclassified 1463
327 Ga0501042_0431817 3300049578 Unclassified 955
328 Ga0501042_0991331 3300049578 Bacteria 612
329 Ga0501043_0001677 3300049579 Bacteria 19235
330 Ga0501043_0010953 3300049579 Bacteria 7104
331 Ga0501043_0019961 3300049579 Bacteria 5258
332 Ga0501043_0027333 3300049579 Bacteria 4479
333 Ga0501043_0042533 3300049579 Bacteria 3570
334 Ga0501043_0421204 3300049579 Bacteria 1007
335 Ga0501043_0501720 3300049579 Bacteria 906
336 Ga0501043_0707411 3300049579 Bacteria 735
337 Ga0501043_1098186 3300049579 Bacteria 562
338 Ga0501046_0004596 3300049580 Bacteria 12463
339 Ga0501046_0011543 3300049580 Bacteria 7554
340 Ga0501046_0012511 3300049580 Bacteria 7220
341 Ga0501046_0020951 3300049580 Bacteria 5397
342 Ga0501046_0113752 3300049580 Bacteria 2065
343 Ga0501046_0170372 3300049580 Bacteria 1634
344 Ga0501046_0877479 3300049580 Bacteria 626
345 Ga0501047_0000672 3300049581 Bacteria 35614
346 Ga0501047_0021411 3300049581 Bacteria 6206
347 Ga0501047_0027721 3300049581 Bacteria 5458
348 Ga0501047_0116029 3300049581 Bacteria 2559
349 Ga0501047_0426341 3300049581 Archaea 1157
350 Ga0501047_0651520 3300049581 Bacteria 872
351 Ga0501047_1078159 3300049581 Bacteria 616
352 Ga0501048_0004205 3300049582 Bacteria 10975
353 Ga0501048_0012482 3300049582 Bacteria 6321
354 Ga0501048_0016076 3300049582 Bacteria 5518
355 Ga0501048_0018875 3300049582 Bacteria 5069
356 Ga0501048_0292312 3300049582 Bacteria 1159
357 Ga0501048_1385736 3300049582 Bacteria 505
358 Ga0501067_0001423 3300049583 Bacteria 12980
359 Ga0501067_0042408 3300049583 Bacteria 2526
360 Ga0501067_0093995 3300049583 Bacteria 1664
361 Ga0501067_0152920 3300049583 Bacteria 1285
362 Ga0501067_0317643 3300049583 Bacteria 867
363 Ga0501068_0001033 3300049584 Bacteria 14713
364 Ga0501068_0003925 3300049584 Bacteria 8088
365 Ga0501068_0010123 3300049584 Bacteria 5290
366 Ga0501068_0020867 3300049584 Bacteria 3823
367 Ga0501068_0057745 3300049584 Bacteria 2353
368 Ga0501068_0077591 3300049584 Bacteria 2034
369 Ga0501068_0095707 3300049584 Bacteria 1836
370 Ga0501068_1146879 3300049584 Bacteria 514
371 Ga0501069_0007053 3300049585 Bacteria 5885
372 Ga0501069_0011726 3300049585 Bacteria 4647
373 Ga0501069_0017111 3300049585 Bacteria 3898
374 Ga0501069_0041083 3300049585 Bacteria 2555
375 Ga0501069_0118412 3300049585 Bacteria 1511
376 Ga0501070_0010428 3300049586 Bacteria 7855
377 Ga0501070_0042834 3300049586 Bacteria 3769
378 Ga0501070_0051156 3300049586 Bacteria 3429
379 Ga0501070_0098590 3300049586 Bacteria 2417
380 Ga0501070_0176751 3300049586 Bacteria 1757
381 Ga0501070_0538753 3300049586 Bacteria 935
382 Ga0501070_0702895 3300049586 Bacteria 799
383 Ga0501070_1426614 3300049586 Bacteria 525
384 Ga0501071_0003832 3300049587 Bacteria 9463
385 Ga0501071_0009869 3300049587 Bacteria 6375
386 Ga0501071_0053663 3300049587 Bacteria 2907
387 Ga0501072_0068310 3300049588 Bacteria 2805
388 Ga0501072_0093080 3300049588 Bacteria 2394
389 Ga0501072_0140658 3300049588 Bacteria 1924
390 Ga0501072_0269755 3300049588 Bacteria 1354
391 Ga0501072_0628910 3300049588 Bacteria 846
392 Ga0501073_0001003 3300049589 Bacteria 20354
393 Ga0501073_0001968 3300049589 Bacteria 15328
394 Ga0501073_0002853 3300049589 Bacteria 12950
395 Ga0501073_0009036 3300049589 Bacteria 7357
396 Ga0501073_0021043 3300049589 Bacteria 4705
397 Ga0501073_0134012 3300049589 Bacteria 1717
398 Ga0501073_0158865 3300049589 Bacteria 1566
399 Ga0501073_0172449 3300049589 Bacteria 1497
400 Ga0501073_0201233 3300049589 Bacteria 1377
401 Ga0501073_0406571 3300049589 Bacteria 940
402 Ga0501073_0508882 3300049589 Bacteria 832
403 Ga0501073_0685519 3300049589 Bacteria 707
404 Ga0501073_0721827 3300049589 Bacteria 687
405 Ga0501074_0006135 3300049590 Bacteria 8679
406 Ga0501074_0022169 3300049590 Bacteria 4614
407 Ga0501074_0036897 3300049590 Bacteria 3541
408 Ga0501074_0225693 3300049590 Bacteria 1333
409 Ga0501074_0411242 3300049590 Bacteria 959
410 Ga0501075_0001277 3300049591 Bacteria 16334
411 Ga0501075_0043593 3300049591 Bacteria 3365
412 Ga0501075_0206498 3300049591 Bacteria 1498
413 Ga0501075_1054500 3300049591 Bacteria 617
414 Ga0501076_0000412 3300049592 Bacteria 26808
415 Ga0501076_0049240 3300049592 Bacteria 3332
416 Ga0501076_0408257 3300049592 Bacteria 1117
417 Ga0501076_0554024 3300049592 Bacteria 948
418 Ga0501077_0002876 3300049593 Bacteria 10325
419 Ga0501077_0016947 3300049593 Bacteria 4596
420 Ga0501077_0841569 3300049593 Bacteria 590
421 Ga0501198_070202 3300049649 Unclassified 659
422 Ga0501202_000334 3300049652 Bacteria 6563
423 Ga0501209_089751 3300049656 Unclassified 893
424 Ga0501217_005948 3300049661 Unclassified 2572
425 Ga0501223_018294 3300049663 Bacteria 1379
426 Ga0501235_006794 3300049669 Unclassified 2491
427 Ga0501243_046859 3300049675 Unclassified 772
428 Ga0501251_068910 3300049681 Unclassified 599
429 Ga0501259_089020 3300049688 Unclassified 691
430 Ga0501079_0001173 3300049741 Bacteria 18345
431 Ga0501079_0003292 3300049741 Bacteria 11839
432 Ga0501079_0009677 3300049741 Bacteria 7308
433 Ga0501079_0011678 3300049741 Bacteria 6708
434 Ga0501079_0013007 3300049741 Bacteria 6348
435 Ga0501079_0336574 3300049741 Bacteria 1182
