F456953

General Info

Members Datasets Scaffolds Average Seq Length
509 306 1018 384

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10000058|Ga0081538_1000005810
Length 422
Sequence MSSAPPNAGPSRAPDGGAAGSLARIASARRRGGSDLGTIAPVEQASAPKTDSPALEALTLDVPAGEICVFVGPSGSGKTTAMRMVNRMVEITEGDIVVGDRSVRDRAPAELRREIGYVIQQIGLFPHRTIADNIATVPRLLGWDRDRIDARVNELLDVIGLEPELMRRFPSQLSGGQQQRVGVARALAANPGVMLMDEPFGAVDPINREKLQNEFLRLQAELHKTILFVTHDIDEAIKMGDRVAVLRDGGRLAQYATPAELLMAPGDPFVEDFVGADRALKRLALMRVADIDLWNAPLVHIGQSTAEVRAKLEGAEVPYALVIDQERRPIGWLSEADLARETVRARPDTSPDPILELDDVMRDALSDLLQAETRYAPVVDAGGRIAGVLSVEIISEFLTSEDALVEEHSAGERPLEEPAAEK

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
294 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
295 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
296 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
297 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
298 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
299 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
300 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
301 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
302 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
303 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
304 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
305 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
306 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 0.39
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.47
Nodule 0.2
Rhizoplane 10.41
Rhizosphere 78.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10000058 3300005981 Bacteria 102121
2 JGI24740J21852_10002907 3300001979 Bacteria 7637
3 JGI24739J22299_10000759 3300001989 Bacteria 11738
4 JGI25156J39149_1001752 3300002705 Bacteria 8665
5 JGI25406J46586_10051627 3300003203 Bacteria 1375
6 JGI25165J46597_1001131 3300003214 Bacteria 16770
7 JGI25404J52841_10003243 3300003659 Bacteria 3190
8 Ga0055533_1000195 3300003756 Bacteria 50285
9 Ga0055532_1000026 3300003758 Bacteria 238584
10 Ga0055527_1000018 3300003760 Bacteria 238584
11 Ga0055535_1000020 3300003761 Bacteria 238584
12 Ga0055542_1000031 3300003762 Bacteria 238584
13 Ga0055529_1000036 3300003763 Bacteria 238584
14 Ga0070683_100000793 3300005329 Bacteria 23313
15 Ga0070683_100001714 3300005329 Bacteria 17052
16 Ga0070683_100006401 3300005329 Bacteria 9872
17 Ga0070677_10000001 3300005333 Bacteria 118426
18 Ga0070666_10006232 3300005335 Bacteria 7339
19 Ga0070680_100165540 3300005336 Bacteria 1859
20 Ga0070682_100000028 3300005337 Bacteria 185177
21 Ga0070682_100000080 3300005337 Bacteria 85683
22 Ga0070682_100047503 3300005337 Bacteria 2669
23 Ga0068868_100025268 3300005338 Bacteria 4516
24 Ga0070660_100001908 3300005339 Bacteria 14358
25 Ga0070661_100000005 3300005344 Bacteria 220455
26 Ga0070692_10016545 3300005345 Bacteria 3509
27 Ga0070692_10113514 3300005345 Bacteria 1502
28 Ga0070668_100065188 3300005347 Bacteria 2825
29 Ga0070675_100000058 3300005354 Bacteria 66874
30 Ga0070673_100042333 3300005364 Bacteria 3511
31 Ga0070688_100000333 3300005365 Bacteria 24059
32 Ga0070688_100001703 3300005365 Bacteria 10976
33 Ga0070659_100008190 3300005366 Bacteria 7629
34 Ga0070659_100019461 3300005366 Bacteria 5145
35 Ga0070667_100008884 3300005367 Bacteria 8317
36 Ga0070667_100081695 3300005367 Bacteria 2766
37 Ga0070714_100000010 3300005435 Bacteria 262871
38 Ga0070714_100055753 3300005435 Bacteria 3379
39 Ga0070713_100000138 3300005436 Bacteria 48026
40 Ga0070711_100010844 3300005439 Bacteria 5650
41 Ga0070663_100001885 3300005455 Bacteria 11713
42 Ga0070663_100221174 3300005455 Bacteria 1487
43 Ga0070678_100001346 3300005456 Bacteria 13080
44 Ga0070678_100015439 3300005456 Bacteria 4857
45 Ga0070662_100012866 3300005457 Bacteria 5558
46 Ga0070681_10007735 3300005458 Bacteria 10506
47 Ga0068867_100022346 3300005459 Bacteria 4523
48 Ga0070685_10000293 3300005466 Bacteria 31562
49 Ga0070685_10000886 3300005466 Bacteria 16173
50 Ga0070679_100003822 3300005530 Bacteria 13829
51 Ga0070684_100018819 3300005535 Bacteria 5698
52 Ga0070684_100046934 3300005535 Bacteria 3743
53 Ga0068853_100017082 3300005539 Bacteria 5985
54 Ga0070672_100000004 3300005543 Bacteria 129970
55 Ga0070672_100208629 3300005543 Bacteria 1635
56 Ga0070693_100038570 3300005547 Bacteria 2671
57 Ga0070665_100001101 3300005548 Bacteria 33337
58 Ga0070665_100002504 3300005548 Bacteria 20206
59 Ga0070665_100038122 3300005548 Bacteria 4831
60 Ga0070704_100031708 3300005549 Bacteria 3558
61 Ga0068855_100223427 3300005563 Bacteria 2111
62 Ga0068855_100293533 3300005563 Bacteria 1802
63 Ga0070664_100007598 3300005564 Bacteria 8754
64 Ga0068854_100001309 3300005578 Bacteria 15008
65 Ga0068854_100005379 3300005578 Bacteria 8082
66 Ga0068856_100001818 3300005614 Bacteria 22286
67 Ga0068856_100045849 3300005614 Bacteria 4305
68 Ga0070702_100030489 3300005615 Bacteria 2941
