F456960

General Info

Members Datasets Scaffolds Average Seq Length
509 259 509 200

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100151520|Ga0075429_1001515201
Length 236
Sequence LAYTPIVAVCDLDRSGFFFAVSGSCGEWLFQPERPPSQKGLDMTKSTLDVEAILKRAAPVTRQHGHEIQPFGHLVRMPIALSENACKESVDNLNQLLADTIALRDLYKKHHWQIAGPTFYQLHLLFDKHYDEQSELVDAIAERIQLLGGVSIAMAHDVAETTLIPRPPKGREEAPVQISRLLHAHEIVLKEARAMARRASETGDDGTNDLIVSDVIRRNELQVWFVAEHVVDVPVV

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
162 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.95
Rhizosphere 96.66
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1014134 3300002076 Bacteria 1120
2 JGI24749J21850_1034686 3300002076 Unclassified 730
3 JGI25406J46586_10013756 3300003203 Bacteria 3461
4 Ga0065714_10067030 3300005288 Bacteria 5973
5 Ga0065704_10223261 3300005289 Bacteria 1067
6 Ga0065704_10288588 3300005289 Bacteria 908
7 Ga0065712_10068399 3300005290 Bacteria 10914
8 Ga0065715_10000217 3300005293 Bacteria 35543
9 Ga0065715_10224426 3300005293 Unclassified 1258
10 Ga0065715_10563425 3300005293 Bacteria 732
11 Ga0065707_10350939 3300005295 Unclassified 918
12 Ga0070676_10006316 3300005328 Bacteria 6332
13 Ga0070676_10030291 3300005328 Bacteria 3085
14 Ga0070690_100017024 3300005330 Bacteria 4363
15 Ga0070690_100101083 3300005330 Bacteria 1912
16 Ga0070670_100011887 3300005331 Bacteria 7444
17 Ga0070677_10021656 3300005333 Unclassified 2361
18 Ga0070677_10129629 3300005333 Unclassified 1150
19 Ga0068869_100058804 3300005334 Bacteria 2812
20 Ga0068869_100087383 3300005334 Bacteria 2339
21 Ga0070666_10055144 3300005335 Bacteria 2682
22 Ga0070682_100123081 3300005337 Bacteria 1744
23 Ga0068868_100018780 3300005338 Bacteria 5171
24 Ga0070689_100020491 3300005340 Bacteria 4907
25 Ga0070691_10110621 3300005341 Bacteria 1374
26 Ga0070687_100090482 3300005343 Unclassified 1691
27 Ga0070661_100172045 3300005344 Unclassified 1645
28 Ga0070668_100038267 3300005347 Bacteria 3666
29 Ga0070668_100200057 3300005347 Bacteria 1640
30 Ga0070669_100125134 3300005353 Bacteria 1966
31 Ga0070669_100173129 3300005353 Bacteria 1684
32 Ga0070675_100037521 3300005354 Bacteria 3948
33 Ga0070674_100042884 3300005356 Bacteria 3075
34 Ga0070673_100015974 3300005364 Bacteria 5291
35 Ga0070673_100430249 3300005364 Bacteria 1184
36 Ga0070673_100772247 3300005364 Bacteria 886
37 Ga0070688_100031438 3300005365 Bacteria 3193
38 Ga0070688_100065272 3300005365 Bacteria 2313
39 Ga0070659_100022907 3300005366 Bacteria 4774
40 Ga0070659_100866634 3300005366 Bacteria 788
41 Ga0070667_100067678 3300005367 Bacteria 3037
42 Ga0070667_100408437 3300005367 Bacteria 1237
43 Ga0070703_10053199 3300005406 Bacteria 1301
44 Ga0070709_10020764 3300005434 Bacteria 3818
45 Ga0070701_10166141 3300005438 Unclassified 1282
46 Ga0070701_10242840 3300005438 Bacteria 1084
47 Ga0070705_100011395 3300005440 Bacteria 4486
48 Ga0070705_100014615 3300005440 Bacteria 4043
49 Ga0070694_100023294 3300005444 Bacteria 3980
50 Ga0070708_100017141 3300005445 Bacteria 6033
51 Ga0070708_100027203 3300005445 Bacteria 4905
52 Ga0070708_100176976 3300005445 Bacteria 1994
53 Ga0070708_100282098 3300005445 Bacteria 1563
54 Ga0070708_100314501 3300005445 Bacteria 1475
55 Ga0070708_100799411 3300005445 Unclassified 887
56 Ga0070663_100370431 3300005455 Bacteria 1164
57 Ga0070678_100161653 3300005456 Bacteria 1815
58 Ga0070678_100202608 3300005456 Bacteria 1639
59 Ga0070662_100012508 3300005457 Bacteria 5628
60 Ga0070662_100528737 3300005457 Bacteria 986
61 Ga0070662_100944050 3300005457 Bacteria 737
62 Ga0070681_10299558 3300005458 Bacteria 1518