436 Ga0501080_0003155 3300049742 Bacteria 14524
437 Ga0501080_0012816 3300049742 Bacteria 7690
438 Ga0501080_0017981 3300049742 Bacteria 6544
439 Ga0501080_0025300 3300049742 Bacteria 5508
440 Ga0501080_0025805 3300049742 Bacteria 5458
441 Ga0501080_0050224 3300049742 Bacteria 3883
442 Ga0501080_0140220 3300049742 Bacteria 2235
443 Ga0501080_0172594 3300049742 Bacteria 1993
444 Ga0501080_0250064 3300049742 Bacteria 1616
445 Ga0501080_0286802 3300049742 Bacteria 1496
446 Ga0501081_0000348 3300049743 Bacteria 24908
447 Ga0501081_0708901 3300049743 Bacteria 756
448 Ga0501083_0007763 3300049744 Bacteria 7599
449 Ga0501083_0008716 3300049744 Bacteria 7155
450 Ga0501083_0015132 3300049744 Bacteria 5401
451 Ga0501083_0017965 3300049744 Bacteria 4932
452 Ga0501083_0025659 3300049744 Bacteria 4079
453 Ga0501083_0394376 3300049744 Bacteria 900
454 Ga0501083_0403326 3300049744 Bacteria 889
455 Ga0501083_0507678 3300049744 Bacteria 785
456 Ga0501083_0816848 3300049744 Bacteria 607
457 Ga0501283_014402 3300049779 Unclassified 1208
458 Ga0501035_0014206 3300049822 Bacteria 7349
459 Ga0501035_0021905 3300049822 Bacteria 5871
460 Ga0501035_0028354 3300049822 Bacteria 5111
461 Ga0501035_0179391 3300049822 Bacteria 1825
462 Ga0501035_0277765 3300049822 Bacteria 1416
463 Ga0501035_1361221 3300049822 Bacteria 545
464 Ga0501044_0002768 3300049823 Bacteria 19967
465 Ga0501044_0015183 3300049823 Bacteria 8295
466 Ga0501044_0028084 3300049823 Bacteria 5938
467 Ga0501044_0099216 3300049823 Bacteria 2931
468 Ga0501044_0172187 3300049823 Bacteria 2135
469 Ga0501044_0192142 3300049823 Bacteria 2003
470 Ga0501044_0778168 3300049823 Bacteria 837
471 Ga0501045_0152968 3300049824 Bacteria 1716
472 Ga0501045_0189846 3300049824 Bacteria 1531
473 Ga0501045_0279195 3300049824 Bacteria 1243
474 Ga0501045_0305433 3300049824 Bacteria 1184
475 Ga0501045_0932320 3300049824 Bacteria 638
476 Ga0501204_086157 3300049850 Unclassified 541
477 Ga0501212_009825 3300049851 Bacteria 1356
478 nmdc:mga0qj67_308791_c1 3300050509 Unclassified 1281
479 nmdc:mga06r32_206753_c1 3300050510 Unclassified 1951
480 nmdc:mga0n895_741640_c1 3300050512 Bacteria 976
481 Ga0500644_0208401 3300053088 Bacteria 811
482 Ga0500651_0298485 3300053093 Bacteria 925
483 Ga0500554_006628 3300053102 Bacteria 2611
484 Ga0500628_000090 3300053129 Bacteria 20726
485 Ga0500588_0223324 3300053146 Bacteria 703
486 Ga0500622_0085752 3300053156 Bacteria 1570
487 Ga0500611_000003 3300053727 Bacteria 333431
488 Ga0500611_122139 3300053727 Bacteria 695
489 Ga0501084_0000890 3300054114 Bacteria 23099
490 Ga0501084_0001467 3300054114 Bacteria 18726
491 Ga0501084_0045341 3300054114 Bacteria 3681
492 Ga0501084_0158630 3300054114 Bacteria 1909
493 Ga0501084_1041443 3300054114 Bacteria 687
494 Ga0590071_003604 3300059421 Bacteria 3801
495 Ga0590074_005397 3300059423 Bacteria 2117
496 Ga0590075_002611 3300059424 Bacteria 4303
497 Ga0501082_0001044 3300060353 Bacteria 24497
498 Ga0501082_0006505 3300060353 Bacteria 10128
499 Ga0501082_0007238 3300060353 Bacteria 9569
500 Ga0501082_0007715 3300060353 Bacteria 9288
501 Ga0501082_0019516 3300060353 Bacteria 5844
502 Ga0501082_0097663 3300060353 Bacteria 2539
503 Ga0501082_0170153 3300060353 Unclassified 1894
504 Ga0501082_0253077 3300060353 Bacteria 1532
505 Ga0530510_0000789 3300061734 Bacteria 20601
506 Ga0530510_0272882 3300061734 Bacteria 1262
507 Ga0530510_0672716 3300061734 Bacteria 788
508 Ga0530510_0808097 3300061734 Bacteria 716
509 Ga0530510_1182618 3300061734 Bacteria 586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041460 Ga0451802_1218583 Ga0451802_1218583_298_600 100
2 3300009148 Ga0105243_10165445 Ga0105243_101654452 107
3 3300005328 Ga0070676_10507766 Ga0070676_105077662 108
4 3300005333 Ga0070677_10113928 Ga0070677_101139282 108
5 3300005354 Ga0070675_101184866 Ga0070675_1011848662 108
6 3300005356 Ga0070674_100091868 Ga0070674_1000918682 108
7 3300005455 Ga0070663_100360082 Ga0070663_1003600822 108
8 3300005719 Ga0068861_100715636 Ga0068861_1007156362 108
9 3300005844 Ga0068862_100021241 Ga0068862_1000212414 108
10 3300006881 Ga0068865_100275792 Ga0068865_1002757922 108
11 3300014326 Ga0157380_10003419 Ga0157380_100034197 108
12 3300025893 Ga0207682_10108769 Ga0207682_101087692 108
13 3300025907 Ga0207645_10237465 Ga0207645_102374651 108
14 3300025926 Ga0207659_10194794 Ga0207659_101947942 108
15 3300025933 Ga0207706_11038153 Ga0207706_110381532 108
16 3300025937 Ga0207669_11081345 Ga0207669_110813452 108
17 3300025972 Ga0207668_10238399 Ga0207668_102383993 108
18 3300026075 Ga0207708_10045404 Ga0207708_100454042 108
19 3300026089 Ga0207648_10282698 Ga0207648_102826981 108
20 3300026118 Ga0207675_100218876 Ga0207675_1002188762 108
21 3300028380 Ga0268265_10280209 Ga0268265_102802093 108
22 3300042117 Ga0450913_026457 Ga0450913_026457_26_370 114
23 3300049568 Ga0501031_0083942 Ga0501031_0083942_900_1244 114
24 3300049573 Ga0501037_0458967 Ga0501037_0458967_59_403 114
25 3300049574 Ga0501038_0135687 Ga0501038_0135687_17_361 114
26 3300049575 Ga0501039_0002361 Ga0501039_0002361_11409_11753 114
27 3300049579 Ga0501043_0501720 Ga0501043_0501720_194_538 114
28 3300049583 Ga0501067_0152920 Ga0501067_0152920_496_840 114