69 Ga0068852_100000012 3300005616 Bacteria 140734
70 Ga0068852_100059648 3300005616 Bacteria 3309
71 Ga0068852_100076606 3300005616 Bacteria 2953
72 Ga0068851_10002153 3300005834 Bacteria 8660
73 Ga0068851_10004144 3300005834 Bacteria 6525
74 Ga0068851_10049325 3300005834 Bacteria 2135
75 Ga0068870_10088203 3300005840 Bacteria 1729
76 Ga0068863_100000004 3300005841 Bacteria 272478
77 Ga0068858_100000033 3300005842 Bacteria 142748
78 Ga0068858_100015212 3300005842 Bacteria 7239
79 Ga0068858_100227435 3300005842 Bacteria 1768
80 Ga0068860_100000261 3300005843 Bacteria 77163
81 Ga0068862_100003740 3300005844 Bacteria 12983
82 Ga0068862_100108215 3300005844 Bacteria 2438
83 Ga0081455_10078252 3300005937 Bacteria 2717
84 Ga0081538_10000030 3300005981 Bacteria 124321
85 Ga0081538_10001837 3300005981 Bacteria 21406
86 Ga0081540_1000006 3300005983 Bacteria 208724
87 Ga0081539_10001978 3300005985 Bacteria 31196
88 Ga0081539_10002242 3300005985 Bacteria 28126
89 Ga0081539_10032849 3300005985 Bacteria 3171
90 Ga0075365_10003588 3300006038 Bacteria 8029
91 Ga0075365_10017892 3300006038 Bacteria 4348
92 Ga0075365_10029336 3300006038 Bacteria 3515
93 Ga0075365_10032858 3300006038 Bacteria 3339
94 Ga0075365_10072968 3300006038 Bacteria 2312
95 Ga0075363_100005478 3300006048 Bacteria 5655
96 Ga0075363_100050215 3300006048 Bacteria 2222
97 Ga0075363_100050303 3300006048 Bacteria 2220
98 Ga0075364_10035240 3300006051 Bacteria 3234
99 Ga0075364_10060122 3300006051 Bacteria 2492
100 Ga0070712_100000777 3300006175 Bacteria 18846
101 Ga0070712_100004050 3300006175 Bacteria 8996
102 Ga0075367_10063884 3300006178 Bacteria 2201
103 Ga0097621_100034816 3300006237 Bacteria 4019
104 Ga0097621_100122296 3300006237 Bacteria 2208
105 Ga0075430_100005002 3300006846 Bacteria 11159
106 Ga0075430_100012685 3300006846 Bacteria 7179
107 Ga0075431_100005559 3300006847 Bacteria 12444
108 Ga0075431_100019598 3300006847 Bacteria 6900
109 Ga0075431_100029237 3300006847 Bacteria 5670
110 Ga0075429_100001085 3300006880 Bacteria 21851
111 Ga0068865_100000017 3300006881 Bacteria 109636
112 Ga0111539_10072809 3300009094 Bacteria 4052
113 Ga0111539_10172881 3300009094 Bacteria 2524
114 Ga0105245_10000056 3300009098 Bacteria 124109
115 Ga0105245_10001028 3300009098 Bacteria 25351
116 Ga0105245_10001521 3300009098 Bacteria 20984
117 Ga0105245_10002366 3300009098 Bacteria 17041
118 Ga0105245_10005382 3300009098 Bacteria 11251
119 Ga0105245_10025166 3300009098 Bacteria 5234
120 Ga0105247_10000202 3300009101 Bacteria 58345
121 Ga0114129_10087710 3300009147 Bacteria 4314
122 Ga0114129_10159301 3300009147 Bacteria 3085
123 Ga0105243_10012791 3300009148 Bacteria 6339
124 Ga0105243_10032752 3300009148 Bacteria 4018
125 Ga0105242_10029750 3300009176 Bacteria 4356
126 Ga0105242_10038289 3300009176 Bacteria 3856
127 Ga0105242_10191320 3300009176 Bacteria 1812
128 Ga0105248_10000032 3300009177 Bacteria 201114
129 Ga0105248_10058936 3300009177 Bacteria 4312
130 Ga0105238_10000023 3300009551 Bacteria 196844
131 Ga0105238_10335629 3300009551 Bacteria 1499
132 Ga0105249_10000074 3300009553 Bacteria 145235
133 Ga0105249_10031524 3300009553 Bacteria 4794
134 Ga0105239_10216771 3300010375 Bacteria 2146
135 Ga0157369_10000099 3300013105 Bacteria 120032
136 Ga0157369_10038995 3300013105 Bacteria 5193
137 Ga0157374_10021164 3300013296 Bacteria 5782
138 Ga0157378_10107124 3300013297 Bacteria 2557
139 Ga0157372_10012132 3300013307 Bacteria 9179
140 Ga0157375_10000363 3300013308 Bacteria 41402
141 Ga0157375_10006935 3300013308 Bacteria 9891
142 Ga0157380_10000219 3300014326 Bacteria 34156
143 Ga0157380_10044365 3300014326 Bacteria 3484
144 Ga0182008_10056875 3300014497 Bacteria 1932
145 Ga0157379_10042205 3300014968 Bacteria 4072
146 Ga0157376_10165310 3300014969 Bacteria 2010
147 Ga0206353_10828458 3300020082 Bacteria 1468
148 Ga0154015_1512999 3300020610 Bacteria 2807
149 Ga0209674_100020 3300025226 Bacteria 672397
150 Ga0209672_100013 3300025228 Bacteria 740693
151 Ga0209147_100013 3300025229 Bacteria 660057
152 Ga0209563_100665 3300025230 Bacteria 10953
153 Ga0207427_102109 3300025231 Bacteria 5803
154 Ga0209258_100016 3300025242 Bacteria 668622
155 Ga0209148_1000020 3300025254 Bacteria 740693
156 Ga0209759_1000083 3300025256 Bacteria 169561
157 Ga0209233_1000153 3300025261 Bacteria 169839
158 Ga0209455_1000017 3300025272 Bacteria 740693
159 Ga0207656_10002206 3300025321 Bacteria 6521
160 Ga0207656_10002277 3300025321 Bacteria 6435
161 Ga0207682_10000034 3300025893 Bacteria 56869
162 Ga0207710_10000369 3300025900 Bacteria 31539
163 Ga0207688_10010418 3300025901 Bacteria 5060
164 Ga0207688_10122882 3300025901 Bacteria 1516
165 Ga0207680_10008255 3300025903 Bacteria 5105
166 Ga0207699_10041782 3300025906 Bacteria 2651
167 Ga0207693_10005072 3300025915 Bacteria 11047
168 Ga0207657_10005100 3300025919 Bacteria 13759
169 Ga0207649_10000005 3300025920 Bacteria 356179
