F456953
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 509 | 306 | 1018 | 384 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10000058|Ga0081538_1000005810 |
| Length | 422 |
| Sequence | MSSAPPNAGPSRAPDGGAAGSLARIASARRRGGSDLGTIAPVEQASAPKTDSPALEALTLDVPAGEICVFVGPSGSGKTTAMRMVNRMVEITEGDIVVGDRSVRDRAPAELRREIGYVIQQIGLFPHRTIADNIATVPRLLGWDRDRIDARVNELLDVIGLEPELMRRFPSQLSGGQQQRVGVARALAANPGVMLMDEPFGAVDPINREKLQNEFLRLQAELHKTILFVTHDIDEAIKMGDRVAVLRDGGRLAQYATPAELLMAPGDPFVEDFVGADRALKRLALMRVADIDLWNAPLVHIGQSTAEVRAKLEGAEVPYALVIDQERRPIGWLSEADLARETVRARPDTSPDPILELDDVMRDALSDLLQAETRYAPVVDAGGRIAGVLSVEIISEFLTSEDALVEEHSAGERPLEEPAAEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 158 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 168 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 169 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 251 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 277 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 294 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 295 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 296 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 297 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 298 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 299 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 300 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 301 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 302 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 303 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 304 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 305 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 306 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.05 |
| Metatranscriptomes | 0.39 |
| Isolates | 2.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.47 |
| Nodule | 0.2 |
| Rhizoplane | 10.41 |
| Rhizosphere | 78.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081538_10000058 | 3300005981 | Bacteria | 102121 |
| 2 | JGI24740J21852_10002907 | 3300001979 | Bacteria | 7637 |
| 3 | JGI24739J22299_10000759 | 3300001989 | Bacteria | 11738 |
| 4 | JGI25156J39149_1001752 | 3300002705 | Bacteria | 8665 |
| 5 | JGI25406J46586_10051627 | 3300003203 | Bacteria | 1375 |
| 6 | JGI25165J46597_1001131 | 3300003214 | Bacteria | 16770 |
| 7 | JGI25404J52841_10003243 | 3300003659 | Bacteria | 3190 |
| 8 | Ga0055533_1000195 | 3300003756 | Bacteria | 50285 |
| 9 | Ga0055532_1000026 | 3300003758 | Bacteria | 238584 |
| 10 | Ga0055527_1000018 | 3300003760 | Bacteria | 238584 |
| 11 | Ga0055535_1000020 | 3300003761 | Bacteria | 238584 |
| 12 | Ga0055542_1000031 | 3300003762 | Bacteria | 238584 |
| 13 | Ga0055529_1000036 | 3300003763 | Bacteria | 238584 |
| 14 | Ga0070683_100000793 | 3300005329 | Bacteria | 23313 |
| 15 | Ga0070683_100001714 | 3300005329 | Bacteria | 17052 |
| 16 | Ga0070683_100006401 | 3300005329 | Bacteria | 9872 |
| 17 | Ga0070677_10000001 | 3300005333 | Bacteria | 118426 |
| 18 | Ga0070666_10006232 | 3300005335 | Bacteria | 7339 |
| 19 | Ga0070680_100165540 | 3300005336 | Bacteria | 1859 |
| 20 | Ga0070682_100000028 | 3300005337 | Bacteria | 185177 |
| 21 | Ga0070682_100000080 | 3300005337 | Bacteria | 85683 |
| 22 | Ga0070682_100047503 | 3300005337 | Bacteria | 2669 |
| 23 | Ga0068868_100025268 | 3300005338 | Bacteria | 4516 |
| 24 | Ga0070660_100001908 | 3300005339 | Bacteria | 14358 |
| 25 | Ga0070661_100000005 | 3300005344 | Bacteria | 220455 |
| 26 | Ga0070692_10016545 | 3300005345 | Bacteria | 3509 |
| 27 | Ga0070692_10113514 | 3300005345 | Bacteria | 1502 |
| 28 | Ga0070668_100065188 | 3300005347 | Bacteria | 2825 |
| 29 | Ga0070675_100000058 | 3300005354 | Bacteria | 66874 |
| 30 | Ga0070673_100042333 | 3300005364 | Bacteria | 3511 |
| 31 | Ga0070688_100000333 | 3300005365 | Bacteria | 24059 |
| 32 | Ga0070688_100001703 | 3300005365 | Bacteria | 10976 |
| 33 | Ga0070659_100008190 | 3300005366 | Bacteria | 7629 |
| 34 | Ga0070659_100019461 | 3300005366 | Bacteria | 5145 |
| 35 | Ga0070667_100008884 | 3300005367 | Bacteria | 8317 |
| 36 | Ga0070667_100081695 | 3300005367 | Bacteria | 2766 |
| 37 | Ga0070714_100000010 | 3300005435 | Bacteria | 262871 |
| 38 | Ga0070714_100055753 | 3300005435 | Bacteria | 3379 |
| 39 | Ga0070713_100000138 | 3300005436 | Bacteria | 48026 |
| 40 | Ga0070711_100010844 | 3300005439 | Bacteria | 5650 |
| 41 | Ga0070663_100001885 | 3300005455 | Bacteria | 11713 |
| 42 | Ga0070663_100221174 | 3300005455 | Bacteria | 1487 |
| 43 | Ga0070678_100001346 | 3300005456 | Bacteria | 13080 |
| 44 | Ga0070678_100015439 | 3300005456 | Bacteria | 4857 |
| 45 | Ga0070662_100012866 | 3300005457 | Bacteria | 5558 |
| 46 | Ga0070681_10007735 | 3300005458 | Bacteria | 10506 |
| 47 | Ga0068867_100022346 | 3300005459 | Bacteria | 4523 |
| 48 | Ga0070685_10000293 | 3300005466 | Bacteria | 31562 |
| 49 | Ga0070685_10000886 | 3300005466 | Bacteria | 16173 |
| 50 | Ga0070679_100003822 | 3300005530 | Bacteria | 13829 |
| 51 | Ga0070684_100018819 | 3300005535 | Bacteria | 5698 |
| 52 | Ga0070684_100046934 | 3300005535 | Bacteria | 3743 |
| 53 | Ga0068853_100017082 | 3300005539 | Bacteria | 5985 |
| 54 | Ga0070672_100000004 | 3300005543 | Bacteria | 129970 |
| 55 | Ga0070672_100208629 | 3300005543 | Bacteria | 1635 |
| 56 | Ga0070693_100038570 | 3300005547 | Bacteria | 2671 |
| 57 | Ga0070665_100001101 | 3300005548 | Bacteria | 33337 |
| 58 | Ga0070665_100002504 | 3300005548 | Bacteria | 20206 |
| 59 | Ga0070665_100038122 | 3300005548 | Bacteria | 4831 |
| 60 | Ga0070704_100031708 | 3300005549 | Bacteria | 3558 |
| 61 | Ga0068855_100223427 | 3300005563 | Bacteria | 2111 |
| 62 | Ga0068855_100293533 | 3300005563 | Bacteria | 1802 |
| 63 | Ga0070664_100007598 | 3300005564 | Bacteria | 8754 |
| 64 | Ga0068854_100001309 | 3300005578 | Bacteria | 15008 |
| 65 | Ga0068854_100005379 | 3300005578 | Bacteria | 8082 |
| 66 | Ga0068856_100001818 | 3300005614 | Bacteria | 22286 |
| 67 | Ga0068856_100045849 | 3300005614 | Bacteria | 4305 |
| 68 | Ga0070702_100030489 | 3300005615 | Bacteria | 2941 |
| 69 | Ga0068852_100000012 | 3300005616 | Bacteria | 140734 |
| 70 | Ga0068852_100059648 | 3300005616 | Bacteria | 3309 |
| 71 | Ga0068852_100076606 | 3300005616 | Bacteria | 2953 |
| 72 | Ga0068851_10002153 | 3300005834 | Bacteria | 8660 |
| 73 | Ga0068851_10004144 | 3300005834 | Bacteria | 6525 |