29 3300049584 Ga0501068_0010123 Ga0501068_0010123_3926_4270 114
30 3300049585 Ga0501069_0017111 Ga0501069_0017111_3326_3670 114
31 3300049586 Ga0501070_0176751 Ga0501070_0176751_17_361 114
32 3300049589 Ga0501073_0009036 Ga0501073_0009036_5416_5760 114
33 3300049589 Ga0501073_0406571 Ga0501073_0406571_148_492 114
34 3300049593 Ga0501077_0841569 Ga0501077_0841569_15_359 114
35 3300049742 Ga0501080_0012816 Ga0501080_0012816_6302_6646 114
36 3300049744 Ga0501083_0403326 Ga0501083_0403326_368_712 114
37 3300049823 Ga0501044_0099216 Ga0501044_0099216_268_612 114
38 3300060353 Ga0501082_0006505 Ga0501082_0006505_3233_3577 114
39 3300061734 Ga0530510_1182618 Ga0530510_1182618_199_543 114
40 3300041460 Ga0451802_0637869 Ga0451802_0637869_13_360 115
41 3300053727 Ga0500611_000003 Ga0500611_000003_107365_107712 115
42 3300045051 Ga0451576_0958319 Ga0451576_0958319_19_372 116
43 3300037471 Ga0395905_0017401 Ga0395905_0017401_5156_5515 117
44 3300041458 Ga0451798_0499475 Ga0451798_0499475_14_367 117
45 3300041459 Ga0451800_0097960 Ga0451800_0097960_175_531 117
46 3300041486 Ga0451807_1555911 Ga0451807_1555911_627_980 117
47 3300041491 Ga0451833_0756336 Ga0451833_0756336_1079_1432 117
48 3300041512 Ga0451853_0739330 Ga0451853_0739330_131_487 117
49 3300053102 Ga0500554_006628 Ga0500554_006628_1976_2332 117
50 3300053129 Ga0500628_000090 Ga0500628_000090_8007_8363 117
51 3300028800 Ga0265338_10052750 Ga0265338_100527504 118
52 3300031731 Ga0307405_10047269 Ga0307405_100472693 118
53 3300031824 Ga0307413_10088360 Ga0307413_100883602 118
54 3300031852 Ga0307410_10171559 Ga0307410_101715592 118
55 3300031911 Ga0307412_10150171 Ga0307412_101501712 118
56 3300032126 Ga0307415_100097123 Ga0307415_1000971232 118
57 3300049571 Ga0501034_0080530 Ga0501034_0080530_591_953 118
58 3300049649 Ga0501198_070202 Ga0501198_070202_194_559 118
59 3300049652 Ga0501202_000334 Ga0501202_000334_4759_5124 118
60 3300049656 Ga0501209_089751 Ga0501209_089751_41_406 118
61 3300049661 Ga0501217_005948 Ga0501217_005948_831_1196 118
62 3300049663 Ga0501223_018294 Ga0501223_018294_933_1298 118
63 3300049669 Ga0501235_006794 Ga0501235_006794_1857_2222 118
64 3300049675 Ga0501243_046859 Ga0501243_046859_134_499 118
65 3300049688 Ga0501259_089020 Ga0501259_089020_32_397 118
66 3300049779 Ga0501283_014402 Ga0501283_014402_796_1161 118
67 3300049850 Ga0501204_086157 Ga0501204_086157_165_530 118
68 3300049851 Ga0501212_009825 Ga0501212_009825_107_472 118
69 3300005337 Ga0070682_100243965 Ga0070682_1002439652 119
70 3300005355 Ga0070671_100599183 Ga0070671_1005991832 119
71 3300005466 Ga0070685_10095318 Ga0070685_100953183 119
72 3300005546 Ga0070696_100150207 Ga0070696_1001502072 119
73 3300005617 Ga0068859_102965558 Ga0068859_1029655582 119
74 3300005841 Ga0068863_100577934 Ga0068863_1005779342 119
75 3300005843 Ga0068860_100536328 Ga0068860_1005363283 119
76 3300009551 Ga0105238_10837978 Ga0105238_108379781 119
77 3300026023 Ga0207677_11928530 Ga0207677_119285302 119
78 3300026088 Ga0207641_10618194 Ga0207641_106181942 119
79 3300031731 Ga0307405_10064844 Ga0307405_100648442 119
80 3300031903 Ga0307407_10929278 Ga0307407_109292782 119
81 3300031911 Ga0307412_10253937 Ga0307412_102539373 119
82 3300032002 Ga0307416_100120156 Ga0307416_1001201562 119
83 3300032002 Ga0307416_100463169 Ga0307416_1004631693 119
84 3300049575 Ga0501039_0205880 Ga0501039_0205880_770_1144 119
85 3300049578 Ga0501042_0431817 Ga0501042_0431817_231_590 119
86 3300049578 Ga0501042_0991331 Ga0501042_0991331_92_466 119
87 3300049582 Ga0501048_1385736 Ga0501048_1385736_79_453 119
88 3300049583 Ga0501067_0042408 Ga0501067_0042408_1928_2302 119
89 3300049584 Ga0501068_0057745 Ga0501068_0057745_221_595 119
90 3300049586 Ga0501070_0098590 Ga0501070_0098590_1459_1833 119
91 3300049587 Ga0501071_0009869 Ga0501071_0009869_586_960 119
92 3300049588 Ga0501072_0093080 Ga0501072_0093080_1669_2043 119
93 3300049588 Ga0501072_0628910 Ga0501072_0628910_386_745 119
94 3300049589 Ga0501073_0001968 Ga0501073_0001968_2382_2756 119
95 3300049589 Ga0501073_0685519 Ga0501073_0685519_19_378 119
96 3300049590 Ga0501074_0022169 Ga0501074_0022169_2516_2890 119
97 3300049591 Ga0501075_0043593 Ga0501075_0043593_36_410 119
98 3300049592 Ga0501076_0049240 Ga0501076_0049240_1279_1653 119
99 3300049593 Ga0501077_0016947 Ga0501077_0016947_2854_3228 119
100 3300049741 Ga0501079_0003292 Ga0501079_0003292_9706_10080 119
101 3300049742 Ga0501080_0017981 Ga0501080_0017981_1107_1481 119
102 3300049744 Ga0501083_0015132 Ga0501083_0015132_2574_2948 119
103 3300059421 Ga0590071_003604 Ga0590071_003604_61_420 119
104 3300059423 Ga0590074_005397 Ga0590074_005397_145_504 119
105 3300059424 Ga0590075_002611 Ga0590075_002611_1969_2328 119
106 3300060353 Ga0501082_0097663 Ga0501082_0097663_599_973 119
107 3300061734 Ga0530510_0272882 Ga0530510_0272882_530_904 119
108 3300061734 Ga0530510_0808097 Ga0530510_0808097_41_400 119
109 3300005329 Ga0070683_100301911 Ga0070683_1003019113 120
110 3300005347 Ga0070668_100260782 Ga0070668_1002607821 120
111 3300005356 Ga0070674_100234853 Ga0070674_1002348533 120
112 3300005444 Ga0070694_100036916 Ga0070694_1000369164 120