170 Ga0207652_10000549 3300025921 Bacteria 38051
171 Ga0207694_10000004 3300025924 Bacteria 967075
172 Ga0207694_10190269 3300025924 Bacteria 1667
173 Ga0207659_10000020 3300025926 Bacteria 151552
174 Ga0207687_10000007 3300025927 Bacteria 604185
175 Ga0207687_10000026 3300025927 Bacteria 173968
176 Ga0207687_10000055 3300025927 Bacteria 88382
177 Ga0207687_10000970 3300025927 Bacteria 19492
178 Ga0207687_10019105 3300025927 Bacteria 4536
179 Ga0207700_10000008 3300025928 Bacteria 341717
180 Ga0207700_10000016 3300025928 Bacteria 202434
181 Ga0207700_10035060 3300025928 Bacteria 3610
182 Ga0207664_10000009 3300025929 Bacteria 299246
183 Ga0207690_10005579 3300025932 Bacteria 7434
184 Ga0207706_10023359 3300025933 Bacteria 5553
185 Ga0207704_10000025 3300025938 Bacteria 135523
186 Ga0207665_10074152 3300025939 Bacteria 2329
187 Ga0207691_10000020 3300025940 Bacteria 133465
188 Ga0207691_10072774 3300025940 Bacteria 3100
189 Ga0207711_10000020 3300025941 Bacteria 363325
190 Ga0207661_10001238 3300025944 Bacteria 17056
191 Ga0207661_10002911 3300025944 Bacteria 11827
192 Ga0207661_10019224 3300025944 Bacteria 5089
193 Ga0207679_10146940 3300025945 Bacteria 1913
194 Ga0207667_10196160 3300025949 Bacteria 2071
195 Ga0207667_10257249 3300025949 Bacteria 1786
196 Ga0207712_10000007 3300025961 Bacteria 539589
197 Ga0207712_10025194 3300025961 Bacteria 3950
198 Ga0207712_10031773 3300025961 Bacteria 3558
199 Ga0207668_10023389 3300025972 Bacteria 3970
200 Ga0207640_10000137 3300025981 Bacteria 54133
201 Ga0207658_10061153 3300025986 Bacteria 2813
202 Ga0207658_10208971 3300025986 Bacteria 1634
203 Ga0207677_10002845 3300026023 Bacteria 9125
204 Ga0207677_10008940 3300026023 Bacteria 5618
205 Ga0207703_10001103 3300026035 Bacteria 25585
206 Ga0207703_10061704 3300026035 Bacteria 3070
207 Ga0207639_10021360 3300026041 Bacteria 4649
208 Ga0207678_10000994 3300026067 Bacteria 25831
209 Ga0207678_10097293 3300026067 Bacteria 2515
210 Ga0207708_10002088 3300026075 Bacteria 14696
211 Ga0207702_10000016 3300026078 Bacteria 226633
212 Ga0207702_10006846 3300026078 Bacteria 9777
213 Ga0207641_10000170 3300026088 Bacteria 91128
214 Ga0207641_10001861 3300026088 Bacteria 20273
215 Ga0207648_10063423 3300026089 Bacteria 3221
216 Ga0207648_10143456 3300026089 Bacteria 2106
217 Ga0207676_10087524 3300026095 Bacteria 2548
218 Ga0207675_100145493 3300026118 Bacteria 2253
219 Ga0207683_10003046 3300026121 Bacteria 14655
220 Ga0207683_10026972 3300026121 Bacteria 4964
221 Ga0207683_10115981 3300026121 Bacteria 2401
222 Ga0207698_10000012 3300026142 Bacteria 260061
223 Ga0207698_10028397 3300026142 Bacteria 3989
224 Ga0268266_10000553 3300028379 Bacteria 52199
225 Ga0268266_10003738 3300028379 Bacteria 14964
226 Ga0268266_10005059 3300028379 Bacteria 12438
227 Ga0268266_10090379 3300028379 Bacteria 2684
228 Ga0268264_10000315 3300028381 Bacteria 77227
229 Ga0265326_10015191 3300028558 Bacteria 2237
230 Ga0265319_1000028 3300028563 Bacteria 135557
231 Ga0265338_10000230 3300028800 Bacteria 103891
232 Ga0265329_10018239 3300031242 Bacteria 2402
233 Ga0265316_10195202 3300031344 Bacteria 1502
234 Ga0265342_10006624 3300031712 Bacteria 8599
235 Ga0307413_10001669 3300031824 Bacteria 8622
236 Ga0307410_10006945 3300031852 Bacteria 6155
237 Ga0307406_10046474 3300031901 Bacteria 2731
238 Ga0307407_10014086 3300031903 Bacteria 3904
239 Ga0307412_10000005 3300031911 Bacteria 526194
240 Ga0307409_100004004 3300031995 Bacteria 8173
241 Ga0307416_100003565 3300032002 Bacteria 9183
242 Ga0307415_100000648 3300032126 Bacteria 15309
243 Ga0307415_100003877 3300032126 Bacteria 7679
244 Ga0316580_10010155 3300032139 Bacteria 2837
245 Ga0316574_0005027 3300035398 Bacteria 7023
246 Ga0316574_0033102 3300035398 Bacteria 3146
247 Ga0316574_0058819 3300035398 Bacteria 2408
248 Ga0316574_0080513 3300035398 Bacteria 2067
249 Ga0373937_0005061 3300036401 Bacteria 11221
250 Ga0316584_0086540 3300036712 Bacteria 2346
251 Ga0395900_0004818 3300037418 Bacteria 14210
252 Ga0395898_0005549 3300037466 Bacteria 13607
253 Ga0395898_0007373 3300037466 Bacteria 11673
254 Ga0395898_0042358 3300037466 Bacteria 4493
255 Ga0395905_0002784 3300037471 Bacteria 19150
256 Ga0436364_1329731 3300037853 Bacteria 8563
257 Ga0395901_0005064 3300038443 Bacteria 13313
258 Ga0395901_0036821 3300038443 Bacteria 5058
259 Ga0436365_0174667 3300039437 Bacteria 2475
260 Ga0436365_0577226 3300039437 Bacteria 8812
261 Ga0466966_0044477 3300044684 Bacteria 2843
262 Ga0466963_0000200 3300044694 Bacteria 25265
263 Ga0466963_0009579 3300044694 Bacteria 5837
264 Ga0466963_0010282 3300044694 Bacteria 5662
265 Ga0466963_0022334 3300044694 Bacteria 4006
266 Ga0466963_0110312 3300044694 Bacteria 1888
267 Ga0466964_0012249 3300044706 Bacteria 3245
268 Ga0453684_0068898 3300044712 Bacteria 4490
269 Ga0466968_0106275 3300044735 Bacteria 1258