| 74 | Ga0068851_10049325 | 3300005834 | Bacteria | 2135 |
| 75 | Ga0068870_10088203 | 3300005840 | Bacteria | 1729 |
| 76 | Ga0068863_100000004 | 3300005841 | Bacteria | 272478 |
| 77 | Ga0068858_100000033 | 3300005842 | Bacteria | 142748 |
| 78 | Ga0068858_100015212 | 3300005842 | Bacteria | 7239 |
| 79 | Ga0068858_100227435 | 3300005842 | Bacteria | 1768 |
| 80 | Ga0068860_100000261 | 3300005843 | Bacteria | 77163 |
| 81 | Ga0068862_100003740 | 3300005844 | Bacteria | 12983 |
| 82 | Ga0068862_100108215 | 3300005844 | Bacteria | 2438 |
| 83 | Ga0081455_10078252 | 3300005937 | Bacteria | 2717 |
| 84 | Ga0081538_10000030 | 3300005981 | Bacteria | 124321 |
| 85 | Ga0081538_10001837 | 3300005981 | Bacteria | 21406 |
| 86 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 87 | Ga0081539_10001978 | 3300005985 | Bacteria | 31196 |
| 88 | Ga0081539_10002242 | 3300005985 | Bacteria | 28126 |
| 89 | Ga0081539_10032849 | 3300005985 | Bacteria | 3171 |
| 90 | Ga0075365_10003588 | 3300006038 | Bacteria | 8029 |
| 91 | Ga0075365_10017892 | 3300006038 | Bacteria | 4348 |
| 92 | Ga0075365_10029336 | 3300006038 | Bacteria | 3515 |
| 93 | Ga0075365_10032858 | 3300006038 | Bacteria | 3339 |
| 94 | Ga0075365_10072968 | 3300006038 | Bacteria | 2312 |
| 95 | Ga0075363_100005478 | 3300006048 | Bacteria | 5655 |
| 96 | Ga0075363_100050215 | 3300006048 | Bacteria | 2222 |
| 97 | Ga0075363_100050303 | 3300006048 | Bacteria | 2220 |
| 98 | Ga0075364_10035240 | 3300006051 | Bacteria | 3234 |
| 99 | Ga0075364_10060122 | 3300006051 | Bacteria | 2492 |
| 100 | Ga0070712_100000777 | 3300006175 | Bacteria | 18846 |
| 101 | Ga0070712_100004050 | 3300006175 | Bacteria | 8996 |
| 102 | Ga0075367_10063884 | 3300006178 | Bacteria | 2201 |
| 103 | Ga0097621_100034816 | 3300006237 | Bacteria | 4019 |
| 104 | Ga0097621_100122296 | 3300006237 | Bacteria | 2208 |
| 105 | Ga0075430_100005002 | 3300006846 | Bacteria | 11159 |
| 106 | Ga0075430_100012685 | 3300006846 | Bacteria | 7179 |
| 107 | Ga0075431_100005559 | 3300006847 | Bacteria | 12444 |
| 108 | Ga0075431_100019598 | 3300006847 | Bacteria | 6900 |
| 109 | Ga0075431_100029237 | 3300006847 | Bacteria | 5670 |
| 110 | Ga0075429_100001085 | 3300006880 | Bacteria | 21851 |
| 111 | Ga0068865_100000017 | 3300006881 | Bacteria | 109636 |
| 112 | Ga0111539_10072809 | 3300009094 | Bacteria | 4052 |
| 113 | Ga0111539_10172881 | 3300009094 | Bacteria | 2524 |
| 114 | Ga0105245_10000056 | 3300009098 | Bacteria | 124109 |
| 115 | Ga0105245_10001028 | 3300009098 | Bacteria | 25351 |
| 116 | Ga0105245_10001521 | 3300009098 | Bacteria | 20984 |
| 117 | Ga0105245_10002366 | 3300009098 | Bacteria | 17041 |
| 118 | Ga0105245_10005382 | 3300009098 | Bacteria | 11251 |
| 119 | Ga0105245_10025166 | 3300009098 | Bacteria | 5234 |
| 120 | Ga0105247_10000202 | 3300009101 | Bacteria | 58345 |
| 121 | Ga0114129_10087710 | 3300009147 | Bacteria | 4314 |
| 122 | Ga0114129_10159301 | 3300009147 | Bacteria | 3085 |
| 123 | Ga0105243_10012791 | 3300009148 | Bacteria | 6339 |
| 124 | Ga0105243_10032752 | 3300009148 | Bacteria | 4018 |
| 125 | Ga0105242_10029750 | 3300009176 | Bacteria | 4356 |
| 126 | Ga0105242_10038289 | 3300009176 | Bacteria | 3856 |
| 127 | Ga0105242_10191320 | 3300009176 | Bacteria | 1812 |
| 128 | Ga0105248_10000032 | 3300009177 | Bacteria | 201114 |
| 129 | Ga0105248_10058936 | 3300009177 | Bacteria | 4312 |
| 130 | Ga0105238_10000023 | 3300009551 | Bacteria | 196844 |
| 131 | Ga0105238_10335629 | 3300009551 | Bacteria | 1499 |
| 132 | Ga0105249_10000074 | 3300009553 | Bacteria | 145235 |
| 133 | Ga0105249_10031524 | 3300009553 | Bacteria | 4794 |
| 134 | Ga0105239_10216771 | 3300010375 | Bacteria | 2146 |
| 135 | Ga0157369_10000099 | 3300013105 | Bacteria | 120032 |
| 136 | Ga0157369_10038995 | 3300013105 | Bacteria | 5193 |
| 137 | Ga0157374_10021164 | 3300013296 | Bacteria | 5782 |
| 138 | Ga0157378_10107124 | 3300013297 | Bacteria | 2557 |
| 139 | Ga0157372_10012132 | 3300013307 | Bacteria | 9179 |
| 140 | Ga0157375_10000363 | 3300013308 | Bacteria | 41402 |
| 141 | Ga0157375_10006935 | 3300013308 | Bacteria | 9891 |
| 142 | Ga0157380_10000219 | 3300014326 | Bacteria | 34156 |
| 143 | Ga0157380_10044365 | 3300014326 | Bacteria | 3484 |
| 144 | Ga0182008_10056875 | 3300014497 | Bacteria | 1932 |
| 145 | Ga0157379_10042205 | 3300014968 | Bacteria | 4072 |
| 146 | Ga0157376_10165310 | 3300014969 | Bacteria | 2010 |
| 147 | Ga0206353_10828458 | 3300020082 | Bacteria | 1468 |
| 148 | Ga0154015_1512999 | 3300020610 | Bacteria | 2807 |
| 149 | Ga0209674_100020 | 3300025226 | Bacteria | 672397 |
| 150 | Ga0209672_100013 | 3300025228 | Bacteria | 740693 |
| 151 | Ga0209147_100013 | 3300025229 | Bacteria | 660057 |
| 152 | Ga0209563_100665 | 3300025230 | Bacteria | 10953 |
| 153 | Ga0207427_102109 | 3300025231 | Bacteria | 5803 |
| 154 | Ga0209258_100016 | 3300025242 | Bacteria | 668622 |
| 155 | Ga0209148_1000020 | 3300025254 | Bacteria | 740693 |
| 156 | Ga0209759_1000083 | 3300025256 | Bacteria | 169561 |
| 157 | Ga0209233_1000153 | 3300025261 | Bacteria | 169839 |
| 158 | Ga0209455_1000017 | 3300025272 | Bacteria | 740693 |
| 159 | Ga0207656_10002206 | 3300025321 | Bacteria | 6521 |
| 160 | Ga0207656_10002277 | 3300025321 | Bacteria | 6435 |
| 161 | Ga0207682_10000034 | 3300025893 | Bacteria | 56869 |
| 162 | Ga0207710_10000369 | 3300025900 | Bacteria | 31539 |
| 163 | Ga0207688_10010418 | 3300025901 | Bacteria | 5060 |
| 164 | Ga0207688_10122882 | 3300025901 | Bacteria | 1516 |
| 165 | Ga0207680_10008255 | 3300025903 | Bacteria | 5105 |
| 166 | Ga0207699_10041782 | 3300025906 | Bacteria | 2651 |
| 167 | Ga0207693_10005072 | 3300025915 | Bacteria | 11047 |
| 168 | Ga0207657_10005100 | 3300025919 | Bacteria | 13759 |
| 169 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 170 | Ga0207652_10000549 | 3300025921 | Bacteria | 38051 |
| 171 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 172 | Ga0207694_10190269 | 3300025924 | Bacteria | 1667 |
| 173 | Ga0207659_10000020 | 3300025926 | Bacteria | 151552 |
| 174 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 175 | Ga0207687_10000026 | 3300025927 | Bacteria | 173968 |
| 176 | Ga0207687_10000055 | 3300025927 | Bacteria | 88382 |
| 177 | Ga0207687_10000970 | 3300025927 | Bacteria | 19492 |