113 3300005445 Ga0070708_100057040 Ga0070708_1000570403 120
114 3300005456 Ga0070678_100758943 Ga0070678_1007589432 120
115 3300005467 Ga0070706_100018051 Ga0070706_1000180517 120
116 3300005467 Ga0070706_100777559 Ga0070706_1007775591 120
117 3300005468 Ga0070707_100092162 Ga0070707_1000921623 120
118 3300005518 Ga0070699_100415084 Ga0070699_1004150842 120
119 3300005536 Ga0070697_100073024 Ga0070697_1000730242 120
120 3300005546 Ga0070696_100125025 Ga0070696_1001250252 120
121 3300005564 Ga0070664_100390391 Ga0070664_1003903912 120
122 3300006173 Ga0070716_101639833 Ga0070716_1016398332 120
123 3300006844 Ga0075428_100317189 Ga0075428_1003171893 120
124 3300006881 Ga0068865_100281417 Ga0068865_1002814172 120
125 3300013308 Ga0157375_12088667 Ga0157375_120886671 120
126 3300025910 Ga0207684_10020492 Ga0207684_100204922 120
127 3300025922 Ga0207646_10174461 Ga0207646_101744613 120
128 3300025933 Ga0207706_11415134 Ga0207706_114151342 120
129 3300025937 Ga0207669_10060053 Ga0207669_100600533 120
130 3300025945 Ga0207679_10080620 Ga0207679_100806204 120
131 3300025972 Ga0207668_11807885 Ga0207668_118078852 120
132 3300025986 Ga0207658_11465228 Ga0207658_114652281 120
133 3300031824 Ga0307413_11183000 Ga0307413_111830001 120
134 3300031995 Ga0307409_102262302 Ga0307409_1022623021 120
135 3300032002 Ga0307416_101738815 Ga0307416_1017388152 120
136 3300032126 Ga0307415_100280968 Ga0307415_1002809682 120
137 3300041486 Ga0451807_0288429 Ga0451807_0288429_1762_2139 120
138 3300041486 Ga0451807_1787862 Ga0451807_1787862_106_471 120
139 3300041496 Ga0451839_0598727 Ga0451839_0598727_417_794 120
140 3300042184 Ga0450908_061023 Ga0450908_061023_144_506 120
141 3300005293 Ga0065715_10508134 Ga0065715_105081341 121
142 3300005295 Ga0065707_10273364 Ga0065707_102733642 121
143 3300005328 Ga0070676_10634643 Ga0070676_106346432 121
144 3300005330 Ga0070690_100033085 Ga0070690_1000330855 121
145 3300005331 Ga0070670_100153072 Ga0070670_1001530724 121
146 3300005334 Ga0068869_100005980 Ga0068869_1000059809 121
147 3300005335 Ga0070666_10013191 Ga0070666_100131915 121
148 3300005335 Ga0070666_10115348 Ga0070666_101153482 121
149 3300005338 Ga0068868_100024980 Ga0068868_1000249803 121
150 3300005340 Ga0070689_100265672 Ga0070689_1002656722 121
151 3300005345 Ga0070692_10553750 Ga0070692_105537502 121
152 3300005353 Ga0070669_100015157 Ga0070669_1000151573 121
153 3300005354 Ga0070675_100002098 Ga0070675_1000020988 121
154 3300005355 Ga0070671_100016938 Ga0070671_1000169388 121
155 3300005355 Ga0070671_100071666 Ga0070671_1000716662 121
156 3300005356 Ga0070674_100045702 Ga0070674_1000457025 121
157 3300005364 Ga0070673_100009034 Ga0070673_1000090344 121
158 3300005364 Ga0070673_100052353 Ga0070673_1000523534 121
159 3300005364 Ga0070673_100870496 Ga0070673_1008704961 121
160 3300005365 Ga0070688_100058984 Ga0070688_1000589844 121
161 3300005367 Ga0070667_100038864 Ga0070667_1000388645 121
162 3300005435 Ga0070714_100400242 Ga0070714_1004002422 121
163 3300005438 Ga0070701_10790681 Ga0070701_107906811 121
164 3300005440 Ga0070705_100257378 Ga0070705_1002573782 121
165 3300005444 Ga0070694_101168430 Ga0070694_1011684301 121
166 3300005445 Ga0070708_100001699 Ga0070708_10000169921 121
167 3300005445 Ga0070708_101991496 Ga0070708_1019914961 121
168 3300005455 Ga0070663_100438011 Ga0070663_1004380112 121
169 3300005456 Ga0070678_100001242 Ga0070678_1000012426 121
170 3300005459 Ga0068867_100000367 Ga0068867_1000003678 121
171 3300005459 Ga0068867_100281540 Ga0068867_1002815402 121
172 3300005468 Ga0070707_100033649 Ga0070707_1000336496 121
173 3300005468 Ga0070707_101136656 Ga0070707_1011366561 121
174 3300005471 Ga0070698_101035673 Ga0070698_1010356731 121
175 3300005518 Ga0070699_100409423 Ga0070699_1004094231 121
176 3300005545 Ga0070695_100296211 Ga0070695_1002962113 121
177 3300005548 Ga0070665_100001624 Ga0070665_10000162422 121
178 3300005578 Ga0068854_100188250 Ga0068854_1001882502 121
179 3300005617 Ga0068859_100001501 Ga0068859_10000150122 121
180 3300005617 Ga0068859_100172415 Ga0068859_1001724154 121
181 3300005618 Ga0068864_100004247 Ga0068864_1000042476 121
182 3300005618 Ga0068864_100604929 Ga0068864_1006049292 121
183 3300005719 Ga0068861_100332957 Ga0068861_1003329573 121
184 3300005840 Ga0068870_10344118 Ga0068870_103441182 121
185 3300005841 Ga0068863_100025066 Ga0068863_1000250668 121
186 3300005842 Ga0068858_100001313 Ga0068858_10000131325 121
187 3300005842 Ga0068858_100408074 Ga0068858_1004080742 121
188 3300005842 Ga0068858_101188076 Ga0068858_1011880761 121
189 3300005843 Ga0068860_100014541 Ga0068860_1000145412 121
190 3300005843 Ga0068860_100164032 Ga0068860_1001640323 121
191 3300005843 Ga0068860_100688315 Ga0068860_1006883152 121
192 3300005844 Ga0068862_100118279 Ga0068862_1001182791 121
193 3300005844 Ga0068862_100148997 Ga0068862_1001489974 121
194 3300005983 Ga0081540_1149605 Ga0081540_11496052 121
195 3300006237 Ga0097621_100031107 Ga0097621_1000311075 121
196 3300006358 Ga0068871_100144358 Ga0068871_1001443584 121
197 3300006844 Ga0075428_100016532 Ga0075428_1000165324 121
198 3300006844 Ga0075428_100460520 Ga0075428_1004605203 121