270 Ga0466957_0043615 3300044842 Bacteria 2717
271 Ga0466960_0047245 3300044901 Bacteria 2064
272 Ga0466959_0000506 3300045049 Bacteria 22637
273 Ga0466959_0056299 3300045049 Bacteria 2869
274 Ga0466958_0035354 3300045836 Bacteria 2984
275 Ga0466967_0000046 3300045976 Bacteria 43911
276 Ga0466967_0017345 3300045976 Bacteria 5713
277 Ga0466967_0020342 3300045976 Bacteria 5362
278 Ga0466967_0029456 3300045976 Bacteria 4594
279 Ga0466967_0111386 3300045976 Bacteria 2515
280 Ga0495603_0010100 3300046455 Bacteria 5713
281 Ga0495590_0041308 3300046457 Bacteria 1608
282 Ga0495629_0005486 3300046459 Bacteria 9470
283 Ga0495638_0087261 3300046460 Bacteria 1885
284 Ga0495653_0000534 3300046463 Bacteria 29072
285 Ga0495650_0001882 3300046471 Bacteria 18669
286 Ga0495580_0007843 3300046472 Bacteria 8548
287 Ga0495582_0040869 3300046473 Bacteria 2555
288 Ga0495605_0028546 3300046474 Bacteria 2879
289 Ga0495662_0017153 3300046476 Bacteria 3505
290 Ga0495594_0000013 3300046499 Bacteria 103201
291 Ga0495606_0000211 3300046507 Bacteria 103386
292 Ga0495606_0019523 3300046507 Bacteria 5037
293 Ga0495606_0022171 3300046507 Bacteria 4635
294 Ga0495608_0000031 3300046511 Bacteria 145255
295 Ga0495608_0006968 3300046511 Bacteria 8001
296 Ga0495610_0010620 3300046512 Bacteria 5707
297 Ga0495618_0255802 3300046514 Bacteria 1098
298 Ga0495620_0002733 3300046515 Bacteria 10163
299 Ga0495628_0025109 3300046516 Bacteria 4871
300 Ga0495628_0074742 3300046516 Bacteria 2639
301 Ga0495628_0178216 3300046516 Bacteria 1609
302 Ga0495630_0000025 3300046517 Bacteria 152364
303 Ga0495630_0011301 3300046517 Bacteria 6459
304 Ga0495630_0040971 3300046517 Bacteria 3460
305 Ga0495642_0011502 3300046528 Bacteria 3401
306 Ga0495652_0000003 3300046529 Bacteria 597094
307 Ga0495652_0013065 3300046529 Bacteria 7479
308 Ga0495665_0000083 3300046531 Bacteria 41848
309 Ga0495665_0021078 3300046531 Bacteria 3501
310 Ga0495586_0134007 3300046535 Bacteria 1388
311 Ga0495587_0001970 3300046536 Bacteria 13697
312 Ga0495645_0029744 3300046543 Bacteria 3975
313 Ga0495645_0065391 3300046543 Bacteria 2630
314 Ga0495622_0000014 3300046557 Bacteria 182142
315 Ga0495667_0000075 3300046559 Bacteria 73540
316 Ga0495656_0000982 3300046615 Bacteria 9239
317 Ga0495634_0003604 3300046642 Bacteria 12372
318 Ga0495625_0000029 3300046660 Bacteria 244646
319 Ga0495635_0105946 3300046663 Bacteria 1921
320 Ga0495588_0000311 3300046674 Bacteria 33416
321 Ga0495657_0000024 3300046675 Bacteria 145255
322 Ga0495623_0001384 3300046679 Bacteria 16462
323 Ga0495646_0000842 3300046680 Bacteria 17354
324 Ga0495646_0080772 3300046680 Bacteria 1896
325 Ga0495647_0000293 3300046681 Bacteria 13969
326 Ga0495658_0001056 3300046683 Bacteria 14543
327 Ga0495669_0004513 3300046684 Bacteria 5755
328 Ga0495669_0104003 3300046684 Bacteria 1321
329 Ga0495613_0000309 3300046689 Bacteria 44163
330 Ga0495624_0000719 3300046690 Bacteria 25951
331 Ga0495624_0003672 3300046690 Bacteria 11342
332 Ga0495624_0011387 3300046690 Bacteria 6111
333 Ga0495649_0000972 3300046694 Bacteria 22610
334 Ga0495649_0001198 3300046694 Bacteria 20005
335 Ga0495649_0034392 3300046694 Bacteria 2788
336 Ga0495600_0012953 3300046809 Bacteria 5228
337 Ga0495600_0028407 3300046809 Bacteria 3619
338 Ga0495600_0129061 3300046809 Bacteria 1643
339 Ga0495660_0100466 3300046810 Bacteria 1490
340 Ga0495604_0000013 3300047317 Bacteria 234578
341 Ga0495604_0027640 3300047317 Bacteria 4509
342 Ga0495604_0072646 3300047317 Bacteria 2599
343 Ga0495674_0000042 3300047319 Bacteria 94820
344 Ga0495674_0002697 3300047319 Bacteria 17280
345 Ga0495674_0003180 3300047319 Bacteria 15950
346 Ga0495676_0064978 3300047321 Bacteria 2834
347 Ga0495680_0000196 3300047322 Bacteria 65437
348 Ga0495680_0002599 3300047322 Bacteria 18367
349 Ga0495683_0013340 3300047323 Bacteria 4299
350 Ga0495687_011042 3300047443 Bacteria 4890
351 Ga0495687_012975 3300047443 Bacteria 4371
352 Ga0495675_0000209 3300047444 Bacteria 42691
353 Ga0495686_0146906 3300047472 Bacteria 1387
354 Ga0495593_0000073 3300047673 Bacteria 42582
355 Ga0495602_0000228 3300048088 Bacteria 52649
356 Ga0495602_0000556 3300048088 Bacteria 34773
357 Ga0495602_0097009 3300048088 Bacteria 2430
358 Ga0495614_0035306 3300048089 Bacteria 2148
359 Ga0496100_0000002 3300048903 Bacteria 489057
360 Ga0496100_0005490 3300048903 Bacteria 6836
361 Ga0496100_0110829 3300048903 Bacteria 1906
362 Ga0496101_0000001 3300048904 Bacteria 489057
363 Ga0496102_0015880 3300048905 Bacteria 6567
364 Ga0496102_0073675 3300048905 Bacteria 3138
365 Ga0496102_0292966 3300048905 Bacteria 1534
366 Ga0496103_0076910 3300048906 Bacteria 2095
367 Ga0496104_0000002 3300048907 Bacteria 686017
368 Ga0496104_0000013 3300048907 Bacteria 397163
369 Ga0496104_0000576 3300048907 Bacteria 31360
370 Ga0496104_0216067 3300048907 Bacteria 1829
371 Ga0496105_0000001 3300048908 Bacteria 1328178