63 Ga0068867_100119365 3300005459 Unclassified 2036
64 Ga0070685_10051369 3300005466 Unclassified 2384
65 Ga0070685_10113801 3300005466 Bacteria 1671
66 Ga0070706_100018009 3300005467 Bacteria 6515
67 Ga0070706_100058332 3300005467 Bacteria 3563
68 Ga0070706_100278613 3300005467 Bacteria 1561
69 Ga0070707_100056695 3300005468 Bacteria 3758
70 Ga0070707_100079189 3300005468 Bacteria 3171
71 Ga0070707_100764714 3300005468 Bacteria 929
72 Ga0070707_100795090 3300005468 Unclassified 910
73 Ga0070698_100036849 3300005471 Bacteria 5048
74 Ga0070698_100191364 3300005471 Bacteria 1983
75 Ga0070698_100320237 3300005471 Bacteria 1481
76 Ga0070698_100398353 3300005471 Bacteria 1310
77 Ga0070698_100466810 3300005471 Bacteria 1198
78 Ga0070699_100018519 3300005518 Bacteria 5982
79 Ga0070699_100275207 3300005518 Bacteria 1507
80 Ga0070699_100310483 3300005518 Bacteria 1416
81 Ga0070699_100325077 3300005518 Bacteria 1383
82 Ga0070697_100000671 3300005536 Bacteria 25737
83 Ga0070697_100227597 3300005536 Bacteria 1590
84 Ga0070697_100307249 3300005536 Unclassified 1364
85 Ga0070697_100309684 3300005536 Unclassified 1358
86 Ga0070672_100014624 3300005543 Bacteria 5566
87 Ga0070672_100301625 3300005543 Bacteria 1358
88 Ga0070686_100025014 3300005544 Bacteria 3586
89 Ga0070695_100028889 3300005545 Bacteria 3443
90 Ga0070695_100441696 3300005545 Unclassified 995
91 Ga0070696_100001746 3300005546 Bacteria 14258
92 Ga0070696_100321855 3300005546 Bacteria 1190
93 Ga0070693_100000070 3300005547 Bacteria 42181
94 Ga0070693_100232803 3300005547 Bacteria 1213
95 Ga0070693_100711867 3300005547 Unclassified 736
96 Ga0070665_100009511 3300005548 Bacteria 9829
97 Ga0070665_100080226 3300005548 Bacteria 3268
98 Ga0070665_100087755 3300005548 Bacteria 3116
99 Ga0070665_100113521 3300005548 Bacteria 2712
100 Ga0070665_100166724 3300005548 Bacteria 2205
101 Ga0070704_100008231 3300005549 Bacteria 6239
102 Ga0070704_100032382 3300005549 Bacteria 3525
103 Ga0070704_100092900 3300005549 Bacteria 2253
104 Ga0068855_100198264 3300005563 Bacteria 2261
105 Ga0070664_100009860 3300005564 Bacteria 7740
106 Ga0068854_100126729 3300005578 Bacteria 1945
107 Ga0068852_100098719 3300005616 Bacteria 2630
108 Ga0068859_100121921 3300005617 Bacteria 2674
109 Ga0068859_100122762 3300005617 Bacteria 2664
110 Ga0068864_100027105 3300005618 Bacteria 4835
111 Ga0068864_100051750 3300005618 Bacteria 3539
112 Ga0068861_100034069 3300005719 Bacteria 3763
113 Ga0068861_100259317 3300005719 Unclassified 1487
114 Ga0068870_10059175 3300005840 Bacteria 2053
115 Ga0068863_100022294 3300005841 Bacteria 6047
116 Ga0068863_100023610 3300005841 Bacteria 5871
117 Ga0068863_100593767 3300005841 Bacteria 1095
118 Ga0068858_100050031 3300005842 Bacteria 3868
119 Ga0068858_100255486 3300005842 Bacteria 1665
120 Ga0068860_100040441 3300005843 Bacteria 4455
121 Ga0068860_100081136 3300005843 Bacteria 3085
122 Ga0068860_100445618 3300005843 Bacteria 1287
123 Ga0068862_100034326 3300005844 Bacteria 4291
124 Ga0068862_100613097 3300005844 Bacteria 1046
125 Ga0081539_10000010 3300005985 Bacteria 484386
126 Ga0075432_10235470 3300006058 Unclassified 737
127 Ga0070716_100044001 3300006173 Unclassified 2500
128 Ga0070716_100515736 3300006173 Unclassified 885
129 Ga0097621_100046359 3300006237 Bacteria 3517
130 Ga0097621_100064190 3300006237 Bacteria 3019
131 Ga0097621_100175470 3300006237 Bacteria 1850
132 Ga0097621_100183018 3300006237 Bacteria 1811
133 Ga0097621_100226909 3300006237 Bacteria 1630
134 Ga0097621_100438815 3300006237 Bacteria 1174
135 Ga0068871_100005904 3300006358 Bacteria 8612