199 3300006846 Ga0075430_100302833 Ga0075430_1003028333 121
200 3300006847 Ga0075431_100078582 Ga0075431_1000785823 121
201 3300006871 Ga0075434_100093014 Ga0075434_1000930143 121
202 3300006881 Ga0068865_100005226 Ga0068865_1000052264 121
203 3300006881 Ga0068865_100557130 Ga0068865_1005571301 121
204 3300006931 Ga0097620_100001501 Ga0097620_1000015012 121
205 3300006931 Ga0097620_100172421 Ga0097620_1001724214 121
206 3300009098 Ga0105245_10185937 Ga0105245_101859374 121
207 3300009098 Ga0105245_11348768 Ga0105245_113487682 121
208 3300009148 Ga0105243_11202854 Ga0105243_112028542 121
209 3300009174 Ga0105241_10266413 Ga0105241_102664132 121
210 3300009177 Ga0105248_10004124 Ga0105248_1000412414 121
211 3300009177 Ga0105248_10689858 Ga0105248_106898583 121
212 3300009553 Ga0105249_10355598 Ga0105249_103555983 121
213 3300013296 Ga0157374_10002767 Ga0157374_1000276714 121
214 3300013306 Ga0163162_10020421 Ga0163162_100204215 121
215 3300013308 Ga0157375_10267740 Ga0157375_102677402 121
216 3300014968 Ga0157379_10081584 Ga0157379_100815844 121
217 3300014969 Ga0157376_10217713 Ga0157376_102177134 121
218 3300017792 Ga0163161_10016677 Ga0163161_100166775 121
219 3300025903 Ga0207680_10178582 Ga0207680_101785822 121
220 3300025907 Ga0207645_10000234 Ga0207645_1000023425 121
221 3300025907 Ga0207645_10332440 Ga0207645_103324401 121
222 3300025908 Ga0207643_10309959 Ga0207643_103099592 121
223 3300025911 Ga0207654_11368703 Ga0207654_113687032 121
224 3300025922 Ga0207646_10178833 Ga0207646_101788332 121
225 3300025925 Ga0207650_10812497 Ga0207650_108124972 121
226 3300025926 Ga0207659_10649481 Ga0207659_106494812 121
227 3300025927 Ga0207687_10885901 Ga0207687_108859012 121
228 3300025929 Ga0207664_10091862 Ga0207664_100918623 121
229 3300025931 Ga0207644_10044750 Ga0207644_100447504 121
230 3300025931 Ga0207644_10113453 Ga0207644_101134532 121
231 3300025935 Ga0207709_10214107 Ga0207709_102141073 121
232 3300025937 Ga0207669_10046307 Ga0207669_100463072 121
233 3300025938 Ga0207704_10060920 Ga0207704_100609204 121
234 3300025940 Ga0207691_10000195 Ga0207691_1000019512 121
235 3300025941 Ga0207711_10017039 Ga0207711_100170394 121
236 3300025941 Ga0207711_10385659 Ga0207711_103856592 121
237 3300025942 Ga0207689_10008885 Ga0207689_100088855 121
238 3300025960 Ga0207651_10072127 Ga0207651_100721273 121
239 3300025960 Ga0207651_10090887 Ga0207651_100908875 121
240 3300025961 Ga0207712_10264543 Ga0207712_102645432 121
241 3300025986 Ga0207658_10021855 Ga0207658_100218555 121
242 3300026023 Ga0207677_11351892 Ga0207677_113518922 121
243 3300026035 Ga0207703_10292724 Ga0207703_102927242 121
244 3300026035 Ga0207703_10545166 Ga0207703_105451662 121
245 3300026035 Ga0207703_12196007 Ga0207703_121960071 121
246 3300026088 Ga0207641_10005044 Ga0207641_1000504413 121
247 3300026089 Ga0207648_10000793 Ga0207648_1000079322 121
248 3300026089 Ga0207648_10167513 Ga0207648_101675133 121
249 3300026095 Ga0207676_10008225 Ga0207676_1000822510 121
250 3300026095 Ga0207676_11306826 Ga0207676_113068262 121
251 3300026118 Ga0207675_100050657 Ga0207675_1000506576 121
252 3300026118 Ga0207675_100188916 Ga0207675_1001889163 121
253 3300026121 Ga0207683_10000921 Ga0207683_100009218 121
254 3300028379 Ga0268266_10448941 Ga0268266_104489412 121
255 3300028380 Ga0268265_10008572 Ga0268265_100085728 121
256 3300028381 Ga0268264_10058579 Ga0268264_100585796 121
257 3300028381 Ga0268264_10504440 Ga0268264_105044402 121
258 3300031911 Ga0307412_11011258 Ga0307412_110112582 121
259 3300035086 Ga0373934_0168065 Ga0373934_0168065_98_463 121
260 3300035172 Ga0373955_0606969 Ga0373955_0606969_98_463 121
261 3300036401 Ga0373937_0520530 Ga0373937_0520530_84_449 121
262 3300036401 Ga0373937_0765396 Ga0373937_0765396_59_424 121
263 3300041486 Ga0451807_1385818 Ga0451807_1385818_11_376 121
264 3300042003 Ga0439443_122031 Ga0439443_122031_26_391 121
265 3300042126 Ga0450888_043989 Ga0450888_043989_209_595 121
266 3300042134 Ga0450898_008088 Ga0450898_008088_844_1230 121
267 3300042436 Ga0439435_0003806 Ga0439435_0003806_2583_2948 121
268 3300042461 Ga0439460_0058206 Ga0439460_0058206_184_549 121
269 3300042532 Ga0450893_0080311 Ga0450893_0080311_43_411 121
270 3300044683 Ga0466965_0018830 Ga0466965_0018830_2398_2763 121
271 3300046616 Ga0495668_0149755 Ga0495668_0149755_765_1142 121
272 3300048911 Ga0496108_0079441 Ga0496108_0079441_1209_1574 121
273 3300048913 Ga0496110_0102016 Ga0496110_0102016_1402_1767 121
274 3300048917 Ga0496114_0152189 Ga0496114_0152189_1604_1969 121
275 3300049568 Ga0501031_0001424 Ga0501031_0001424_5425_5793 121
276 3300049568 Ga0501031_0025890 Ga0501031_0025890_2098_2469 121
277 3300049568 Ga0501031_0063582 Ga0501031_0063582_709_1086 121
278 3300049568 Ga0501031_0096317 Ga0501031_0096317_1040_1405 121
279 3300049568 Ga0501031_0489640 Ga0501031_0489640_41_406 121
280 3300049569 Ga0501032_0003005 Ga0501032_0003005_4270_4635 121
281 3300049569 Ga0501032_0009842 Ga0501032_0009842_5961_6329 121
282 3300049569 Ga0501032_0024500 Ga0501032_0024500_1929_2300 121
283 3300049569 Ga0501032_0139392 Ga0501032_0139392_32_403 121
284 3300049569 Ga0501032_0230792 Ga0501032_0230792_751_1116 121