372 Ga0496105_0000006 3300048908 Bacteria 393578
373 Ga0496105_0000488 3300048908 Bacteria 26096
374 Ga0496106_0000022 3300048909 Bacteria 166339
375 Ga0496106_0000864 3300048909 Bacteria 22031
376 Ga0496106_0024135 3300048909 Bacteria 4520
377 Ga0496106_0087862 3300048909 Bacteria 2395
378 Ga0496107_0000016 3300048910 Bacteria 172319
379 Ga0496107_0002031 3300048910 Bacteria 12927
380 Ga0496107_0059311 3300048910 Bacteria 2769
381 Ga0496108_0000001 3300048911 Bacteria 919044
382 Ga0496108_0000045 3300048911 Bacteria 137416
383 Ga0496108_0002417 3300048911 Bacteria 14918
384 Ga0496108_0004290 3300048911 Bacteria 11478
385 Ga0496109_0000003 3300048912 Bacteria 420862
386 Ga0496109_0000028 3300048912 Bacteria 168138
387 Ga0496109_0000032 3300048912 Bacteria 162984
388 Ga0496109_0000279 3300048912 Bacteria 48999
389 Ga0496109_0014159 3300048912 Bacteria 6935
390 Ga0496110_0004071 3300048913 Bacteria 11281
391 Ga0496110_0005343 3300048913 Bacteria 10063
392 Ga0496110_0008950 3300048913 Bacteria 8073
393 Ga0496110_0011873 3300048913 Bacteria 7155
394 Ga0496110_0031965 3300048913 Bacteria 4542
395 Ga0496110_0347454 3300048913 Bacteria 1351
396 Ga0496111_0001844 3300048914 Bacteria 12488
397 Ga0496111_0005974 3300048914 Bacteria 7858
398 Ga0496111_0014518 3300048914 Bacteria 5384
399 Ga0496112_0005132 3300048915 Bacteria 11255
400 Ga0496112_0215752 3300048915 Bacteria 1875
401 Ga0496112_0455046 3300048915 Bacteria 1218
402 Ga0496113_0002212 3300048916 Bacteria 11219
403 Ga0496113_0019863 3300048916 Bacteria 4710
404 Ga0496114_0000014 3300048917 Bacteria 297902
405 Ga0496114_0007982 3300048917 Bacteria 8374
406 Ga0496115_0000020 3300048918 Bacteria 171995
407 Ga0496115_0000157 3300048918 Bacteria 63822
408 Ga0496115_0000209 3300048918 Bacteria 54079
409 Ga0496115_0002818 3300048918 Bacteria 12497
410 Ga0496115_0007706 3300048918 Bacteria 7940
411 Ga0496117_0020122 3300048920 Bacteria 5452
412 Ga0496118_0013441 3300048921 Bacteria 7743
413 Ga0496119_0046169 3300048922 Bacteria 2723
414 Ga0496121_0018233 3300048924 Bacteria 7095
415 Ga0496124_0094249 3300048927 Bacteria 2435
416 Ga0495682_0001688 3300049460 Bacteria 11253
417 Ga0501031_0008042 3300049568 Bacteria 6868
418 Ga0501032_0022643 3300049569 Bacteria 4353
419 Ga0501036_0059718 3300049572 Bacteria 3231
420 Ga0501036_0122879 3300049572 Bacteria 2192
421 Ga0501037_0021892 3300049573 Bacteria 4732
422 Ga0501038_0001145 3300049574 Bacteria 24031
423 Ga0501038_0140220 3300049574 Bacteria 1978
424 Ga0501042_0096568 3300049578 Bacteria 2123
425 Ga0501042_0121531 3300049578 Bacteria 1880
426 Ga0501042_0161627 3300049578 Bacteria 1616
427 Ga0501043_0006461 3300049579 Bacteria 9411
428 Ga0501046_0037262 3300049580 Bacteria 3908
429 Ga0501046_0050815 3300049580 Bacteria 3274
430 Ga0501047_0014205 3300049581 Bacteria 7568
431 Ga0501047_0089911 3300049581 Bacteria 2947
432 Ga0501048_0000032 3300049582 Bacteria 65543
433 Ga0501069_0045065 3300049585 Bacteria 2442
434 Ga0501070_0030642 3300049586 Bacteria 4507
435 Ga0501070_0042301 3300049586 Bacteria 3794
436 Ga0501070_0091697 3300049586 Bacteria 2514
437 Ga0501071_0006530 3300049587 Bacteria 7573
438 Ga0501071_0065363 3300049587 Bacteria 2641
439 Ga0501071_0081188 3300049587 Bacteria 2373
440 Ga0501071_0081514 3300049587 Bacteria 2368
441 Ga0501072_0006551 3300049588 Bacteria 8869
442 Ga0501072_0028473 3300049588 Bacteria 4362
443 Ga0501073_0060033 3300049589 Bacteria 2654
444 Ga0501073_0068973 3300049589 Bacteria 2464
445 Ga0501074_0045086 3300049590 Bacteria 3190
446 Ga0501074_0279884 3300049590 Bacteria 1186
447 Ga0501075_0033687 3300049591 Bacteria 3811
448 Ga0501075_0192210 3300049591 Bacteria 1557
449 Ga0501079_0003967 3300049741 Bacteria 10933
450 Ga0501079_0047986 3300049741 Bacteria 3295
451 Ga0501080_0099039 3300049742 Bacteria 2705
452 Ga0501080_0339415 3300049742 Bacteria 1358
453 Ga0501083_0091822 3300049744 Bacteria 2004
454 Ga0501035_0004956 3300049822 Bacteria 12626
455 Ga0501044_0070355 3300049823 Bacteria 3559
456 Ga0501044_0086899 3300049823 Bacteria 3158
457 Ga0501044_0225133 3300049823 Bacteria 1825
458 Ga0501045_0103207 3300049824 Bacteria 2111
459 Ga0501045_0111614 3300049824 Bacteria 2027
460 Ga0501045_0126250 3300049824 Bacteria 1901
461 nmdc:mga03n38_37693_c1 3300050490 Bacteria 2087
462 nmdc:mga03n38_79282_c1 3300050490 Bacteria 1539
463 nmdc:mga00v17_41581_c1 3300050491 Bacteria 2761
464 nmdc:mga0yw44_15873_c1 3300050492 Bacteria 4050
465 nmdc:mga0yw44_5488_c1 3300050492 Bacteria 6000
466 nmdc:mga0yw44_6126_c1 3300050492 Bacteria 5776
467 nmdc:mga0yw44_70758_c1 3300050492 Bacteria 2164
468 nmdc:mga0yw44_78214_c1 3300050492 Bacteria 2068
469 nmdc:mga05p37_38503_c1 3300050507 Bacteria 5865
470 nmdc:mga05p37_48899_c1 3300050507 Bacteria 5200
471 nmdc:mga09592_18827_c1 3300050508 Bacteria 5665
472 nmdc:mga0qj67_3971_c1 3300050509 Bacteria 10703
473 nmdc:mga0qj67_43201_c1 3300050509 Bacteria 3549