136 Ga0068871_100036279 3300006358 Bacteria 3924
137 Ga0068871_100111125 3300006358 Bacteria 2305
138 Ga0068871_100669554 3300006358 Unclassified 949
139 Ga0075428_100079272 3300006844 Bacteria 3585
140 Ga0075428_100102324 3300006844 Bacteria 3124
141 Ga0075428_101171312 3300006844 Bacteria 811
142 Ga0075430_100085770 3300006846 Bacteria 2636
143 Ga0075431_100012034 3300006847 Bacteria 8731
144 Ga0075431_100199173 3300006847 Bacteria 2049
145 Ga0075431_100495356 3300006847 Unclassified 1214
146 Ga0075433_10003209 3300006852 Bacteria 12611
147 Ga0075433_10005635 3300006852 Bacteria 9844
148 Ga0075433_10010403 3300006852 Bacteria 7465
149 Ga0075433_10053135 3300006852 Bacteria 3531
150 Ga0075434_100005888 3300006871 Bacteria 11205
151 Ga0075434_100008297 3300006871 Bacteria 9650
152 Ga0075434_100011260 3300006871 Bacteria 8425
153 Ga0075434_100068540 3300006871 Bacteria 3534
154 Ga0075434_100158113 3300006871 Bacteria 2286
155 Ga0075434_100159391 3300006871 Bacteria 2276
156 Ga0075429_100130028 3300006880 Bacteria 2202
157 Ga0075429_100151520 3300006880 Bacteria 2030
158 Ga0075429_100169059 3300006880 Unclassified 1915
159 Ga0075429_100172369 3300006880 Bacteria 1895
160 Ga0075429_100412710 3300006880 Bacteria 1182
161 Ga0075429_100458888 3300006880 Bacteria 1116
162 Ga0068865_100003401 3300006881 Bacteria 9522
163 Ga0068865_100013766 3300006881 Bacteria 5124
164 Ga0068865_100473479 3300006881 Bacteria 1039
165 Ga0068865_100730515 3300006881 Unclassified 849
166 Ga0075436_100001858 3300006914 Bacteria 14484
167 Ga0075436_100008889 3300006914 Bacteria 6873
168 Ga0075436_100020714 3300006914 Bacteria 4512
169 Ga0075436_100150723 3300006914 Bacteria 1636
170 Ga0075436_100187398 3300006914 Bacteria 1463
171 Ga0075436_100249948 3300006914 Bacteria 1262
172 Ga0075436_100425476 3300006914 Unclassified 965
173 Ga0097620_100121922 3300006931 Bacteria 2674
174 Ga0097620_100122761 3300006931 Bacteria 2664
175 Ga0075435_100006637 3300007076 Bacteria 8200
176 Ga0075435_100011923 3300007076 Bacteria 6420
177 Ga0075435_100030367 3300007076 Bacteria 4248
178 Ga0075435_100032642 3300007076 Bacteria 4113
179 Ga0075435_100043026 3300007076 Bacteria 3615
180 Ga0075435_100102481 3300007076 Bacteria 2372
181 Ga0075435_100354719 3300007076 Bacteria 1257
182 Ga0099794_10014958 3300007265 Bacteria 3413
183 Ga0099794_10018141 3300007265 Bacteria 3150
184 Ga0099794_10079020 3300007265 Bacteria 1620
185 Ga0105250_10168189 3300009092 Bacteria 917
186 Ga0105240_10237831 3300009093 Unclassified 2113
187 Ga0111539_10026686 3300009094 Bacteria 7059
188 Ga0111539_10048302 3300009094 Bacteria 5082
189 Ga0111539_10151220 3300009094 Bacteria 2717
190 Ga0111539_10153604 3300009094 Bacteria 2694
191 Ga0105245_10033791 3300009098 Bacteria 4533
192 Ga0105245_10091033 3300009098 Bacteria 2807
193 Ga0105245_10314958 3300009098 Bacteria 1540
194 Ga0105247_10505343 3300009101 Bacteria 881
195 Ga0114129_10028393 3300009147 Bacteria 7928
196 Ga0114129_10030204 3300009147 Bacteria 7675
197 Ga0114129_10062473 3300009147 Bacteria 5202
198 Ga0114129_10129575 3300009147 Bacteria 3467
199 Ga0114129_10159577 3300009147 Bacteria 3082
200 Ga0114129_10445707 3300009147 Unclassified 1699
201 Ga0114129_10834208 3300009147 Unclassified 1173
202 Ga0114129_10872039 3300009147 Bacteria 1143
203 Ga0114129_10961677 3300009147 Bacteria 1078
204 Ga0105243_10050204 3300009148 Bacteria 3295
205 Ga0105243_10196054 3300009148 Bacteria 1768
206 Ga0105241_10309912 3300009174 Bacteria 1357
207 Ga0105242_10032681 3300009176 Bacteria 4162
208 Ga0105242_10110368 3300009176 Bacteria 2343
209 Ga0105242_10249879 3300009176 Bacteria 1598