285 3300049570 Ga0501033_0000613 Ga0501033_0000613_26035_26406 121
286 3300049570 Ga0501033_0018352 Ga0501033_0018352_864_1277 121
287 3300049570 Ga0501033_0020603 Ga0501033_0020603_644_1012 121
288 3300049570 Ga0501033_0159295 Ga0501033_0159295_51_422 121
289 3300049570 Ga0501033_0238544 Ga0501033_0238544_519_884 121
290 3300049571 Ga0501034_0005129 Ga0501034_0005129_7774_8139 121
291 3300049571 Ga0501034_0014676 Ga0501034_0014676_6119_6490 121
292 3300049571 Ga0501034_0018000 Ga0501034_0018000_6261_6674 121
293 3300049571 Ga0501034_0020267 Ga0501034_0020267_5860_6228 121
294 3300049572 Ga0501036_0000820 Ga0501036_0000820_3508_3876 121
295 3300049572 Ga0501036_0002241 Ga0501036_0002241_7933_8304 121
296 3300049572 Ga0501036_0005381 Ga0501036_0005381_5732_6097 121
297 3300049572 Ga0501036_0032145 Ga0501036_0032145_912_1325 121
298 3300049572 Ga0501036_0069349 Ga0501036_0069349_140_505 121
299 3300049572 Ga0501036_0152124 Ga0501036_0152124_577_942 121
300 3300049572 Ga0501036_0328076 Ga0501036_0328076_869_1234 121
301 3300049573 Ga0501037_0006980 Ga0501037_0006980_5944_6312 121
302 3300049573 Ga0501037_0127455 Ga0501037_0127455_1421_1792 121
303 3300049573 Ga0501037_0147132 Ga0501037_0147132_296_661 121
304 3300049573 Ga0501037_0218874 Ga0501037_0218874_249_662 121
305 3300049573 Ga0501037_0506459 Ga0501037_0506459_147_512 121
306 3300049574 Ga0501038_0001533 Ga0501038_0001533_13116_13481 121
307 3300049574 Ga0501038_0001876 Ga0501038_0001876_12254_12625 121
308 3300049574 Ga0501038_0010497 Ga0501038_0010497_3508_3876 121
309 3300049574 Ga0501038_0018606 Ga0501038_0018606_2879_3292 121
310 3300049574 Ga0501038_0105374 Ga0501038_0105374_1736_2101 121
311 3300049575 Ga0501039_0026034 Ga0501039_0026034_3030_3395 121
312 3300049575 Ga0501039_0051994 Ga0501039_0051994_1632_2003 121
313 3300049575 Ga0501039_0211278 Ga0501039_0211278_792_1169 121
314 3300049575 Ga0501039_0269478 Ga0501039_0269478_725_1093 121
315 3300049576 Ga0501040_0050654 Ga0501040_0050654_92_457 121
316 3300049576 Ga0501040_0070432 Ga0501040_0070432_152_517 121
317 3300049577 Ga0501041_0000587 Ga0501041_0000587_15782_16147 121
318 3300049578 Ga0501042_0000391 Ga0501042_0000391_11905_12270 121
319 3300049578 Ga0501042_0004969 Ga0501042_0004969_311_682 121
320 3300049578 Ga0501042_0194529 Ga0501042_0194529_241_606 121
321 3300049579 Ga0501043_0001677 Ga0501043_0001677_13839_14204 121
322 3300049579 Ga0501043_0010953 Ga0501043_0010953_5925_6296 121
323 3300049579 Ga0501043_0019961 Ga0501043_0019961_2470_2838 121
324 3300049579 Ga0501043_0027333 Ga0501043_0027333_157_522 121
325 3300049579 Ga0501043_0042533 Ga0501043_0042533_835_1248 121
326 3300049579 Ga0501043_0421204 Ga0501043_0421204_229_594 121
327 3300049579 Ga0501043_0707411 Ga0501043_0707411_173_538 121
328 3300049579 Ga0501043_1098186 Ga0501043_1098186_50_415 121
329 3300049580 Ga0501046_0004596 Ga0501046_0004596_5854_6219 121
330 3300049580 Ga0501046_0011543 Ga0501046_0011543_7045_7410 121
331 3300049580 Ga0501046_0012511 Ga0501046_0012511_1925_2296 121
332 3300049580 Ga0501046_0020951 Ga0501046_0020951_4595_4963 121
333 3300049580 Ga0501046_0113752 Ga0501046_0113752_1403_1816 121
334 3300049580 Ga0501046_0170372 Ga0501046_0170372_1114_1479 121
335 3300049580 Ga0501046_0877479 Ga0501046_0877479_209_574 121
336 3300049581 Ga0501047_0000672 Ga0501047_0000672_12961_13326 121
337 3300049581 Ga0501047_0021411 Ga0501047_0021411_1996_2364 121
338 3300049581 Ga0501047_0027721 Ga0501047_0027721_5022_5393 121
339 3300049581 Ga0501047_0116029 Ga0501047_0116029_373_738 121
340 3300049581 Ga0501047_0426341 Ga0501047_0426341_66_437 121
341 3300049581 Ga0501047_0651520 Ga0501047_0651520_473_838 121
342 3300049581 Ga0501047_1078159 Ga0501047_1078159_81_446 121
343 3300049582 Ga0501048_0004205 Ga0501048_0004205_3539_3907 121
344 3300049582 Ga0501048_0012482 Ga0501048_0012482_1836_2249 121
345 3300049582 Ga0501048_0016076 Ga0501048_0016076_4954_5325 121
346 3300049582 Ga0501048_0018875 Ga0501048_0018875_4289_4654 121
347 3300049582 Ga0501048_0292312 Ga0501048_0292312_529_906 121
348 3300049583 Ga0501067_0001423 Ga0501067_0001423_5879_6247 121
349 3300049583 Ga0501067_0093995 Ga0501067_0093995_419_784 121
350 3300049583 Ga0501067_0317643 Ga0501067_0317643_391_804 121
351 3300049584 Ga0501068_0001033 Ga0501068_0001033_5624_5992 121
352 3300049584 Ga0501068_0003925 Ga0501068_0003925_2998_3363 121
353 3300049584 Ga0501068_0020867 Ga0501068_0020867_3170_3535 121
354 3300049584 Ga0501068_0077591 Ga0501068_0077591_833_1246 121
355 3300049584 Ga0501068_0095707 Ga0501068_0095707_1385_1756 121
356 3300049584 Ga0501068_1146879 Ga0501068_1146879_32_397 121
357 3300049585 Ga0501069_0007053 Ga0501069_0007053_2499_2864 121
358 3300049585 Ga0501069_0011726 Ga0501069_0011726_125_496 121
359 3300049585 Ga0501069_0041083 Ga0501069_0041083_653_1021 121
360 3300049585 Ga0501069_0118412 Ga0501069_0118412_881_1294 121
361 3300049586 Ga0501070_0010428 Ga0501070_0010428_512_883 121
362 3300049586 Ga0501070_0042834 Ga0501070_0042834_1458_1871 121
363 3300049586 Ga0501070_0051156 Ga0501070_0051156_823_1191 121
364 3300049586 Ga0501070_0538753 Ga0501070_0538753_404_769 121
365 3300049586 Ga0501070_0702895 Ga0501070_0702895_416_781 121