| 178 | Ga0207687_10019105 | 3300025927 | Bacteria | 4536 |
| 179 | Ga0207700_10000008 | 3300025928 | Bacteria | 341717 |
| 180 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 181 | Ga0207700_10035060 | 3300025928 | Bacteria | 3610 |
| 182 | Ga0207664_10000009 | 3300025929 | Bacteria | 299246 |
| 183 | Ga0207690_10005579 | 3300025932 | Bacteria | 7434 |
| 184 | Ga0207706_10023359 | 3300025933 | Bacteria | 5553 |
| 185 | Ga0207704_10000025 | 3300025938 | Bacteria | 135523 |
| 186 | Ga0207665_10074152 | 3300025939 | Bacteria | 2329 |
| 187 | Ga0207691_10000020 | 3300025940 | Bacteria | 133465 |
| 188 | Ga0207691_10072774 | 3300025940 | Bacteria | 3100 |
| 189 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 190 | Ga0207661_10001238 | 3300025944 | Bacteria | 17056 |
| 191 | Ga0207661_10002911 | 3300025944 | Bacteria | 11827 |
| 192 | Ga0207661_10019224 | 3300025944 | Bacteria | 5089 |
| 193 | Ga0207679_10146940 | 3300025945 | Bacteria | 1913 |
| 194 | Ga0207667_10196160 | 3300025949 | Bacteria | 2071 |
| 195 | Ga0207667_10257249 | 3300025949 | Bacteria | 1786 |
| 196 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 197 | Ga0207712_10025194 | 3300025961 | Bacteria | 3950 |
| 198 | Ga0207712_10031773 | 3300025961 | Bacteria | 3558 |
| 199 | Ga0207668_10023389 | 3300025972 | Bacteria | 3970 |
| 200 | Ga0207640_10000137 | 3300025981 | Bacteria | 54133 |
| 201 | Ga0207658_10061153 | 3300025986 | Bacteria | 2813 |
| 202 | Ga0207658_10208971 | 3300025986 | Bacteria | 1634 |
| 203 | Ga0207677_10002845 | 3300026023 | Bacteria | 9125 |
| 204 | Ga0207677_10008940 | 3300026023 | Bacteria | 5618 |
| 205 | Ga0207703_10001103 | 3300026035 | Bacteria | 25585 |
| 206 | Ga0207703_10061704 | 3300026035 | Bacteria | 3070 |
| 207 | Ga0207639_10021360 | 3300026041 | Bacteria | 4649 |
| 208 | Ga0207678_10000994 | 3300026067 | Bacteria | 25831 |
| 209 | Ga0207678_10097293 | 3300026067 | Bacteria | 2515 |
| 210 | Ga0207708_10002088 | 3300026075 | Bacteria | 14696 |
| 211 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 212 | Ga0207702_10006846 | 3300026078 | Bacteria | 9777 |
| 213 | Ga0207641_10000170 | 3300026088 | Bacteria | 91128 |
| 214 | Ga0207641_10001861 | 3300026088 | Bacteria | 20273 |
| 215 | Ga0207648_10063423 | 3300026089 | Bacteria | 3221 |
| 216 | Ga0207648_10143456 | 3300026089 | Bacteria | 2106 |
| 217 | Ga0207676_10087524 | 3300026095 | Bacteria | 2548 |
| 218 | Ga0207675_100145493 | 3300026118 | Bacteria | 2253 |
| 219 | Ga0207683_10003046 | 3300026121 | Bacteria | 14655 |
| 220 | Ga0207683_10026972 | 3300026121 | Bacteria | 4964 |
| 221 | Ga0207683_10115981 | 3300026121 | Bacteria | 2401 |
| 222 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 223 | Ga0207698_10028397 | 3300026142 | Bacteria | 3989 |
| 224 | Ga0268266_10000553 | 3300028379 | Bacteria | 52199 |
| 225 | Ga0268266_10003738 | 3300028379 | Bacteria | 14964 |
| 226 | Ga0268266_10005059 | 3300028379 | Bacteria | 12438 |
| 227 | Ga0268266_10090379 | 3300028379 | Bacteria | 2684 |
| 228 | Ga0268264_10000315 | 3300028381 | Bacteria | 77227 |
| 229 | Ga0265326_10015191 | 3300028558 | Bacteria | 2237 |
| 230 | Ga0265319_1000028 | 3300028563 | Bacteria | 135557 |
| 231 | Ga0265338_10000230 | 3300028800 | Bacteria | 103891 |
| 232 | Ga0265329_10018239 | 3300031242 | Bacteria | 2402 |
| 233 | Ga0265316_10195202 | 3300031344 | Bacteria | 1502 |
| 234 | Ga0265342_10006624 | 3300031712 | Bacteria | 8599 |
| 235 | Ga0307413_10001669 | 3300031824 | Bacteria | 8622 |
| 236 | Ga0307410_10006945 | 3300031852 | Bacteria | 6155 |
| 237 | Ga0307406_10046474 | 3300031901 | Bacteria | 2731 |
| 238 | Ga0307407_10014086 | 3300031903 | Bacteria | 3904 |
| 239 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 240 | Ga0307409_100004004 | 3300031995 | Bacteria | 8173 |
| 241 | Ga0307416_100003565 | 3300032002 | Bacteria | 9183 |
| 242 | Ga0307415_100000648 | 3300032126 | Bacteria | 15309 |
| 243 | Ga0307415_100003877 | 3300032126 | Bacteria | 7679 |
| 244 | Ga0316580_10010155 | 3300032139 | Bacteria | 2837 |
| 245 | Ga0316574_0005027 | 3300035398 | Bacteria | 7023 |
| 246 | Ga0316574_0033102 | 3300035398 | Bacteria | 3146 |
| 247 | Ga0316574_0058819 | 3300035398 | Bacteria | 2408 |
| 248 | Ga0316574_0080513 | 3300035398 | Bacteria | 2067 |
| 249 | Ga0373937_0005061 | 3300036401 | Bacteria | 11221 |
| 250 | Ga0316584_0086540 | 3300036712 | Bacteria | 2346 |
| 251 | Ga0395900_0004818 | 3300037418 | Bacteria | 14210 |
| 252 | Ga0395898_0005549 | 3300037466 | Bacteria | 13607 |
| 253 | Ga0395898_0007373 | 3300037466 | Bacteria | 11673 |
| 254 | Ga0395898_0042358 | 3300037466 | Bacteria | 4493 |
| 255 | Ga0395905_0002784 | 3300037471 | Bacteria | 19150 |
| 256 | Ga0436364_1329731 | 3300037853 | Bacteria | 8563 |
| 257 | Ga0395901_0005064 | 3300038443 | Bacteria | 13313 |
| 258 | Ga0395901_0036821 | 3300038443 | Bacteria | 5058 |
| 259 | Ga0436365_0174667 | 3300039437 | Bacteria | 2475 |
| 260 | Ga0436365_0577226 | 3300039437 | Bacteria | 8812 |
| 261 | Ga0466966_0044477 | 3300044684 | Bacteria | 2843 |
| 262 | Ga0466963_0000200 | 3300044694 | Bacteria | 25265 |
| 263 | Ga0466963_0009579 | 3300044694 | Bacteria | 5837 |
| 264 | Ga0466963_0010282 | 3300044694 | Bacteria | 5662 |
| 265 | Ga0466963_0022334 | 3300044694 | Bacteria | 4006 |
| 266 | Ga0466963_0110312 | 3300044694 | Bacteria | 1888 |
| 267 | Ga0466964_0012249 | 3300044706 | Bacteria | 3245 |
| 268 | Ga0453684_0068898 | 3300044712 | Bacteria | 4490 |
| 269 | Ga0466968_0106275 | 3300044735 | Bacteria | 1258 |
| 270 | Ga0466957_0043615 | 3300044842 | Bacteria | 2717 |
| 271 | Ga0466960_0047245 | 3300044901 | Bacteria | 2064 |
| 272 | Ga0466959_0000506 | 3300045049 | Bacteria | 22637 |
| 273 | Ga0466959_0056299 | 3300045049 | Bacteria | 2869 |
| 274 | Ga0466958_0035354 | 3300045836 | Bacteria | 2984 |
| 275 | Ga0466967_0000046 | 3300045976 | Bacteria | 43911 |
| 276 | Ga0466967_0017345 | 3300045976 | Bacteria | 5713 |
| 277 | Ga0466967_0020342 | 3300045976 | Bacteria | 5362 |
| 278 | Ga0466967_0029456 | 3300045976 | Bacteria | 4594 |
| 279 | Ga0466967_0111386 | 3300045976 | Bacteria | 2515 |
| 280 | Ga0495603_0010100 | 3300046455 | Bacteria | 5713 |
| 281 | Ga0495590_0041308 | 3300046457 | Bacteria | 1608 |
| 282 | Ga0495629_0005486 | 3300046459 | Bacteria | 9470 |
| 283 | Ga0495638_0087261 | 3300046460 | Bacteria | 1885 |