210 Ga0105248_10002426 3300009177 Bacteria 20687
211 Ga0105248_10104474 3300009177 Bacteria 3194
212 Ga0105248_10177476 3300009177 Bacteria 2401
213 Ga0105248_10409564 3300009177 Bacteria 1527
214 Ga0105248_10843108 3300009177 Bacteria 1034
215 Ga0105248_11370868 3300009177 Unclassified 800
216 Ga0105237_10007820 3300009545 Bacteria 11654
217 Ga0105238_10298845 3300009551 Bacteria 1593
218 Ga0105249_10005227 3300009553 Bacteria 11203
219 Ga0105249_10075534 3300009553 Bacteria 3121
220 Ga0105249_10284527 3300009553 Unclassified 1652
221 Ga0105249_10835401 3300009553 Bacteria 986
222 Ga0105249_11153789 3300009553 Bacteria 845
223 Ga0099796_10230788 3300010159 Unclassified 762
224 Ga0105239_10336328 3300010375 Bacteria 1704
225 Ga0157374_10183472 3300013296 Bacteria 2045
226 Ga0157378_10877231 3300013297 Bacteria 927
227 Ga0157378_11475601 3300013297 Bacteria 724
228 Ga0163162_10010669 3300013306 Bacteria 8934
229 Ga0163162_10118177 3300013306 Bacteria 2753
230 Ga0163162_10123668 3300013306 Bacteria 2693
231 Ga0163162_10430987 3300013306 Bacteria 1451
232 Ga0163162_10469701 3300013306 Unclassified 1389
233 Ga0157372_10548419 3300013307 Unclassified 1348
234 Ga0157375_10040280 3300013308 Bacteria 4503
235 Ga0157375_10183780 3300013308 Bacteria 2243
236 Ga0157375_10790137 3300013308 Bacteria 1098
237 Ga0163163_10099300 3300014325 Bacteria 2932
238 Ga0157380_10075881 3300014326 Bacteria 2734
239 Ga0157380_10188425 3300014326 Bacteria 1819
240 Ga0157380_10784448 3300014326 Bacteria 968
241 Ga0157377_10015522 3300014745 Bacteria 3899
242 Ga0157379_10370026 3300014968 Bacteria 1314
243 Ga0157379_10906062 3300014968 Bacteria 837
244 Ga0157376_10004354 3300014969 Bacteria 9846
245 Ga0157376_10031349 3300014969 Bacteria 4255
246 Ga0157376_10560707 3300014969 Bacteria 1132
247 Ga0157376_10631873 3300014969 Bacteria 1069
248 Ga0157376_10671372 3300014969 Bacteria 1039
249 Ga0163161_10158102 3300017792 Bacteria 1727
250 Ga0206356_11270007 3300020070 Bacteria 812
251 Ga0213872_10001072 3300021361 Bacteria 18898
252 Ga0213876_10025743 3300021384 Bacteria 3102
253 Ga0224712_10239706 3300022467 Bacteria 835
254 Ga0224572_1010248 3300024225 Bacteria 1759
255 Ga0228598_1009860 3300024227 Bacteria 1908
256 Ga0207697_10112345 3300025315 Bacteria 1167
257 Ga0207653_10003016 3300025885 Bacteria 5346
258 Ga0207682_10002915 3300025893 Bacteria 7544
259 Ga0207710_10095441 3300025900 Bacteria 1397
260 Ga0207688_10006975 3300025901 Bacteria 6148
261 Ga0207680_10178848 3300025903 Unclassified 1433
262 Ga0207699_10396661 3300025906 Bacteria 982
263 Ga0207645_10012718 3300025907 Bacteria 5706
264 Ga0207643_10022056 3300025908 Bacteria 3504
265 Ga0207684_10018022 3300025910 Bacteria 6052
266 Ga0207684_10078920 3300025910 Bacteria 2800
267 Ga0207707_10157218 3300025912 Bacteria 1988
268 Ga0207695_10133539 3300025913 Unclassified 2437
269 Ga0207695_10315556 3300025913 Unclassified 1453
270 Ga0207671_10225841 3300025914 Bacteria 1468
271 Ga0207660_10412624 3300025917 Bacteria 1088
272 Ga0207662_10001974 3300025918 Bacteria 10120
273 Ga0207649_10501458 3300025920 Unclassified 923
274 Ga0207646_10000005 3300025922 Bacteria 523896
275 Ga0207646_10240496 3300025922 Bacteria 1635
276 Ga0207646_10775055 3300025922 Unclassified 855
277 Ga0207681_10227709 3300025923 Unclassified 1445
278 Ga0207681_10423728 3300025923 Bacteria 1079
279 Ga0207694_10383639 3300025924 Bacteria 1167
280 Ga0207650_10003815 3300025925 Bacteria 10308
281 Ga0207659_10040309 3300025926 Bacteria 3265
282 Ga0207687_10012986 3300025927 Bacteria 5442
283 Ga0207687_10333530 3300025927 Bacteria 1231