366 3300049586 Ga0501070_1426614 Ga0501070_1426614_32_403 121
367 3300049587 Ga0501071_0003832 Ga0501071_0003832_7187_7552 121
368 3300049587 Ga0501071_0053663 Ga0501071_0053663_984_1352 121
369 3300049588 Ga0501072_0068310 Ga0501072_0068310_1148_1513 121
370 3300049588 Ga0501072_0140658 Ga0501072_0140658_1371_1742 121
371 3300049588 Ga0501072_0269755 Ga0501072_0269755_397_765 121
372 3300049589 Ga0501073_0001003 Ga0501073_0001003_14133_14501 121
373 3300049589 Ga0501073_0002853 Ga0501073_0002853_3498_3869 121
374 3300049589 Ga0501073_0021043 Ga0501073_0021043_1548_1961 121
375 3300049589 Ga0501073_0134012 Ga0501073_0134012_1054_1419 121
376 3300049589 Ga0501073_0158865 Ga0501073_0158865_589_954 121
377 3300049589 Ga0501073_0172449 Ga0501073_0172449_890_1255 121
378 3300049589 Ga0501073_0201233 Ga0501073_0201233_650_1015 121
379 3300049589 Ga0501073_0508882 Ga0501073_0508882_453_818 121
380 3300049589 Ga0501073_0721827 Ga0501073_0721827_251_616 121
381 3300049590 Ga0501074_0006135 Ga0501074_0006135_3432_3845 121
382 3300049590 Ga0501074_0036897 Ga0501074_0036897_2846_3214 121
383 3300049590 Ga0501074_0225693 Ga0501074_0225693_890_1255 121
384 3300049590 Ga0501074_0411242 Ga0501074_0411242_475_840 121
385 3300049591 Ga0501075_0001277 Ga0501075_0001277_549_914 121
386 3300049591 Ga0501075_0206498 Ga0501075_0206498_1007_1372 121
387 3300049591 Ga0501075_1054500 Ga0501075_1054500_124_489 121
388 3300049592 Ga0501076_0000412 Ga0501076_0000412_3607_3972 121
389 3300049592 Ga0501076_0408257 Ga0501076_0408257_564_935 121
390 3300049592 Ga0501076_0554024 Ga0501076_0554024_122_487 121
391 3300049593 Ga0501077_0002876 Ga0501077_0002876_3248_3613 121
392 3300049741 Ga0501079_0001173 Ga0501079_0001173_12024_12389 121
393 3300049741 Ga0501079_0009677 Ga0501079_0009677_6921_7289 121
394 3300049741 Ga0501079_0011678 Ga0501079_0011678_328_699 121
395 3300049741 Ga0501079_0013007 Ga0501079_0013007_857_1270 121
396 3300049741 Ga0501079_0336574 Ga0501079_0336574_52_417 121
397 3300049742 Ga0501080_0003155 Ga0501080_0003155_4157_4522 121
398 3300049742 Ga0501080_0025300 Ga0501080_0025300_5077_5445 121
399 3300049742 Ga0501080_0025805 Ga0501080_0025805_5022_5393 121
400 3300049742 Ga0501080_0050224 Ga0501080_0050224_3433_3798 121
401 3300049742 Ga0501080_0140220 Ga0501080_0140220_881_1294 121
402 3300049742 Ga0501080_0172594 Ga0501080_0172594_54_419 121
403 3300049742 Ga0501080_0250064 Ga0501080_0250064_66_437 121
404 3300049742 Ga0501080_0286802 Ga0501080_0286802_15_386 121
405 3300049743 Ga0501081_0000348 Ga0501081_0000348_23461_23826 121
406 3300049743 Ga0501081_0708901 Ga0501081_0708901_211_579 121
407 3300049744 Ga0501083_0007763 Ga0501083_0007763_3305_3718 121
408 3300049744 Ga0501083_0008716 Ga0501083_0008716_151_519 121
409 3300049744 Ga0501083_0017965 Ga0501083_0017965_2374_2745 121
410 3300049744 Ga0501083_0025659 Ga0501083_0025659_1313_1678 121
411 3300049744 Ga0501083_0507678 Ga0501083_0507678_274_651 121
412 3300049744 Ga0501083_0816848 Ga0501083_0816848_89_454 121
413 3300049822 Ga0501035_0014206 Ga0501035_0014206_1051_1422 121
414 3300049822 Ga0501035_0021905 Ga0501035_0021905_2830_3195 121
415 3300049822 Ga0501035_0028354 Ga0501035_0028354_4598_4966 121
416 3300049822 Ga0501035_0179391 Ga0501035_0179391_66_437 121
417 3300049822 Ga0501035_0277765 Ga0501035_0277765_625_990 121
418 3300049822 Ga0501035_1361221 Ga0501035_1361221_17_382 121
419 3300049823 Ga0501044_0002768 Ga0501044_0002768_10795_11160 121
420 3300049823 Ga0501044_0015183 Ga0501044_0015183_4083_4496 121
421 3300049823 Ga0501044_0028084 Ga0501044_0028084_66_437 121
422 3300049823 Ga0501044_0172187 Ga0501044_0172187_1750_2121 121
423 3300049823 Ga0501044_0192142 Ga0501044_0192142_1020_1385 121
424 3300049823 Ga0501044_0778168 Ga0501044_0778168_236_601 121
425 3300049824 Ga0501045_0152968 Ga0501045_0152968_1047_1418 121
426 3300049824 Ga0501045_0189846 Ga0501045_0189846_439_816 121
427 3300049824 Ga0501045_0279195 Ga0501045_0279195_736_1101 121
428 3300049824 Ga0501045_0305433 Ga0501045_0305433_72_485 121
429 3300049824 Ga0501045_0932320 Ga0501045_0932320_182_547 121
430 3300050509 nmdc:mga0qj67_308791_c1 nmdc:mga0qj67_308791_c1_527_895 121
431 3300050510 nmdc:mga06r32_206753_c1 nmdc:mga06r32_206753_c1_608_976 121
432 3300050512 nmdc:mga0n895_741640_c1 nmdc:mga0n895_741640_c1_60_425 121
433 3300054114 Ga0501084_0000890 Ga0501084_0000890_1035_1400 121
434 3300054114 Ga0501084_0001467 Ga0501084_0001467_17991_18356 121
435 3300054114 Ga0501084_0045341 Ga0501084_0045341_1425_1793 121
436 3300054114 Ga0501084_0158630 Ga0501084_0158630_626_1039 121
437 3300054114 Ga0501084_1041443 Ga0501084_1041443_297_662 121
438 3300060353 Ga0501082_0001044 Ga0501082_0001044_17077_17442 121
439 3300060353 Ga0501082_0007238 Ga0501082_0007238_5924_6292 121
440 3300060353 Ga0501082_0007715 Ga0501082_0007715_8107_8472 121
441 3300060353 Ga0501082_0019516 Ga0501082_0019516_3974_4387 121
442 3300060353 Ga0501082_0170153 Ga0501082_0170153_434_811 121
443 3300060353 Ga0501082_0253077 Ga0501082_0253077_810_1181 121
444 3300061734 Ga0530510_0000789 Ga0530510_0000789_7410_7775 121