| 284 | Ga0495653_0000534 | 3300046463 | Bacteria | 29072 |
| 285 | Ga0495650_0001882 | 3300046471 | Bacteria | 18669 |
| 286 | Ga0495580_0007843 | 3300046472 | Bacteria | 8548 |
| 287 | Ga0495582_0040869 | 3300046473 | Bacteria | 2555 |
| 288 | Ga0495605_0028546 | 3300046474 | Bacteria | 2879 |
| 289 | Ga0495662_0017153 | 3300046476 | Bacteria | 3505 |
| 290 | Ga0495594_0000013 | 3300046499 | Bacteria | 103201 |
| 291 | Ga0495606_0000211 | 3300046507 | Bacteria | 103386 |
| 292 | Ga0495606_0019523 | 3300046507 | Bacteria | 5037 |
| 293 | Ga0495606_0022171 | 3300046507 | Bacteria | 4635 |
| 294 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 295 | Ga0495608_0006968 | 3300046511 | Bacteria | 8001 |
| 296 | Ga0495610_0010620 | 3300046512 | Bacteria | 5707 |
| 297 | Ga0495618_0255802 | 3300046514 | Bacteria | 1098 |
| 298 | Ga0495620_0002733 | 3300046515 | Bacteria | 10163 |
| 299 | Ga0495628_0025109 | 3300046516 | Bacteria | 4871 |
| 300 | Ga0495628_0074742 | 3300046516 | Bacteria | 2639 |
| 301 | Ga0495628_0178216 | 3300046516 | Bacteria | 1609 |
| 302 | Ga0495630_0000025 | 3300046517 | Bacteria | 152364 |
| 303 | Ga0495630_0011301 | 3300046517 | Bacteria | 6459 |
| 304 | Ga0495630_0040971 | 3300046517 | Bacteria | 3460 |
| 305 | Ga0495642_0011502 | 3300046528 | Bacteria | 3401 |
| 306 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 307 | Ga0495652_0013065 | 3300046529 | Bacteria | 7479 |
| 308 | Ga0495665_0000083 | 3300046531 | Bacteria | 41848 |
| 309 | Ga0495665_0021078 | 3300046531 | Bacteria | 3501 |
| 310 | Ga0495586_0134007 | 3300046535 | Bacteria | 1388 |
| 311 | Ga0495587_0001970 | 3300046536 | Bacteria | 13697 |
| 312 | Ga0495645_0029744 | 3300046543 | Bacteria | 3975 |
| 313 | Ga0495645_0065391 | 3300046543 | Bacteria | 2630 |
| 314 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 315 | Ga0495667_0000075 | 3300046559 | Bacteria | 73540 |
| 316 | Ga0495656_0000982 | 3300046615 | Bacteria | 9239 |
| 317 | Ga0495634_0003604 | 3300046642 | Bacteria | 12372 |
| 318 | Ga0495625_0000029 | 3300046660 | Bacteria | 244646 |
| 319 | Ga0495635_0105946 | 3300046663 | Bacteria | 1921 |
| 320 | Ga0495588_0000311 | 3300046674 | Bacteria | 33416 |
| 321 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 322 | Ga0495623_0001384 | 3300046679 | Bacteria | 16462 |
| 323 | Ga0495646_0000842 | 3300046680 | Bacteria | 17354 |
| 324 | Ga0495646_0080772 | 3300046680 | Bacteria | 1896 |
| 325 | Ga0495647_0000293 | 3300046681 | Bacteria | 13969 |
| 326 | Ga0495658_0001056 | 3300046683 | Bacteria | 14543 |
| 327 | Ga0495669_0004513 | 3300046684 | Bacteria | 5755 |
| 328 | Ga0495669_0104003 | 3300046684 | Bacteria | 1321 |
| 329 | Ga0495613_0000309 | 3300046689 | Bacteria | 44163 |
| 330 | Ga0495624_0000719 | 3300046690 | Bacteria | 25951 |
| 331 | Ga0495624_0003672 | 3300046690 | Bacteria | 11342 |
| 332 | Ga0495624_0011387 | 3300046690 | Bacteria | 6111 |
| 333 | Ga0495649_0000972 | 3300046694 | Bacteria | 22610 |
| 334 | Ga0495649_0001198 | 3300046694 | Bacteria | 20005 |
| 335 | Ga0495649_0034392 | 3300046694 | Bacteria | 2788 |
| 336 | Ga0495600_0012953 | 3300046809 | Bacteria | 5228 |
| 337 | Ga0495600_0028407 | 3300046809 | Bacteria | 3619 |
| 338 | Ga0495600_0129061 | 3300046809 | Bacteria | 1643 |
| 339 | Ga0495660_0100466 | 3300046810 | Bacteria | 1490 |
| 340 | Ga0495604_0000013 | 3300047317 | Bacteria | 234578 |
| 341 | Ga0495604_0027640 | 3300047317 | Bacteria | 4509 |
| 342 | Ga0495604_0072646 | 3300047317 | Bacteria | 2599 |
| 343 | Ga0495674_0000042 | 3300047319 | Bacteria | 94820 |
| 344 | Ga0495674_0002697 | 3300047319 | Bacteria | 17280 |
| 345 | Ga0495674_0003180 | 3300047319 | Bacteria | 15950 |
| 346 | Ga0495676_0064978 | 3300047321 | Bacteria | 2834 |
| 347 | Ga0495680_0000196 | 3300047322 | Bacteria | 65437 |
| 348 | Ga0495680_0002599 | 3300047322 | Bacteria | 18367 |
| 349 | Ga0495683_0013340 | 3300047323 | Bacteria | 4299 |
| 350 | Ga0495687_011042 | 3300047443 | Bacteria | 4890 |
| 351 | Ga0495687_012975 | 3300047443 | Bacteria | 4371 |
| 352 | Ga0495675_0000209 | 3300047444 | Bacteria | 42691 |
| 353 | Ga0495686_0146906 | 3300047472 | Bacteria | 1387 |
| 354 | Ga0495593_0000073 | 3300047673 | Bacteria | 42582 |
| 355 | Ga0495602_0000228 | 3300048088 | Bacteria | 52649 |
| 356 | Ga0495602_0000556 | 3300048088 | Bacteria | 34773 |
| 357 | Ga0495602_0097009 | 3300048088 | Bacteria | 2430 |
| 358 | Ga0495614_0035306 | 3300048089 | Bacteria | 2148 |
| 359 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 360 | Ga0496100_0005490 | 3300048903 | Bacteria | 6836 |
| 361 | Ga0496100_0110829 | 3300048903 | Bacteria | 1906 |
| 362 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 363 | Ga0496102_0015880 | 3300048905 | Bacteria | 6567 |
| 364 | Ga0496102_0073675 | 3300048905 | Bacteria | 3138 |
| 365 | Ga0496102_0292966 | 3300048905 | Bacteria | 1534 |
| 366 | Ga0496103_0076910 | 3300048906 | Bacteria | 2095 |
| 367 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 368 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 369 | Ga0496104_0000576 | 3300048907 | Bacteria | 31360 |
| 370 | Ga0496104_0216067 | 3300048907 | Bacteria | 1829 |
| 371 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 372 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 373 | Ga0496105_0000488 | 3300048908 | Bacteria | 26096 |
| 374 | Ga0496106_0000022 | 3300048909 | Bacteria | 166339 |
| 375 | Ga0496106_0000864 | 3300048909 | Bacteria | 22031 |
| 376 | Ga0496106_0024135 | 3300048909 | Bacteria | 4520 |
| 377 | Ga0496106_0087862 | 3300048909 | Bacteria | 2395 |
| 378 | Ga0496107_0000016 | 3300048910 | Bacteria | 172319 |
| 379 | Ga0496107_0002031 | 3300048910 | Bacteria | 12927 |
| 380 | Ga0496107_0059311 | 3300048910 | Bacteria | 2769 |
| 381 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 382 | Ga0496108_0000045 | 3300048911 | Bacteria | 137416 |
| 383 | Ga0496108_0002417 | 3300048911 | Bacteria | 14918 |
| 384 | Ga0496108_0004290 | 3300048911 | Bacteria | 11478 |
| 385 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 386 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 387 | Ga0496109_0000032 | 3300048912 | Bacteria | 162984 |
| 388 | Ga0496109_0000279 | 3300048912 | Bacteria | 48999 |
| 389 | Ga0496109_0014159 | 3300048912 | Bacteria | 6935 |