284 Ga0207644_10122799 3300025931 Bacteria 1979
285 Ga0207644_10252967 3300025931 Bacteria 1406
286 Ga0207706_10017068 3300025933 Bacteria 6547
287 Ga0207706_10043603 3300025933 Bacteria 3975
288 Ga0207686_10018772 3300025934 Bacteria 3920
289 Ga0207686_10096501 3300025934 Bacteria 1964
290 Ga0207686_10401136 3300025934 Bacteria 1044
291 Ga0207709_10220021 3300025935 Bacteria 1369
292 Ga0207670_10059918 3300025936 Bacteria 2591
293 Ga0207669_10081323 3300025937 Bacteria 2075
294 Ga0207704_10033489 3300025938 Bacteria 2922
295 Ga0207704_10059859 3300025938 Bacteria 2353
296 Ga0207704_10100542 3300025938 Bacteria 1926
297 Ga0207704_10610291 3300025938 Unclassified 894
298 Ga0207665_10008672 3300025939 Bacteria 6692
299 Ga0207691_10010467 3300025940 Bacteria 8895
300 Ga0207691_10031364 3300025940 Bacteria 4961
301 Ga0207691_10304109 3300025940 Bacteria 1369
302 Ga0207711_10155122 3300025941 Bacteria 2069
303 Ga0207711_10339351 3300025941 Bacteria 1390
304 Ga0207711_10596631 3300025941 Bacteria 1030
305 Ga0207689_10002575 3300025942 Bacteria 16800
306 Ga0207679_10024682 3300025945 Bacteria 4124
307 Ga0207667_10155766 3300025949 Bacteria 2351
308 Ga0207651_10009309 3300025960 Bacteria 5367
309 Ga0207651_10313338 3300025960 Bacteria 1309
310 Ga0207712_10098589 3300025961 Bacteria 2168
311 Ga0207712_10107147 3300025961 Bacteria 2089
312 Ga0207712_10619234 3300025961 Unclassified 938
313 Ga0207668_10424913 3300025972 Bacteria 1129
314 Ga0207668_10642146 3300025972 Bacteria 928
315 Ga0207668_11078641 3300025972 Unclassified 719
316 Ga0207658_10947324 3300025986 Bacteria 785
317 Ga0207677_10059926 3300026023 Bacteria 2628
318 Ga0207677_10067722 3300026023 Bacteria 2502
319 Ga0207703_10220411 3300026035 Bacteria 1696
320 Ga0207678_10114023 3300026067 Bacteria 2306
321 Ga0207641_10009460 3300026088 Bacteria 8031
322 Ga0207641_10015591 3300026088 Bacteria 6228
323 Ga0207641_10308889 3300026088 Bacteria 1496
324 Ga0207648_10016241 3300026089 Bacteria 6812
325 Ga0207676_10008185 3300026095 Bacteria 7439
326 Ga0207675_100031483 3300026118 Bacteria 4941
327 Ga0207675_100326474 3300026118 Unclassified 1499
328 Ga0207683_10078682 3300026121 Bacteria 2922
329 Ga0207683_10158924 3300026121 Bacteria 2042
330 Ga0207683_10244973 3300026121 Bacteria 1635
331 Ga0209588_1006633 3300027671 Bacteria 3374
332 Ga0209588_1040120 3300027671 Bacteria 1510
333 Ga0207428_10013895 3300027907 Bacteria 7012
334 Ga0207428_10061336 3300027907 Bacteria 2978
335 Ga0207428_10216112 3300027907 Unclassified 1439
336 Ga0207428_10277567 3300027907 Bacteria 1244
337 Ga0207428_10624804 3300027907 Bacteria 775
338 Ga0265354_1000140 3300028016 Bacteria 13048
339 Ga0265354_1000496 3300028016 Bacteria 6795
340 Ga0265357_1012037 3300028023 Unclassified 887
341 Ga0268266_10017882 3300028379 Bacteria 6041
342 Ga0268266_10070943 3300028379 Bacteria 3019
343 Ga0268266_10143270 3300028379 Bacteria 2146
344 Ga0268266_10177178 3300028379 Unclassified 1939
345 Ga0268265_10034851 3300028380 Bacteria 3672
346 Ga0268265_10161262 3300028380 Bacteria 1905
347 Ga0268265_10413711 3300028380 Bacteria 1250
348 Ga0268264_10089418 3300028381 Bacteria 2652
349 Ga0268264_10217155 3300028381 Unclassified 1758
350 Ga0265770_1000351 3300030878 Bacteria 6312
351 Ga0265760_10001580 3300031090 Bacteria 6713
352 Ga0265760_10006711 3300031090 Bacteria 3294
353 Ga0265340_10198052 3300031247 Bacteria 904
354 Ga0265316_10000902 3300031344 Bacteria 32488
355 Ga0307410_10950104 3300031852 Bacteria 739
356 Ga0307416_100838162 3300032002 Bacteria 1017
357 Ga0307414_10927298 3300032004 Bacteria 799