474 nmdc:mga06r32_21279_c1 3300050510 Bacteria 5986
475 nmdc:mga06r32_237436_c1 3300050510 Bacteria 1811
476 nmdc:mga08y16_121188_c1 3300050511 Bacteria 2722
477 nmdc:mga0a205_3124_c1 3300050515 Bacteria 14696
478 Ga0495601_0000097 3300053077 Bacteria 48380
479 Ga0495601_0011384 3300053077 Bacteria 5319
480 Ga0495612_0000228 3300053078 Bacteria 23756
481 Ga0495612_0004552 3300053078 Bacteria 5755
482 Ga0495612_0005157 3300053078 Bacteria 5400
483 Ga0495655_0000011 3300053083 Bacteria 118490
484 Ga0495595_0000014 3300053084 Bacteria 145255
485 Ga0495595_0012587 3300053084 Bacteria 3560
486 Ga0495619_0000001 3300053085 Bacteria 586054
487 Ga0495619_0000022 3300053085 Bacteria 184144
488 Ga0495619_0000319 3300053085 Bacteria 33678
489 Ga0495619_0003460 3300053085 Bacteria 10187
490 Ga0495619_0005740 3300053085 Bacteria 7864
491 Ga0500628_000032 3300053129 Bacteria 52752
492 Ga0500616_0001741 3300053153 Bacteria 19953
493 Ga0500616_0061029 3300053153 Bacteria 1953
494 Ga0501084_0144037 3300054114 Bacteria 2007
495 Ga0501082_0123072 3300060353 Bacteria 2249
496 Ga0530510_0006377 3300061734 Bacteria 8212
497 2738823361 2738541296 Bacteria 7285013
498 2738835537 2738541298 Bacteria 7286732
499 2738877282 2738541306 Bacteria 7284992
500 2739188988 2738543002 Bacteria 7284546
501 2739223875 2738543008 Bacteria 7282815
502 2792835204 2791355137 Bacteria 9654227
503 2904488666 2904483920 Bacteria 7545285
504 2904621083 2904615490 Bacteria 10047340
505 2919529281 2919527303 Bacteria 7718827
506 2945936034 2945934425 Bacteria 7444609
507 2990710061 2990703756 Bacteria 7715990
508 642422601 641736151 Bacteria 7477263
509 8055266403 8055266321 Bacteria 7999742
510 Ga0081538_10000058
511 JGI24740J21852_10002907
512 JGI24739J22299_10000759
513 JGI25156J39149_1001752
514 JGI25406J46586_10051627
515 JGI25165J46597_1001131
516 JGI25404J52841_10003243
517 Ga0055533_1000195
518 Ga0055532_1000026
519 Ga0055527_1000018
520 Ga0055535_1000020
521 Ga0055542_1000031
522 Ga0055529_1000036
523 Ga0070683_100000793
524 Ga0070683_100001714
525 Ga0070683_100006401
526 Ga0070677_10000001
527 Ga0070666_10006232
528 Ga0070680_100165540
529 Ga0070682_100000028
530 Ga0070682_100000080
531 Ga0070682_100047503
532 Ga0068868_100025268
533 Ga0070660_100001908
534 Ga0070661_100000005
535 Ga0070692_10016545
536 Ga0070692_10113514
537 Ga0070668_100065188
538 Ga0070675_100000058
539 Ga0070673_100042333
540 Ga0070688_100000333
541 Ga0070688_100001703
542 Ga0070659_100008190
543 Ga0070659_100019461
544 Ga0070667_100008884
545 Ga0070667_100081695
546 Ga0070714_100000010
547 Ga0070714_100055753
548 Ga0070713_100000138
549 Ga0070711_100010844
550 Ga0070663_100001885
551 Ga0070663_100221174
552 Ga0070678_100001346
553 Ga0070678_100015439
554 Ga0070662_100012866
555 Ga0070681_10007735
556 Ga0068867_100022346
557 Ga0070685_10000293
558 Ga0070685_10000886
559 Ga0070679_100003822
560 Ga0070684_100018819
561 Ga0070684_100046934
562 Ga0068853_100017082
563 Ga0070672_100000004
564 Ga0070672_100208629
565 Ga0070693_100038570
566 Ga0070665_100001101
567 Ga0070665_100002504
568 Ga0070665_100038122
569 Ga0070704_100031708
570 Ga0068855_100223427
571 Ga0068855_100293533
572 Ga0070664_100007598
573 Ga0068854_100001309
574 Ga0068854_100005379
575 Ga0068856_100001818
576 Ga0068856_100045849
577 Ga0070702_100030489
578 Ga0068852_100000012
579 Ga0068852_100059648
580 Ga0068852_100076606
581 Ga0068851_10002153
582 Ga0068851_10004144
583 Ga0068851_10049325
584 Ga0068870_10088203
585 Ga0068863_100000004
586 Ga0068858_100000033
587 Ga0068858_100015212
588 Ga0068858_100227435
589 Ga0068860_100000261
590 Ga0068862_100003740
591 Ga0068862_100108215
592 Ga0081455_10078252
593 Ga0081538_10000030
594 Ga0081538_10001837
595 Ga0081540_1000006
596 Ga0081539_10001978
597 Ga0081539_10002242
598 Ga0081539_10032849
599 Ga0075365_10003588
600 Ga0075365_10017892
601 Ga0075365_10029336
602 Ga0075365_10032858
603 Ga0075365_10072968
604 Ga0075363_100005478
605 Ga0075363_100050215
606 Ga0075363_100050303
607 Ga0075364_10035240
608 Ga0075364_10060122
609 Ga0070712_100000777
610 Ga0070712_100004050
611 Ga0075367_10063884
612 Ga0097621_100034816
613 Ga0097621_100122296
614 Ga0075430_100005002
615 Ga0075430_100012685
616 Ga0075431_100005559
617 Ga0075431_100019598
618 Ga0075431_100029237
619 Ga0075429_100001085
620 Ga0068865_100000017
621 Ga0111539_10072809
622 Ga0111539_10172881
623 Ga0105245_10000056
624 Ga0105245_10001028
625 Ga0105245_10001521
626 Ga0105245_10002366
627 Ga0105245_10005382
628 Ga0105245_10025166
629 Ga0105247_10000202
630 Ga0114129_10087710
631 Ga0114129_10159301
632 Ga0105243_10012791
633 Ga0105243_10032752
634 Ga0105242_10029750
635 Ga0105242_10038289
636 Ga0105242_10191320
637 Ga0105248_10000032
638 Ga0105248_10058936
639 Ga0105238_10000023
640 Ga0105238_10335629
641 Ga0105249_10000074
642 Ga0105249_10031524
643 Ga0105239_10216771