445 3300061734 Ga0530510_0672716 Ga0530510_0672716_128_493 121
446 3300005438 Ga0070701_10897294 Ga0070701_108972942 122
447 3300005459 Ga0068867_100646083 Ga0068867_1006460831 122
448 3300005549 Ga0070704_100944743 Ga0070704_1009447432 122
449 3300005615 Ga0070702_100074494 Ga0070702_1000744944 122
450 3300005617 Ga0068859_100050634 Ga0068859_1000506343 122
451 3300005618 Ga0068864_100896629 Ga0068864_1008966292 122
452 3300005719 Ga0068861_101534481 Ga0068861_1015344812 122
453 3300005841 Ga0068863_101007207 Ga0068863_1010072072 122
454 3300005844 Ga0068862_100132699 Ga0068862_1001326992 122
455 3300005844 Ga0068862_101800394 Ga0068862_1018003942 122
456 3300006931 Ga0097620_100050643 Ga0097620_1000506433 122
457 3300009101 Ga0105247_10007747 Ga0105247_100077476 122
458 3300009174 Ga0105241_10086376 Ga0105241_100863763 122
459 3300009545 Ga0105237_10643933 Ga0105237_106439332 122
460 3300013306 Ga0163162_10733507 Ga0163162_107335072 122
461 3300013308 Ga0157375_12644730 Ga0157375_126447302 122
462 3300014968 Ga0157379_10218277 Ga0157379_102182773 122
463 3300025900 Ga0207710_10003720 Ga0207710_100037204 122
464 3300025904 Ga0207647_10156040 Ga0207647_101560404 122
465 3300025911 Ga0207654_10238536 Ga0207654_102385362 122
466 3300025918 Ga0207662_10192179 Ga0207662_101921792 122
467 3300025961 Ga0207712_10549018 Ga0207712_105490182 122
468 3300025986 Ga0207658_10322922 Ga0207658_103229223 122
469 3300026035 Ga0207703_10309013 Ga0207703_103090133 122
470 3300026075 Ga0207708_10726866 Ga0207708_107268662 122
471 3300026088 Ga0207641_10878342 Ga0207641_108783422 122
472 3300026089 Ga0207648_10528607 Ga0207648_105286072 122
473 3300026118 Ga0207675_101548174 Ga0207675_1015481742 122
474 3300028380 Ga0268265_10962408 Ga0268265_109624082 122
475 3300028380 Ga0268265_11531068 Ga0268265_115310682 122
476 3300028381 Ga0268264_10005209 Ga0268264_100052096 122
477 3300046460 Ga0495638_0042929 Ga0495638_0042929_1587_1955 122
478 3300046513 Ga0495616_0001799 Ga0495616_0001799_725_1093 122
479 3300046519 Ga0495632_0150556 Ga0495632_0150556_428_796 122
480 3300046660 Ga0495625_0129725 Ga0495625_0129725_928_1296 122
481 3300053727 Ga0500611_122139 Ga0500611_122139_50_418 122
482 3300005545 Ga0070695_101195768 Ga0070695_1011957682 123
483 3300025944 Ga0207661_11100690 Ga0207661_111006902 123
484 3300028577 Ga0265318_10066907 Ga0265318_100669073 123
485 3300028653 Ga0265323_10071435 Ga0265323_100714352 123
486 3300031240 Ga0265320_10071770 Ga0265320_100717702 123
487 3300035691 Ga0373931_0674936 Ga0373931_0674936_109_480 123
488 3300041408 Ga0439453_0094382 Ga0439453_0094382_194_586 123
489 3300041997 Ga0439431_0076194 Ga0439431_0076194_171_563 123
490 3300042436 Ga0439435_0034636 Ga0439435_0034636_132_524 123
491 3300047472 Ga0495686_0034470 Ga0495686_0034470_1238_1609 123
492 3300049744 Ga0501083_0394376 Ga0501083_0394376_94_465 123
493 3300053088 Ga0500644_0208401 Ga0500644_0208401_277_648 123
494 3300053093 Ga0500651_0298485 Ga0500651_0298485_468_839 123
495 3300053146 Ga0500588_0223324 Ga0500588_0223324_102_473 123
496 3300053156 Ga0500622_0085752 Ga0500622_0085752_477_848 123
497 3300003316 rootH1_10008402 rootH1_100084022 124
498 3300003322 rootL2_10244749 rootL2_102447492 124
499 3300032002 Ga0307416_101277031 Ga0307416_1012770311 124
500 3300032126 Ga0307415_100666212 Ga0307415_1006662121 124
501 3300041512 Ga0451853_2651384 Ga0451853_2651384_124_498 124
502 3300046457 Ga0495590_0027070 Ga0495590_0027070_889_1263 124
503 3300046460 Ga0495638_0064971 Ga0495638_0064971_667_1041 124
504 3300046491 Ga0495584_0051777 Ga0495584_0051777_852_1226 124
505 3300046684 Ga0495669_0261183 Ga0495669_0261183_389_763 124
506 3300046694 Ga0495649_0062062 Ga0495649_0062062_435_809 124
507 3300047472 Ga0495686_0140711 Ga0495686_0140711_622_996 124
508 3300049681 Ga0501251_068910 Ga0501251_068910_160_537 124
509 2088090001 CNB_F6ESG4R02HWPVU CNB_01399570 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

130

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8572 7 113
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.8352 1 114
2p7m-assembly4.cif.gz_D-2 crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.8341 1 114
2kjz-assembly1.cif.gz_B solution nmr structure of protein atc0852 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att2. 0.8339 2 113
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.8275 1 111
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9243 61 113 3.30.720.110
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9176 1 52 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9163 2 50 3.30.720.120
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8702 1 52 3.30.720.120
af_C6T374_10_137_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8572 7 115 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7Y0FEF3-F1-model_v4 deleted 0.973 2 118
AF-A0A7Y2CVR7-F1-model_v4 VOC family protein 0.9728 2 115
AF-A0A3M8G0F3-F1-model_v4 VOC family protein 0.9701 1 118
AF-I0K2W0-F1-model_v4 VOC domain-containing protein 0.9687 2 117
AF-A0A7V9JVB7-F1-model_v4 VOC family protein 0.9667 1 118

Feature Viewer

pLDDT pTM Quality
87 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map