| 390 | Ga0496110_0004071 | 3300048913 | Bacteria | 11281 |
| 391 | Ga0496110_0005343 | 3300048913 | Bacteria | 10063 |
| 392 | Ga0496110_0008950 | 3300048913 | Bacteria | 8073 |
| 393 | Ga0496110_0011873 | 3300048913 | Bacteria | 7155 |
| 394 | Ga0496110_0031965 | 3300048913 | Bacteria | 4542 |
| 395 | Ga0496110_0347454 | 3300048913 | Bacteria | 1351 |
| 396 | Ga0496111_0001844 | 3300048914 | Bacteria | 12488 |
| 397 | Ga0496111_0005974 | 3300048914 | Bacteria | 7858 |
| 398 | Ga0496111_0014518 | 3300048914 | Bacteria | 5384 |
| 399 | Ga0496112_0005132 | 3300048915 | Bacteria | 11255 |
| 400 | Ga0496112_0215752 | 3300048915 | Bacteria | 1875 |
| 401 | Ga0496112_0455046 | 3300048915 | Bacteria | 1218 |
| 402 | Ga0496113_0002212 | 3300048916 | Bacteria | 11219 |
| 403 | Ga0496113_0019863 | 3300048916 | Bacteria | 4710 |
| 404 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 405 | Ga0496114_0007982 | 3300048917 | Bacteria | 8374 |
| 406 | Ga0496115_0000020 | 3300048918 | Bacteria | 171995 |
| 407 | Ga0496115_0000157 | 3300048918 | Bacteria | 63822 |
| 408 | Ga0496115_0000209 | 3300048918 | Bacteria | 54079 |
| 409 | Ga0496115_0002818 | 3300048918 | Bacteria | 12497 |
| 410 | Ga0496115_0007706 | 3300048918 | Bacteria | 7940 |
| 411 | Ga0496117_0020122 | 3300048920 | Bacteria | 5452 |
| 412 | Ga0496118_0013441 | 3300048921 | Bacteria | 7743 |
| 413 | Ga0496119_0046169 | 3300048922 | Bacteria | 2723 |
| 414 | Ga0496121_0018233 | 3300048924 | Bacteria | 7095 |
| 415 | Ga0496124_0094249 | 3300048927 | Bacteria | 2435 |
| 416 | Ga0495682_0001688 | 3300049460 | Bacteria | 11253 |
| 417 | Ga0501031_0008042 | 3300049568 | Bacteria | 6868 |
| 418 | Ga0501032_0022643 | 3300049569 | Bacteria | 4353 |
| 419 | Ga0501036_0059718 | 3300049572 | Bacteria | 3231 |
| 420 | Ga0501036_0122879 | 3300049572 | Bacteria | 2192 |
| 421 | Ga0501037_0021892 | 3300049573 | Bacteria | 4732 |
| 422 | Ga0501038_0001145 | 3300049574 | Bacteria | 24031 |
| 423 | Ga0501038_0140220 | 3300049574 | Bacteria | 1978 |
| 424 | Ga0501042_0096568 | 3300049578 | Bacteria | 2123 |
| 425 | Ga0501042_0121531 | 3300049578 | Bacteria | 1880 |
| 426 | Ga0501042_0161627 | 3300049578 | Bacteria | 1616 |
| 427 | Ga0501043_0006461 | 3300049579 | Bacteria | 9411 |
| 428 | Ga0501046_0037262 | 3300049580 | Bacteria | 3908 |
| 429 | Ga0501046_0050815 | 3300049580 | Bacteria | 3274 |
| 430 | Ga0501047_0014205 | 3300049581 | Bacteria | 7568 |
| 431 | Ga0501047_0089911 | 3300049581 | Bacteria | 2947 |
| 432 | Ga0501048_0000032 | 3300049582 | Bacteria | 65543 |
| 433 | Ga0501069_0045065 | 3300049585 | Bacteria | 2442 |
| 434 | Ga0501070_0030642 | 3300049586 | Bacteria | 4507 |
| 435 | Ga0501070_0042301 | 3300049586 | Bacteria | 3794 |
| 436 | Ga0501070_0091697 | 3300049586 | Bacteria | 2514 |
| 437 | Ga0501071_0006530 | 3300049587 | Bacteria | 7573 |
| 438 | Ga0501071_0065363 | 3300049587 | Bacteria | 2641 |
| 439 | Ga0501071_0081188 | 3300049587 | Bacteria | 2373 |
| 440 | Ga0501071_0081514 | 3300049587 | Bacteria | 2368 |
| 441 | Ga0501072_0006551 | 3300049588 | Bacteria | 8869 |
| 442 | Ga0501072_0028473 | 3300049588 | Bacteria | 4362 |
| 443 | Ga0501073_0060033 | 3300049589 | Bacteria | 2654 |
| 444 | Ga0501073_0068973 | 3300049589 | Bacteria | 2464 |
| 445 | Ga0501074_0045086 | 3300049590 | Bacteria | 3190 |
| 446 | Ga0501074_0279884 | 3300049590 | Bacteria | 1186 |
| 447 | Ga0501075_0033687 | 3300049591 | Bacteria | 3811 |
| 448 | Ga0501075_0192210 | 3300049591 | Bacteria | 1557 |
| 449 | Ga0501079_0003967 | 3300049741 | Bacteria | 10933 |
| 450 | Ga0501079_0047986 | 3300049741 | Bacteria | 3295 |
| 451 | Ga0501080_0099039 | 3300049742 | Bacteria | 2705 |
| 452 | Ga0501080_0339415 | 3300049742 | Bacteria | 1358 |
| 453 | Ga0501083_0091822 | 3300049744 | Bacteria | 2004 |
| 454 | Ga0501035_0004956 | 3300049822 | Bacteria | 12626 |
| 455 | Ga0501044_0070355 | 3300049823 | Bacteria | 3559 |
| 456 | Ga0501044_0086899 | 3300049823 | Bacteria | 3158 |
| 457 | Ga0501044_0225133 | 3300049823 | Bacteria | 1825 |
| 458 | Ga0501045_0103207 | 3300049824 | Bacteria | 2111 |
| 459 | Ga0501045_0111614 | 3300049824 | Bacteria | 2027 |
| 460 | Ga0501045_0126250 | 3300049824 | Bacteria | 1901 |
| 461 | nmdc:mga03n38_37693_c1 | 3300050490 | Bacteria | 2087 |
| 462 | nmdc:mga03n38_79282_c1 | 3300050490 | Bacteria | 1539 |
| 463 | nmdc:mga00v17_41581_c1 | 3300050491 | Bacteria | 2761 |
| 464 | nmdc:mga0yw44_15873_c1 | 3300050492 | Bacteria | 4050 |
| 465 | nmdc:mga0yw44_5488_c1 | 3300050492 | Bacteria | 6000 |
| 466 | nmdc:mga0yw44_6126_c1 | 3300050492 | Bacteria | 5776 |
| 467 | nmdc:mga0yw44_70758_c1 | 3300050492 | Bacteria | 2164 |
| 468 | nmdc:mga0yw44_78214_c1 | 3300050492 | Bacteria | 2068 |
| 469 | nmdc:mga05p37_38503_c1 | 3300050507 | Bacteria | 5865 |
| 470 | nmdc:mga05p37_48899_c1 | 3300050507 | Bacteria | 5200 |
| 471 | nmdc:mga09592_18827_c1 | 3300050508 | Bacteria | 5665 |
| 472 | nmdc:mga0qj67_3971_c1 | 3300050509 | Bacteria | 10703 |
| 473 | nmdc:mga0qj67_43201_c1 | 3300050509 | Bacteria | 3549 |
| 474 | nmdc:mga06r32_21279_c1 | 3300050510 | Bacteria | 5986 |
| 475 | nmdc:mga06r32_237436_c1 | 3300050510 | Bacteria | 1811 |
| 476 | nmdc:mga08y16_121188_c1 | 3300050511 | Bacteria | 2722 |
| 477 | nmdc:mga0a205_3124_c1 | 3300050515 | Bacteria | 14696 |
| 478 | Ga0495601_0000097 | 3300053077 | Bacteria | 48380 |
| 479 | Ga0495601_0011384 | 3300053077 | Bacteria | 5319 |
| 480 | Ga0495612_0000228 | 3300053078 | Bacteria | 23756 |
| 481 | Ga0495612_0004552 | 3300053078 | Bacteria | 5755 |
| 482 | Ga0495612_0005157 | 3300053078 | Bacteria | 5400 |
| 483 | Ga0495655_0000011 | 3300053083 | Bacteria | 118490 |
| 484 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 485 | Ga0495595_0012587 | 3300053084 | Bacteria | 3560 |
| 486 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 487 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 488 | Ga0495619_0000319 | 3300053085 | Bacteria | 33678 |
| 489 | Ga0495619_0003460 | 3300053085 | Bacteria | 10187 |
| 490 | Ga0495619_0005740 | 3300053085 | Bacteria | 7864 |
| 491 | Ga0500628_000032 | 3300053129 | Bacteria | 52752 |
| 492 | Ga0500616_0001741 | 3300053153 | Bacteria | 19953 |
| 493 | Ga0500616_0061029 | 3300053153 | Bacteria | 1953 |
| 494 | Ga0501084_0144037 | 3300054114 | Bacteria | 2007 |
| 495 | Ga0501082_0123072 | 3300060353 | Bacteria | 2249 |