358 Ga0373950_0005575 3300034818 Bacteria 1886
359 Ga0373959_0002979 3300034820 Bacteria 2689
360 Ga0373938_0002531 3300034957 Bacteria 2953
361 Ga0373929_0005770 3300035085 Bacteria 2235
362 Ga0373940_0142924 3300035088 Bacteria 757
363 Ga0373949_0008488 3300035090 Bacteria 2248
364 Ga0373949_0017957 3300035090 Unclassified 1599
365 Ga0373951_0003102 3300035091 Bacteria 4100
366 Ga0373952_0051754 3300035092 Bacteria 981
367 Ga0373932_0015060 3300035112 Bacteria 1955
368 Ga0373939_0003089 3300035114 Bacteria 3908
369 Ga0373939_0079737 3300035114 Bacteria 1085
370 Ga0373954_0009191 3300035118 Bacteria 4348
371 Ga0373960_0001999 3300035121 Bacteria 4578
372 Ga0373955_0058105 3300035172 Bacteria 2127
373 Ga0373942_0017342 3300035207 Bacteria 1774
374 Ga0373961_0004367 3300035241 Bacteria 3422
375 Ga0373962_0024027 3300035242 Bacteria 1626
376 Ga0373962_0033932 3300035242 Bacteria 1411
377 Ga0373931_0012497 3300035691 Bacteria 4113
378 Ga0373935_0474048 3300035692 Bacteria 906
379 Ga0373927_0054205 3300035695 Unclassified 2594
380 Ga0373927_0251937 3300035695 Bacteria 1161
381 Ga0373947_0509251 3300035725 Bacteria 818
382 Ga0373937_0045218 3300036401 Bacteria 4023
383 Ga0373937_0402316 3300036401 Bacteria 1299
384 Ga0436365_1505847 3300039437 Bacteria 6621
385 Ga0451800_1099319 3300041459 Bacteria 827
386 Ga0451576_0039792 3300045051 Bacteria 4976
387 Ga0495592_0007872 3300046454 Bacteria 7988
388 Ga0495629_0000018 3300046459 Bacteria 169239
389 Ga0495651_0002472 3300046462 Bacteria 14281
390 Ga0495653_0011358 3300046463 Bacteria 7276
391 Ga0495580_0035396 3300046472 Bacteria 3591
392 Ga0495580_0082018 3300046472 Bacteria 2248
393 Ga0495580_0099393 3300046472 Bacteria 2024
394 Ga0495582_0001254 3300046473 Bacteria 14252
395 Ga0495639_0007935 3300046475 Bacteria 4562
396 Ga0495662_0031784 3300046476 Bacteria 2550
397 Ga0495664_0051732 3300046477 Unclassified 2439
398 Ga0495594_0000960 3300046499 Bacteria 14991
399 Ga0495608_0014065 3300046511 Bacteria 5554
400 Ga0495618_0010301 3300046514 Bacteria 5656
401 Ga0495628_0001354 3300046516 Bacteria 22458
402 Ga0495630_0071980 3300046517 Bacteria 2602
403 Ga0495630_0084527 3300046517 Unclassified 2396
404 Ga0495652_0001829 3300046529 Bacteria 22590
405 Ga0495640_0337696 3300046533 Unclassified 931
406 Ga0495586_0145543 3300046535 Bacteria 1331
407 Ga0495586_0171988 3300046535 Bacteria 1224
408 Ga0495645_0073318 3300046543 Unclassified 2466
409 Ga0495667_0002946 3300046559 Bacteria 11418
410 Ga0495634_0118005 3300046642 Bacteria 1701
411 Ga0495635_0000069 3300046663 Bacteria 63592
412 Ga0495635_0055686 3300046663 Unclassified 2724
413 Ga0495659_0007350 3300046664 Bacteria 3494
414 Ga0495623_0086957 3300046679 Unclassified 1926
415 Ga0495647_0002903 3300046681 Bacteria 5442
416 Ga0495658_0000471 3300046683 Bacteria 22293
417 Ga0495613_0005080 3300046689 Bacteria 9864
418 Ga0495600_0001463 3300046809 Bacteria 13099
419 Ga0495604_0016106 3300047317 Bacteria 5972
420 Ga0495604_0524681 3300047317 Bacteria 766
421 Ga0495674_0023499 3300047319 Bacteria 5680
422 Ga0495674_0048005 3300047319 Bacteria 3781
423 Ga0495674_0141358 3300047319 Bacteria 2023
424 Ga0495674_0570850 3300047319 Unclassified 899
425 Ga0495676_0080094 3300047321 Bacteria 2481
426 Ga0495680_0000044 3300047322 Bacteria 97068
427 Ga0495680_0001532 3300047322 Bacteria 24733
428 Ga0495675_0000366 3300047444 Bacteria 31480
429 Ga0495675_0020005 3300047444 Bacteria 4254
430 Ga0495684_0026100 3300047471 Unclassified 4491
431 Ga0495614_0018343 3300048089 Bacteria 3031
432 Ga0496102_0040957 3300048905 Bacteria 4193