644 Ga0157369_10000099
645 Ga0157369_10038995
646 Ga0157374_10021164
647 Ga0157378_10107124
648 Ga0157372_10012132
649 Ga0157375_10000363
650 Ga0157375_10006935
651 Ga0157380_10000219
652 Ga0157380_10044365
653 Ga0182008_10056875
654 Ga0157379_10042205
655 Ga0157376_10165310
656 Ga0206353_10828458
657 Ga0154015_1512999
658 Ga0209674_100020
659 Ga0209672_100013
660 Ga0209147_100013
661 Ga0209563_100665
662 Ga0207427_102109
663 Ga0209258_100016
664 Ga0209148_1000020
665 Ga0209759_1000083
666 Ga0209233_1000153
667 Ga0209455_1000017
668 Ga0207656_10002206
669 Ga0207656_10002277
670 Ga0207682_10000034
671 Ga0207710_10000369
672 Ga0207688_10010418
673 Ga0207688_10122882
674 Ga0207680_10008255
675 Ga0207699_10041782
676 Ga0207693_10005072
677 Ga0207657_10005100
678 Ga0207649_10000005
679 Ga0207652_10000549
680 Ga0207694_10000004
681 Ga0207694_10190269
682 Ga0207659_10000020
683 Ga0207687_10000007
684 Ga0207687_10000026
685 Ga0207687_10000055
686 Ga0207687_10000970
687 Ga0207687_10019105
688 Ga0207700_10000008
689 Ga0207700_10000016
690 Ga0207700_10035060
691 Ga0207664_10000009
692 Ga0207690_10005579
693 Ga0207706_10023359
694 Ga0207704_10000025
695 Ga0207665_10074152
696 Ga0207691_10000020
697 Ga0207691_10072774
698 Ga0207711_10000020
699 Ga0207661_10001238
700 Ga0207661_10002911
701 Ga0207661_10019224
702 Ga0207679_10146940
703 Ga0207667_10196160
704 Ga0207667_10257249
705 Ga0207712_10000007
706 Ga0207712_10025194
707 Ga0207712_10031773
708 Ga0207668_10023389
709 Ga0207640_10000137
710 Ga0207658_10061153
711 Ga0207658_10208971
712 Ga0207677_10002845
713 Ga0207677_10008940
714 Ga0207703_10001103
715 Ga0207703_10061704
716 Ga0207639_10021360
717 Ga0207678_10000994
718 Ga0207678_10097293
719 Ga0207708_10002088
720 Ga0207702_10000016
721 Ga0207702_10006846
722 Ga0207641_10000170
723 Ga0207641_10001861
724 Ga0207648_10063423
725 Ga0207648_10143456
726 Ga0207676_10087524
727 Ga0207675_100145493
728 Ga0207683_10003046
729 Ga0207683_10026972
730 Ga0207683_10115981
731 Ga0207698_10000012
732 Ga0207698_10028397
733 Ga0268266_10000553
734 Ga0268266_10003738
735 Ga0268266_10005059
736 Ga0268266_10090379
737 Ga0268264_10000315
738 Ga0265326_10015191
739 Ga0265319_1000028
740 Ga0265338_10000230
741 Ga0265329_10018239
742 Ga0265316_10195202
743 Ga0265342_10006624
744 Ga0307413_10001669
745 Ga0307410_10006945
746 Ga0307406_10046474
747 Ga0307407_10014086
748 Ga0307412_10000005
749 Ga0307409_100004004
750 Ga0307416_100003565
751 Ga0307415_100000648
752 Ga0307415_100003877
753 Ga0316580_10010155
754 Ga0316574_0005027
755 Ga0316574_0033102
756 Ga0316574_0058819
757 Ga0316574_0080513
758 Ga0373937_0005061
759 Ga0316584_0086540
760 Ga0395900_0004818
761 Ga0395898_0005549
762 Ga0395898_0007373
763 Ga0395898_0042358
764 Ga0395905_0002784
765 Ga0436364_1329731
766 Ga0395901_0005064
767 Ga0395901_0036821
768 Ga0436365_0174667
769 Ga0436365_0577226
770 Ga0466966_0044477
771 Ga0466963_0000200
772 Ga0466963_0009579
773 Ga0466963_0010282
774 Ga0466963_0022334
775 Ga0466963_0110312
776 Ga0466964_0012249
777 Ga0453684_0068898
778 Ga0466968_0106275
779 Ga0466957_0043615
780 Ga0466960_0047245
781 Ga0466959_0000506
782 Ga0466959_0056299
783 Ga0466958_0035354
784 Ga0466967_0000046
785 Ga0466967_0017345
786 Ga0466967_0020342
787 Ga0466967_0029456
788 Ga0466967_0111386
789 Ga0495603_0010100
790 Ga0495590_0041308
791 Ga0495629_0005486
792 Ga0495638_0087261
793 Ga0495653_0000534
794 Ga0495650_0001882
795 Ga0495580_0007843
796 Ga0495582_0040869
797 Ga0495605_0028546
798 Ga0495662_0017153
799 Ga0495594_0000013
800 Ga0495606_0000211
801 Ga0495606_0019523
802 Ga0495606_0022171
803 Ga0495608_0000031
804 Ga0495608_0006968
805 Ga0495610_0010620
806 Ga0495618_0255802
807 Ga0495620_0002733
808 Ga0495628_0025109
809 Ga0495628_0074742
810 Ga0495628_0178216
811 Ga0495630_0000025
812 Ga0495630_0011301
813 Ga0495630_0040971
814 Ga0495642_0011502
815 Ga0495652_0000003
816 Ga0495652_0013065
817 Ga0495665_0000083
818 Ga0495665_0021078
819 Ga0495586_0134007
820 Ga0495587_0001970
821 Ga0495645_0029744
822 Ga0495645_0065391
823 Ga0495622_0000014
824 Ga0495667_0000075
825 Ga0495656_0000982
826 Ga0495634_0003604
827 Ga0495625_0000029
828 Ga0495635_0105946
829 Ga0495588_0000311
830 Ga0495657_0000024
831 Ga0495623_0001384
832 Ga0495646_0000842
833 Ga0495646_0080772
834 Ga0495647_0000293
835 Ga0495658_0001056
836 Ga0495669_0004513
837 Ga0495669_0104003
838 Ga0495613_0000309
839 Ga0495624_0000719
840 Ga0495624_0003672
841 Ga0495624_0011387
842 Ga0495649_0000972
843 Ga0495649_0001198
844 Ga0495649_0034392
845 Ga0495600_0012953
846 Ga0495600_0028407
847 Ga0495600_0129061
848 Ga0495660_0100466
849 Ga0495604_0000013
850 Ga0495604_0027640
851 Ga0495604_0072646
852 Ga0495674_0000042
853 Ga0495674_0002697
854 Ga0495674_0003180
855 Ga0495676_0064978
856 Ga0495680_0000196
857 Ga0495680_0002599
858 Ga0495683_0013340
859 Ga0495687_011042
860 Ga0495687_012975