| 496 | Ga0530510_0006377 | 3300061734 | Bacteria | 8212 |
| 497 | 2738823361 | 2738541296 | Bacteria | 7285013 |
| 498 | 2738835537 | 2738541298 | Bacteria | 7286732 |
| 499 | 2738877282 | 2738541306 | Bacteria | 7284992 |
| 500 | 2739188988 | 2738543002 | Bacteria | 7284546 |
| 501 | 2739223875 | 2738543008 | Bacteria | 7282815 |
| 502 | 2792835204 | 2791355137 | Bacteria | 9654227 |
| 503 | 2904488666 | 2904483920 | Bacteria | 7545285 |
| 504 | 2904621083 | 2904615490 | Bacteria | 10047340 |
| 505 | 2919529281 | 2919527303 | Bacteria | 7718827 |
| 506 | 2945936034 | 2945934425 | Bacteria | 7444609 |
| 507 | 2990710061 | 2990703756 | Bacteria | 7715990 |
| 508 | 642422601 | 641736151 | Bacteria | 7477263 |
| 509 | 8055266403 | 8055266321 | Bacteria | 7999742 |
| 510 | Ga0081538_10000058 | |||
| 511 | JGI24740J21852_10002907 | |||
| 512 | JGI24739J22299_10000759 | |||
| 513 | JGI25156J39149_1001752 | |||
| 514 | JGI25406J46586_10051627 | |||
| 515 | JGI25165J46597_1001131 | |||
| 516 | JGI25404J52841_10003243 | |||
| 517 | Ga0055533_1000195 | |||
| 518 | Ga0055532_1000026 | |||
| 519 | Ga0055527_1000018 | |||
| 520 | Ga0055535_1000020 | |||
| 521 | Ga0055542_1000031 | |||
| 522 | Ga0055529_1000036 | |||
| 523 | Ga0070683_100000793 | |||
| 524 | Ga0070683_100001714 | |||
| 525 | Ga0070683_100006401 | |||
| 526 | Ga0070677_10000001 | |||
| 527 | Ga0070666_10006232 | |||
| 528 | Ga0070680_100165540 | |||
| 529 | Ga0070682_100000028 | |||
| 530 | Ga0070682_100000080 | |||
| 531 | Ga0070682_100047503 | |||
| 532 | Ga0068868_100025268 | |||
| 533 | Ga0070660_100001908 | |||
| 534 | Ga0070661_100000005 | |||
| 535 | Ga0070692_10016545 | |||
| 536 | Ga0070692_10113514 | |||
| 537 | Ga0070668_100065188 | |||
| 538 | Ga0070675_100000058 | |||
| 539 | Ga0070673_100042333 | |||
| 540 | Ga0070688_100000333 | |||
| 541 | Ga0070688_100001703 | |||
| 542 | Ga0070659_100008190 | |||
| 543 | Ga0070659_100019461 | |||
| 544 | Ga0070667_100008884 | |||
| 545 | Ga0070667_100081695 | |||
| 546 | Ga0070714_100000010 | |||
| 547 | Ga0070714_100055753 | |||
| 548 | Ga0070713_100000138 | |||
| 549 | Ga0070711_100010844 | |||
| 550 | Ga0070663_100001885 | |||
| 551 | Ga0070663_100221174 | |||
| 552 | Ga0070678_100001346 | |||
| 553 | Ga0070678_100015439 | |||
| 554 | Ga0070662_100012866 | |||
| 555 | Ga0070681_10007735 | |||
| 556 | Ga0068867_100022346 | |||
| 557 | Ga0070685_10000293 | |||
| 558 | Ga0070685_10000886 | |||
| 559 | Ga0070679_100003822 | |||
| 560 | Ga0070684_100018819 | |||
| 561 | Ga0070684_100046934 | |||
| 562 | Ga0068853_100017082 | |||
| 563 | Ga0070672_100000004 | |||
| 564 | Ga0070672_100208629 | |||
| 565 | Ga0070693_100038570 | |||
| 566 | Ga0070665_100001101 | |||
| 567 | Ga0070665_100002504 | |||
| 568 | Ga0070665_100038122 | |||
| 569 | Ga0070704_100031708 | |||
| 570 | Ga0068855_100223427 | |||
| 571 | Ga0068855_100293533 | |||
| 572 | Ga0070664_100007598 | |||
| 573 | Ga0068854_100001309 | |||
| 574 | Ga0068854_100005379 | |||
| 575 | Ga0068856_100001818 | |||
| 576 | Ga0068856_100045849 | |||
| 577 | Ga0070702_100030489 | |||
| 578 | Ga0068852_100000012 | |||
| 579 | Ga0068852_100059648 | |||
| 580 | Ga0068852_100076606 | |||
| 581 | Ga0068851_10002153 | |||
| 582 | Ga0068851_10004144 | |||
| 583 | Ga0068851_10049325 | |||
| 584 | Ga0068870_10088203 | |||
| 585 | Ga0068863_100000004 | |||
| 586 | Ga0068858_100000033 | |||
| 587 | Ga0068858_100015212 | |||
| 588 | Ga0068858_100227435 | |||
| 589 | Ga0068860_100000261 | |||
| 590 | Ga0068862_100003740 | |||
| 591 | Ga0068862_100108215 | |||
| 592 | Ga0081455_10078252 | |||
| 593 | Ga0081538_10000030 | |||
| 594 | Ga0081538_10001837 | |||
| 595 | Ga0081540_1000006 | |||
| 596 | Ga0081539_10001978 | |||
| 597 | Ga0081539_10002242 | |||
| 598 | Ga0081539_10032849 | |||
| 599 | Ga0075365_10003588 | |||
| 600 | Ga0075365_10017892 | |||
| 601 | Ga0075365_10029336 | |||
| 602 | Ga0075365_10032858 | |||
| 603 | Ga0075365_10072968 | |||
| 604 | Ga0075363_100005478 | |||
| 605 | Ga0075363_100050215 | |||
| 606 | Ga0075363_100050303 | |||
| 607 | Ga0075364_10035240 | |||
| 608 | Ga0075364_10060122 | |||
| 609 | Ga0070712_100000777 | |||
| 610 | Ga0070712_100004050 | |||
| 611 | Ga0075367_10063884 | |||
| 612 | Ga0097621_100034816 | |||
| 613 | Ga0097621_100122296 | |||
| 614 | Ga0075430_100005002 | |||
| 615 | Ga0075430_100012685 | |||
| 616 | Ga0075431_100005559 | |||
| 617 | Ga0075431_100019598 | |||
| 618 | Ga0075431_100029237 | |||
| 619 | Ga0075429_100001085 | |||
| 620 | Ga0068865_100000017 | |||
| 621 | Ga0111539_10072809 | |||
| 622 | Ga0111539_10172881 | |||
| 623 | Ga0105245_10000056 | |||
| 624 | Ga0105245_10001028 | |||
| 625 | Ga0105245_10001521 | |||
| 626 | Ga0105245_10002366 | |||
| 627 | Ga0105245_10005382 | |||
| 628 | Ga0105245_10025166 | |||
| 629 | Ga0105247_10000202 | |||
| 630 | Ga0114129_10087710 | |||
| 631 | Ga0114129_10159301 | |||
| 632 | Ga0105243_10012791 | |||
| 633 | Ga0105243_10032752 | |||
| 634 | Ga0105242_10029750 | |||
| 635 | Ga0105242_10038289 | |||
| 636 | Ga0105242_10191320 | |||
| 637 | Ga0105248_10000032 | |||
| 638 | Ga0105248_10058936 | |||
| 639 | Ga0105238_10000023 | |||
| 640 | Ga0105238_10335629 | |||
| 641 | Ga0105249_10000074 | |||
| 642 | Ga0105249_10031524 | |||
| 643 | Ga0105239_10216771 | |||
| 644 | Ga0157369_10000099 | |||
| 645 | Ga0157369_10038995 | |||
| 646 | Ga0157374_10021164 | |||
| 647 | Ga0157378_10107124 | |||
| 648 | Ga0157372_10012132 | |||
| 649 | Ga0157375_10000363 | |||
| 650 | Ga0157375_10006935 | |||
| 651 | Ga0157380_10000219 | |||
| 652 | Ga0157380_10044365 | |||
| 653 | Ga0182008_10056875 | |||
| 654 | Ga0157379_10042205 | |||
| 655 | Ga0157376_10165310 | |||
| 656 | Ga0206353_10828458 | |||
| 657 | Ga0154015_1512999 | |||
| 658 | Ga0209674_100020 | |||
| 659 | Ga0209672_100013 | |||
| 660 | Ga0209147_100013 | |||
| 661 | Ga0209563_100665 | |||
| 662 | Ga0207427_102109 | |||
| 663 | Ga0209258_100016 | |||
| 664 | Ga0209148_1000020 | |||
| 665 | Ga0209759_1000083 | |||
| 666 | Ga0209233_1000153 | |||
| 667 | Ga0209455_1000017 | |||
| 668 | Ga0207656_10002206 | |||
| 669 | Ga0207656_10002277 | |||
| 670 | Ga0207682_10000034 | |||
| 671 | Ga0207710_10000369 | |||
| 672 | Ga0207688_10010418 | |||
| 673 | Ga0207688_10122882 | |||
| 674 | Ga0207680_10008255 | |||