433 Ga0496102_0044366 3300048905 Bacteria 4035
434 Ga0496102_0759918 3300048905 Bacteria 892
435 Ga0496104_0007618 3300048907 Bacteria 9585
436 Ga0496105_0039898 3300048908 Bacteria 3871
437 Ga0496106_0169666 3300048909 Bacteria 1729
438 Ga0496106_0221528 3300048909 Bacteria 1509
439 Ga0496108_0002260 3300048911 Bacteria 15425
440 Ga0496109_0017369 3300048912 Bacteria 6305
441 Ga0496109_0121658 3300048912 Unclassified 2432
442 Ga0496110_0001014 3300048913 Bacteria 19798
443 Ga0496112_0008799 3300048915 Bacteria 9059
444 Ga0496113_0000999 3300048916 Bacteria 15144
445 Ga0496114_0256321 3300048917 Bacteria 1540
446 Ga0501033_0014320 3300049570 Bacteria 6027
447 Ga0501034_0001936 3300049571 Bacteria 26215
448 Ga0501034_0209699 3300049571 Bacteria 1904
449 Ga0501034_0776058 3300049571 Unclassified 852
450 Ga0501043_0384825 3300049579 Bacteria 1061
451 Ga0501046_0009058 3300049580 Bacteria 8630
452 Ga0501046_0051472 3300049580 Bacteria 3249
453 Ga0501047_0022792 3300049581 Bacteria 6012
454 Ga0501070_0002689 3300049586 Bacteria 15528
455 Ga0501080_1152257 3300049742 Bacteria 668
456 Ga0501044_0060576 3300049823 Bacteria 3875
457 Ga0501044_0097268 3300049823 Bacteria 2965
458 nmdc:mga05p37_104709_c1 3300050507 Bacteria 3481
459 nmdc:mga05p37_187676_c1 3300050507 Bacteria 2513
460 nmdc:mga05p37_25306_c1 3300050507 Bacteria 7218
461 nmdc:mga05p37_518962_c1 3300050507 Unclassified 1363
462 nmdc:mga05p37_62132_c1 3300050507 Bacteria 4597
463 nmdc:mga05p37_85364_c1 3300050507 Bacteria 3890
464 nmdc:mga05p37_924490_c1 3300050507 Bacteria 937
465 nmdc:mga09592_158122_c1 3300050508 Bacteria 1957
466 nmdc:mga09592_71066_c1 3300050508 Bacteria 2954
467 nmdc:mga09592_798209_c1 3300050508 Bacteria 799
468 nmdc:mga0qj67_121163_c1 3300050509 Bacteria 2116
469 nmdc:mga0qj67_150082_c1 3300050509 Bacteria 1891
470 nmdc:mga06r32_141118_c1 3300050510 Bacteria 2386
471 nmdc:mga06r32_18928_c1 3300050510 Bacteria 6314
472 nmdc:mga06r32_565810_c1 3300050510 Bacteria 1110
473 nmdc:mga08y16_282339_c1 3300050511 Bacteria 1712
474 nmdc:mga08y16_47922_c1 3300050511 Bacteria 4473
475 nmdc:mga08y16_61190_c1 3300050511 Bacteria 3932
476 nmdc:mga0n895_115046_c1 3300050512 Bacteria 2708
477 nmdc:mga0n895_117847_c1 3300050512 Bacteria 2675
478 nmdc:mga0n895_119652_c1 3300050512 Bacteria 2654
479 nmdc:mga0n895_157724_c1 3300050512 Bacteria 2301
480 nmdc:mga0n895_47526_c1 3300050512 Bacteria 4196
481 nmdc:mga0n895_98159_c1 3300050512 Bacteria 2936
482 nmdc:mga0rr50_105075_c1 3300050513 Bacteria 2226
483 nmdc:mga0rr50_14521_c1 3300050513 Bacteria 5170
484 nmdc:mga0rr50_23827_c1 3300050513 Bacteria 4231
485 nmdc:mga0rr50_34717_c1 3300050513 Bacteria 3614
486 nmdc:mga0rr50_58211_c1 3300050513 Bacteria 2895
487 nmdc:mga0rr50_66888_c1 3300050513 Bacteria 2728
488 nmdc:mga0rr50_93016_c1 3300050513 Unclassified 2352
489 nmdc:mga0rr50_97855_c1 3300050513 Bacteria 2299
490 nmdc:mga08x19_113439_c1 3300050514 Bacteria 1810
491 nmdc:mga08x19_11576_c1 3300050514 Bacteria 5310
492 nmdc:mga08x19_1552_c1 3300050514 Bacteria 14249
493 nmdc:mga08x19_161072_c1 3300050514 Bacteria 1524
494 nmdc:mga08x19_174587_c1 3300050514 Bacteria 1465
495 nmdc:mga08x19_385234_c1 3300050514 Bacteria 982
496 nmdc:mga08x19_421967_c1 3300050514 Bacteria 937
497 nmdc:mga08x19_42410_c1 3300050514 Bacteria 2901
498 nmdc:mga08x19_72084_c1 3300050514 Bacteria 2253
499 nmdc:mga08x19_89009_c1 3300050514 Bacteria 2036
500 nmdc:mga0a205_161_c1 3300050515 Bacteria 44265
501 nmdc:mga0a205_281895_c1 3300050515 Bacteria 1537
502 nmdc:mga0a205_341270_c1 3300050515 Bacteria 1366
503 nmdc:mga0a205_3521_c1 3300050515 Bacteria 13991