861 Ga0495675_0000209
862 Ga0495686_0146906
863 Ga0495593_0000073
864 Ga0495602_0000228
865 Ga0495602_0000556
866 Ga0495602_0097009
867 Ga0495614_0035306
868 Ga0496100_0000002
869 Ga0496100_0005490
870 Ga0496100_0110829
871 Ga0496101_0000001
872 Ga0496102_0015880
873 Ga0496102_0073675
874 Ga0496102_0292966
875 Ga0496103_0076910
876 Ga0496104_0000002
877 Ga0496104_0000013
878 Ga0496104_0000576
879 Ga0496104_0216067
880 Ga0496105_0000001
881 Ga0496105_0000006
882 Ga0496105_0000488
883 Ga0496106_0000022
884 Ga0496106_0000864
885 Ga0496106_0024135
886 Ga0496106_0087862
887 Ga0496107_0000016
888 Ga0496107_0002031
889 Ga0496107_0059311
890 Ga0496108_0000001
891 Ga0496108_0000045
892 Ga0496108_0002417
893 Ga0496108_0004290
894 Ga0496109_0000003
895 Ga0496109_0000028
896 Ga0496109_0000032
897 Ga0496109_0000279
898 Ga0496109_0014159
899 Ga0496110_0004071
900 Ga0496110_0005343
901 Ga0496110_0008950
902 Ga0496110_0011873
903 Ga0496110_0031965
904 Ga0496110_0347454
905 Ga0496111_0001844
906 Ga0496111_0005974
907 Ga0496111_0014518
908 Ga0496112_0005132
909 Ga0496112_0215752
910 Ga0496112_0455046
911 Ga0496113_0002212
912 Ga0496113_0019863
913 Ga0496114_0000014
914 Ga0496114_0007982
915 Ga0496115_0000020
916 Ga0496115_0000157
917 Ga0496115_0000209
918 Ga0496115_0002818
919 Ga0496115_0007706
920 Ga0496117_0020122
921 Ga0496118_0013441
922 Ga0496119_0046169
923 Ga0496121_0018233
924 Ga0496124_0094249
925 Ga0495682_0001688
926 Ga0501031_0008042
927 Ga0501032_0022643
928 Ga0501036_0059718
929 Ga0501036_0122879
930 Ga0501037_0021892
931 Ga0501038_0001145
932 Ga0501038_0140220
933 Ga0501042_0096568
934 Ga0501042_0121531
935 Ga0501042_0161627
936 Ga0501043_0006461
937 Ga0501046_0037262
938 Ga0501046_0050815
939 Ga0501047_0014205
940 Ga0501047_0089911
941 Ga0501048_0000032
942 Ga0501069_0045065
943 Ga0501070_0030642
944 Ga0501070_0042301
945 Ga0501070_0091697
946 Ga0501071_0006530
947 Ga0501071_0065363
948 Ga0501071_0081188
949 Ga0501071_0081514
950 Ga0501072_0006551
951 Ga0501072_0028473
952 Ga0501073_0060033
953 Ga0501073_0068973
954 Ga0501074_0045086
955 Ga0501074_0279884
956 Ga0501075_0033687
957 Ga0501075_0192210
958 Ga0501079_0003967
959 Ga0501079_0047986
960 Ga0501080_0099039
961 Ga0501080_0339415
962 Ga0501083_0091822
963 Ga0501035_0004956
964 Ga0501044_0070355
965 Ga0501044_0086899
966 Ga0501044_0225133
967 Ga0501045_0103207
968 Ga0501045_0111614
969 Ga0501045_0126250
970 nmdc:mga03n38_37693_c1
971 nmdc:mga03n38_79282_c1
972 nmdc:mga00v17_41581_c1
973 nmdc:mga0yw44_15873_c1
974 nmdc:mga0yw44_5488_c1
975 nmdc:mga0yw44_6126_c1
976 nmdc:mga0yw44_70758_c1
977 nmdc:mga0yw44_78214_c1
978 nmdc:mga05p37_38503_c1
979 nmdc:mga05p37_48899_c1
980 nmdc:mga09592_18827_c1
981 nmdc:mga0qj67_3971_c1
982 nmdc:mga0qj67_43201_c1
983 nmdc:mga06r32_21279_c1
984 nmdc:mga06r32_237436_c1
985 nmdc:mga08y16_121188_c1
986 nmdc:mga0a205_3124_c1
987 Ga0495601_0000097
988 Ga0495601_0011384
989 Ga0495612_0000228
990 Ga0495612_0004552
991 Ga0495612_0005157
992 Ga0495655_0000011
993 Ga0495595_0000014
994 Ga0495595_0012587
995 Ga0495619_0000001
996 Ga0495619_0000022
997 Ga0495619_0000319
998 Ga0495619_0003460
999 Ga0495619_0005740
1000 Ga0500628_000032
1001 Ga0500616_0001741
1002 Ga0500616_0061029
1003 Ga0501084_0144037
1004 Ga0501082_0123072
1005 Ga0530510_0006377
1006 2738823361
1007 2738835537
1008 2738877282
1009 2739188988
1010 2739223875
1011 2792835204
1012 2904488666
1013 2904621083
1014 2919529281
1015 2945936034
1016 2990710061
1017 642422601
1018 8055266403

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

201

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9597 2 239
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9519 2 239
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.947 2 239
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9462 2 239
2awo-assembly2.cif.gz_C crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9456 2 239
ID Description Score Start End Superfamily
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9619 1 236 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9574 2 218 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.957 1 238 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9539 1 236 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9508 1 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5C7NKR9-F1-model_v4 deleted 0.9675 2 236
AF-A0A1Q7D495-F1-model_v4 ABC transporter domain-containing protein 0.965 2 239 GO:0005524
GO:0016887
GO:0022857
GO:0043190
AF-A0A431JYT0-F1-model_v4 ABC transporter ATP-binding protein 0.9622 2 237 GO:0005524
GO:0005886
GO:0016887
AF-A0A212LEM7-F1-model_v4 Uncharacterized ABC transporter ATP-binding protein y4oS 0.9611 2 238 GO:0005524
GO:0016887
GO:0022857
GO:0043190
AF-A0A7X3MUK7-F1-model_v4 Spermidine/putrescine import ATP-binding protein PotA (EC 7.6.2.11) 0.9606 2 236 GO:0005524
GO:0015417
GO:0016887
GO:0043190

Map