| 675 | Ga0207699_10041782 | |||
| 676 | Ga0207693_10005072 | |||
| 677 | Ga0207657_10005100 | |||
| 678 | Ga0207649_10000005 | |||
| 679 | Ga0207652_10000549 | |||
| 680 | Ga0207694_10000004 | |||
| 681 | Ga0207694_10190269 | |||
| 682 | Ga0207659_10000020 | |||
| 683 | Ga0207687_10000007 | |||
| 684 | Ga0207687_10000026 | |||
| 685 | Ga0207687_10000055 | |||
| 686 | Ga0207687_10000970 | |||
| 687 | Ga0207687_10019105 | |||
| 688 | Ga0207700_10000008 | |||
| 689 | Ga0207700_10000016 | |||
| 690 | Ga0207700_10035060 | |||
| 691 | Ga0207664_10000009 | |||
| 692 | Ga0207690_10005579 | |||
| 693 | Ga0207706_10023359 | |||
| 694 | Ga0207704_10000025 | |||
| 695 | Ga0207665_10074152 | |||
| 696 | Ga0207691_10000020 | |||
| 697 | Ga0207691_10072774 | |||
| 698 | Ga0207711_10000020 | |||
| 699 | Ga0207661_10001238 | |||
| 700 | Ga0207661_10002911 | |||
| 701 | Ga0207661_10019224 | |||
| 702 | Ga0207679_10146940 | |||
| 703 | Ga0207667_10196160 | |||
| 704 | Ga0207667_10257249 | |||
| 705 | Ga0207712_10000007 | |||
| 706 | Ga0207712_10025194 | |||
| 707 | Ga0207712_10031773 | |||
| 708 | Ga0207668_10023389 | |||
| 709 | Ga0207640_10000137 | |||
| 710 | Ga0207658_10061153 | |||
| 711 | Ga0207658_10208971 | |||
| 712 | Ga0207677_10002845 | |||
| 713 | Ga0207677_10008940 | |||
| 714 | Ga0207703_10001103 | |||
| 715 | Ga0207703_10061704 | |||
| 716 | Ga0207639_10021360 | |||
| 717 | Ga0207678_10000994 | |||
| 718 | Ga0207678_10097293 | |||
| 719 | Ga0207708_10002088 | |||
| 720 | Ga0207702_10000016 | |||
| 721 | Ga0207702_10006846 | |||
| 722 | Ga0207641_10000170 | |||
| 723 | Ga0207641_10001861 | |||
| 724 | Ga0207648_10063423 | |||
| 725 | Ga0207648_10143456 | |||
| 726 | Ga0207676_10087524 | |||
| 727 | Ga0207675_100145493 | |||
| 728 | Ga0207683_10003046 | |||
| 729 | Ga0207683_10026972 | |||
| 730 | Ga0207683_10115981 | |||
| 731 | Ga0207698_10000012 | |||
| 732 | Ga0207698_10028397 | |||
| 733 | Ga0268266_10000553 | |||
| 734 | Ga0268266_10003738 | |||
| 735 | Ga0268266_10005059 | |||
| 736 | Ga0268266_10090379 | |||
| 737 | Ga0268264_10000315 | |||
| 738 | Ga0265326_10015191 | |||
| 739 | Ga0265319_1000028 | |||
| 740 | Ga0265338_10000230 | |||
| 741 | Ga0265329_10018239 | |||
| 742 | Ga0265316_10195202 | |||
| 743 | Ga0265342_10006624 | |||
| 744 | Ga0307413_10001669 | |||
| 745 | Ga0307410_10006945 | |||
| 746 | Ga0307406_10046474 | |||
| 747 | Ga0307407_10014086 | |||
| 748 | Ga0307412_10000005 | |||
| 749 | Ga0307409_100004004 | |||
| 750 | Ga0307416_100003565 | |||
| 751 | Ga0307415_100000648 | |||
| 752 | Ga0307415_100003877 | |||
| 753 | Ga0316580_10010155 | |||
| 754 | Ga0316574_0005027 | |||
| 755 | Ga0316574_0033102 | |||
| 756 | Ga0316574_0058819 | |||
| 757 | Ga0316574_0080513 | |||
| 758 | Ga0373937_0005061 | |||
| 759 | Ga0316584_0086540 | |||
| 760 | Ga0395900_0004818 | |||
| 761 | Ga0395898_0005549 | |||
| 762 | Ga0395898_0007373 | |||
| 763 | Ga0395898_0042358 | |||
| 764 | Ga0395905_0002784 | |||
| 765 | Ga0436364_1329731 | |||
| 766 | Ga0395901_0005064 | |||
| 767 | Ga0395901_0036821 | |||
| 768 | Ga0436365_0174667 | |||
| 769 | Ga0436365_0577226 | |||
| 770 | Ga0466966_0044477 | |||
| 771 | Ga0466963_0000200 | |||
| 772 | Ga0466963_0009579 | |||
| 773 | Ga0466963_0010282 | |||
| 774 | Ga0466963_0022334 | |||
| 775 | Ga0466963_0110312 | |||
| 776 | Ga0466964_0012249 | |||
| 777 | Ga0453684_0068898 | |||
| 778 | Ga0466968_0106275 | |||
| 779 | Ga0466957_0043615 | |||
| 780 | Ga0466960_0047245 | |||
| 781 | Ga0466959_0000506 | |||
| 782 | Ga0466959_0056299 | |||
| 783 | Ga0466958_0035354 | |||
| 784 | Ga0466967_0000046 | |||
| 785 | Ga0466967_0017345 | |||
| 786 | Ga0466967_0020342 | |||
| 787 | Ga0466967_0029456 | |||
| 788 | Ga0466967_0111386 | |||
| 789 | Ga0495603_0010100 | |||
| 790 | Ga0495590_0041308 | |||
| 791 | Ga0495629_0005486 | |||
| 792 | Ga0495638_0087261 | |||
| 793 | Ga0495653_0000534 | |||
| 794 | Ga0495650_0001882 | |||
| 795 | Ga0495580_0007843 | |||
| 796 | Ga0495582_0040869 | |||
| 797 | Ga0495605_0028546 | |||
| 798 | Ga0495662_0017153 | |||
| 799 | Ga0495594_0000013 | |||
| 800 | Ga0495606_0000211 | |||
| 801 | Ga0495606_0019523 | |||
| 802 | Ga0495606_0022171 | |||
| 803 | Ga0495608_0000031 | |||
| 804 | Ga0495608_0006968 | |||
| 805 | Ga0495610_0010620 | |||
| 806 | Ga0495618_0255802 | |||
| 807 | Ga0495620_0002733 | |||
| 808 | Ga0495628_0025109 | |||
| 809 | Ga0495628_0074742 | |||
| 810 | Ga0495628_0178216 | |||
| 811 | Ga0495630_0000025 | |||
| 812 | Ga0495630_0011301 | |||
| 813 | Ga0495630_0040971 | |||
| 814 | Ga0495642_0011502 | |||
| 815 | Ga0495652_0000003 | |||
| 816 | Ga0495652_0013065 | |||
| 817 | Ga0495665_0000083 | |||
| 818 | Ga0495665_0021078 | |||
| 819 | Ga0495586_0134007 | |||
| 820 | Ga0495587_0001970 | |||
| 821 | Ga0495645_0029744 | |||
| 822 | Ga0495645_0065391 | |||
| 823 | Ga0495622_0000014 | |||
| 824 | Ga0495667_0000075 | |||
| 825 | Ga0495656_0000982 | |||
| 826 | Ga0495634_0003604 | |||
| 827 | Ga0495625_0000029 | |||
| 828 | Ga0495635_0105946 | |||
| 829 | Ga0495588_0000311 | |||
| 830 | Ga0495657_0000024 | |||
| 831 | Ga0495623_0001384 | |||
| 832 | Ga0495646_0000842 | |||
| 833 | Ga0495646_0080772 | |||
| 834 | Ga0495647_0000293 | |||
| 835 | Ga0495658_0001056 | |||
| 836 | Ga0495669_0004513 | |||
| 837 | Ga0495669_0104003 | |||
| 838 | Ga0495613_0000309 | |||
| 839 | Ga0495624_0000719 | |||
| 840 | Ga0495624_0003672 | |||
| 841 | Ga0495624_0011387 | |||
| 842 | Ga0495649_0000972 | |||
| 843 | Ga0495649_0001198 | |||
| 844 | Ga0495649_0034392 | |||
| 845 | Ga0495600_0012953 | |||
| 846 | Ga0495600_0028407 | |||
| 847 | Ga0495600_0129061 | |||
| 848 | Ga0495660_0100466 | |||
| 849 | Ga0495604_0000013 | |||
| 850 | Ga0495604_0027640 | |||
| 851 | Ga0495604_0072646 | |||
| 852 | Ga0495674_0000042 | |||
| 853 | Ga0495674_0002697 | |||
| 854 | Ga0495674_0003180 | |||
| 855 | Ga0495676_0064978 | |||
| 856 | Ga0495680_0000196 | |||
| 857 | Ga0495680_0002599 | |||
| 858 | Ga0495683_0013340 | |||
| 859 | Ga0495687_011042 | |||
| 860 | Ga0495687_012975 | |||
| 861 | Ga0495675_0000209 | |||
| 862 | Ga0495686_0146906 | |||
| 863 | Ga0495593_0000073 | |||
| 864 | Ga0495602_0000228 | |||
| 865 | Ga0495602_0000556 | |||
| 866 | Ga0495602_0097009 | |||
| 867 | Ga0495614_0035306 | |||
| 868 | Ga0496100_0000002 | |||
| 869 | Ga0496100_0005490 | |||
| 870 | Ga0496100_0110829 | |||
| 871 | Ga0496101_0000001 | |||
| 872 | Ga0496102_0015880 | |||
| 873 | Ga0496102_0073675 | |||
| 874 | Ga0496102_0292966 | |||
| 875 | Ga0496103_0076910 | |||
| 876 | Ga0496104_0000002 | |||
| 877 | Ga0496104_0000013 | |||
| 878 | Ga0496104_0000576 | |||
| 879 | Ga0496104_0216067 | |||
| 880 | Ga0496105_0000001 | |||
| 881 | Ga0496105_0000006 | |||
| 882 | Ga0496105_0000488 | |||
| 883 | Ga0496106_0000022 | |||
| 884 | Ga0496106_0000864 | |||
| 885 | Ga0496106_0024135 | |||
| 886 | Ga0496106_0087862 | |||
| 887 | Ga0496107_0000016 | |||
| 888 | Ga0496107_0002031 | |||
| 889 | Ga0496107_0059311 | |||
| 890 | Ga0496108_0000001 | |||
| 891 | Ga0496108_0000045 | |||
| 892 | Ga0496108_0002417 | |||
| 893 | Ga0496108_0004290 | |||
| 894 | Ga0496109_0000003 | |||
| 895 | Ga0496109_0000028 | |||
| 896 | Ga0496109_0000032 | |||
| 897 | Ga0496109_0000279 | |||
| 898 | Ga0496109_0014159 | |||
| 899 | Ga0496110_0004071 | |||
| 900 | Ga0496110_0005343 | |||
| 901 | Ga0496110_0008950 | |||
| 902 | Ga0496110_0011873 | |||
| 903 | Ga0496110_0031965 | |||
| 904 | Ga0496110_0347454 | |||
| 905 | Ga0496111_0001844 | |||
| 906 | Ga0496111_0005974 | |||
| 907 | Ga0496111_0014518 | |||
| 908 | Ga0496112_0005132 | |||
| 909 | Ga0496112_0215752 | |||
| 910 | Ga0496112_0455046 | |||
| 911 | Ga0496113_0002212 | |||
| 912 | Ga0496113_0019863 | |||
| 913 | Ga0496114_0000014 | |||
| 914 | Ga0496114_0007982 | |||
| 915 | Ga0496115_0000020 | |||
| 916 | Ga0496115_0000157 | |||
| 917 | Ga0496115_0000209 | |||
| 918 | Ga0496115_0002818 | |||
| 919 | Ga0496115_0007706 | |||
| 920 | Ga0496117_0020122 | |||
| 921 | Ga0496118_0013441 | |||
| 922 | Ga0496119_0046169 | |||
| 923 | Ga0496121_0018233 | |||
| 924 | Ga0496124_0094249 | |||
| 925 | Ga0495682_0001688 | |||
| 926 | Ga0501031_0008042 | |||
| 927 | Ga0501032_0022643 | |||
| 928 | Ga0501036_0059718 | |||
| 929 | Ga0501036_0122879 | |||
| 930 | Ga0501037_0021892 | |||
| 931 | Ga0501038_0001145 | |||
| 932 | Ga0501038_0140220 | |||
| 933 | Ga0501042_0096568 | |||
| 934 | Ga0501042_0121531 | |||
| 935 | Ga0501042_0161627 | |||
| 936 | Ga0501043_0006461 | |||
| 937 | Ga0501046_0037262 | |||
| 938 | Ga0501046_0050815 | |||
| 939 | Ga0501047_0014205 | |||
| 940 | Ga0501047_0089911 | |||
| 941 | Ga0501048_0000032 | |||
| 942 | Ga0501069_0045065 | |||
| 943 | Ga0501070_0030642 | |||
| 944 | Ga0501070_0042301 | |||
| 945 | Ga0501070_0091697 | |||
| 946 | Ga0501071_0006530 | |||
| 947 | Ga0501071_0065363 | |||
| 948 | Ga0501071_0081188 | |||
| 949 | Ga0501071_0081514 | |||
| 950 | Ga0501072_0006551 | |||
| 951 | Ga0501072_0028473 | |||
| 952 | Ga0501073_0060033 | |||
| 953 | Ga0501073_0068973 | |||
| 954 | Ga0501074_0045086 | |||
| 955 | Ga0501074_0279884 | |||
| 956 | Ga0501075_0033687 | |||
| 957 | Ga0501075_0192210 | |||
| 958 | Ga0501079_0003967 | |||
| 959 | Ga0501079_0047986 | |||
| 960 | Ga0501080_0099039 | |||
| 961 | Ga0501080_0339415 | |||
| 962 | Ga0501083_0091822 | |||
| 963 | Ga0501035_0004956 | |||
| 964 | Ga0501044_0070355 | |||
| 965 | Ga0501044_0086899 | |||
| 966 | Ga0501044_0225133 | |||
| 967 | Ga0501045_0103207 | |||
| 968 | Ga0501045_0111614 | |||
| 969 | Ga0501045_0126250 | |||
| 970 | nmdc:mga03n38_37693_c1 | |||
| 971 | nmdc:mga03n38_79282_c1 | |||
| 972 | nmdc:mga00v17_41581_c1 | |||
| 973 | nmdc:mga0yw44_15873_c1 | |||
| 974 | nmdc:mga0yw44_5488_c1 | |||
| 975 | nmdc:mga0yw44_6126_c1 | |||
| 976 | nmdc:mga0yw44_70758_c1 | |||
| 977 | nmdc:mga0yw44_78214_c1 | |||
| 978 | nmdc:mga05p37_38503_c1 | |||
| 979 | nmdc:mga05p37_48899_c1 | |||
| 980 | nmdc:mga09592_18827_c1 | |||
| 981 | nmdc:mga0qj67_3971_c1 | |||
| 982 | nmdc:mga0qj67_43201_c1 | |||
| 983 | nmdc:mga06r32_21279_c1 | |||
| 984 | nmdc:mga06r32_237436_c1 | |||
| 985 | nmdc:mga08y16_121188_c1 | |||
| 986 | nmdc:mga0a205_3124_c1 | |||
| 987 | Ga0495601_0000097 | |||
| 988 | Ga0495601_0011384 | |||
| 989 | Ga0495612_0000228 | |||
| 990 | Ga0495612_0004552 | |||
| 991 | Ga0495612_0005157 | |||
| 992 | Ga0495655_0000011 | |||
| 993 | Ga0495595_0000014 | |||
| 994 | Ga0495595_0012587 | |||
| 995 | Ga0495619_0000001 | |||
| 996 | Ga0495619_0000022 | |||
| 997 | Ga0495619_0000319 | |||
| 998 | Ga0495619_0003460 | |||
| 999 | Ga0495619_0005740 | |||
| 1000 | Ga0500628_000032 | |||
| 1001 | Ga0500616_0001741 | |||
| 1002 | Ga0500616_0061029 | |||
| 1003 | Ga0501084_0144037 | |||
| 1004 | Ga0501082_0123072 | |||
| 1005 | Ga0530510_0006377 | |||
| 1006 | 2738823361 | |||
| 1007 | 2738835537 | |||
| 1008 | 2738877282 | |||
| 1009 | 2739188988 | |||
| 1010 | 2739223875 | |||
| 1011 | 2792835204 | |||
| 1012 | 2904488666 | |||
| 1013 | 2904621083 | |||
| 1014 | 2919529281 | |||
| 1015 | 2945936034 | |||
| 1016 | 2990710061 | |||
| 1017 | 642422601 | |||
| 1018 | 8055266403 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9597 | 2 | 239 |
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.9519 | 2 | 239 |
| 8ja7-assembly1.cif.gz_D | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.947 | 2 | 239 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9462 | 2 | 239 |
| 2awo-assembly2.cif.gz_C | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9456 | 2 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G089_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9619 | 1 | 236 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9574 | 2 | 218 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.957 | 1 | 238 | 3.40.50.300 |
| af_Q2G089_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9539 | 1 | 236 | 3.40.50.300 |
| af_O69724_1_242_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9508 | 1 | 241 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C7NKR9-F1-model_v4 | deleted | 0.9675 | 2 | 236 |
|
| AF-A0A1Q7D495-F1-model_v4 | ABC transporter domain-containing protein | 0.965 | 2 | 239 |
GO:0005524
GO:0016887 GO:0022857 GO:0043190 |
| AF-A0A431JYT0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9622 | 2 | 237 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A212LEM7-F1-model_v4 | Uncharacterized ABC transporter ATP-binding protein y4oS | 0.9611 | 2 | 238 |
GO:0005524
GO:0016887 GO:0022857 GO:0043190 |
| AF-A0A7X3MUK7-F1-model_v4 | Spermidine/putrescine import ATP-binding protein PotA (EC 7.6.2.11) | 0.9606 | 2 | 236 |
GO:0005524
GO:0015417 GO:0016887 GO:0043190 |