504 nmdc:mga0a205_39439_c1 3300050515 Bacteria 4546
505 nmdc:mga0a205_42795_c1 3300050515 Bacteria 4365
506 nmdc:mga0a205_47188_c1 3300050515 Bacteria 4156
507 Ga0495619_0003782 3300053085 Bacteria 9735
508 Ga0495619_0293266 3300053085 Unclassified 1127
509 Ga0587111_0006492 3300060346 Bacteria 1857

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300024227 Ga0228598_1009860 Ga0228598_10098602 185
2 3300005457 Ga0070662_100944050 Ga0070662_1009440501 189
3 3300013306 Ga0163162_10123668 Ga0163162_101236682 189
4 3300049570 Ga0501033_0014320 Ga0501033_0014320_2261_2854 192
5 3300049571 Ga0501034_0001936 Ga0501034_0001936_3531_4124 192
6 3300049571 Ga0501034_0776058 Ga0501034_0776058_12_605 192
7 3300049579 Ga0501043_0384825 Ga0501043_0384825_273_866 192
8 3300049580 Ga0501046_0009058 Ga0501046_0009058_4845_5438 192
9 3300049580 Ga0501046_0051472 Ga0501046_0051472_566_1159 192
10 3300049581 Ga0501047_0022792 Ga0501047_0022792_599_1192 192
11 3300049586 Ga0501070_0002689 Ga0501070_0002689_9737_10330 192
12 3300049742 Ga0501080_1152257 Ga0501080_1152257_20_613 192
13 3300049823 Ga0501044_0060576 Ga0501044_0060576_179_772 192
14 3300049823 Ga0501044_0097268 Ga0501044_0097268_2306_2899 192
15 3300005289 Ga0065704_10288588 Ga0065704_102885881 193
16 3300006844 Ga0075428_101171312 Ga0075428_1011713121 193
17 3300025906 Ga0207699_10396661 Ga0207699_103966612 193
18 3300025922 Ga0207646_10240496 Ga0207646_102404962 193
19 3300050512 nmdc:mga0n895_119652_c1 nmdc:mga0n895_119652_c1_1518_2120 193
20 3300050514 nmdc:mga08x19_385234_c1 nmdc:mga08x19_385234_c1_235_837 193
21 3300050515 nmdc:mga0a205_281895_c1 nmdc:mga0a205_281895_c1_25_630 193
22 3300005289 Ga0065704_10223261 Ga0065704_102232611 194
23 3300005546 Ga0070696_100321855 Ga0070696_1003218552 194
24 3300006844 Ga0075428_100102324 Ga0075428_1001023244 194
25 3300006880 Ga0075429_100151520 Ga0075429_1001515201 194
26 3300009094 Ga0111539_10153604 Ga0111539_101536042 194
27 3300009147 Ga0114129_10062473 Ga0114129_100624734 194
28 3300009147 Ga0114129_10834208 Ga0114129_108342081 194
29 3300025917 Ga0207660_10412624 Ga0207660_104126242 194
30 3300050507 nmdc:mga05p37_85364_c1 nmdc:mga05p37_85364_c1_2551_3135 194
31 3300050507 nmdc:mga05p37_924490_c1 nmdc:mga05p37_924490_c1_282_866 194
32 3300050508 nmdc:mga09592_158122_c1 nmdc:mga09592_158122_c1_1239_1823 194
33 3300003203 JGI25406J46586_10013756 JGI25406J46586_100137562 195
34 3300005985 Ga0081539_10000010 Ga0081539_1000001032 195
35 3300020070 Ga0206356_11270007 Ga0206356_112700071 195
36 3300022467 Ga0224712_10239706 Ga0224712_102397062 195
37 3300035725 Ga0373947_0509251 Ga0373947_0509251_70_657 195
38 3300036401 Ga0373937_0402316 Ga0373937_0402316_411_998 195
39 3300005334 Ga0068869_100087383 Ga0068869_1000873832 196
40 3300005356 Ga0070674_100042884 Ga0070674_1000428842 196
41 3300005364 Ga0070673_100430249 Ga0070673_1004302492 196
42 3300005366 Ga0070659_100866634 Ga0070659_1008666342 196
43 3300005456 Ga0070678_100202608 Ga0070678_1002026082 196
44 3300005458 Ga0070681_10299558 Ga0070681_102995582 196
45 3300005468 Ga0070707_100795090 Ga0070707_1007950901 196
46 3300005536 Ga0070697_100227597 Ga0070697_1002275971 196
47 3300005543 Ga0070672_100301625 Ga0070672_1003016252 196
48 3300005548 Ga0070665_100009511 Ga0070665_10000951110 196
49 3300005548 Ga0070665_100113521 Ga0070665_1001135213 196
50 3300005548 Ga0070665_100166724 Ga0070665_1001667242 196
51 3300005617 Ga0068859_100121921 Ga0068859_1001219212 196
52 3300005841 Ga0068863_100593767 Ga0068863_1005937671 196
53 3300005843 Ga0068860_100445618 Ga0068860_1004456182 196
54 3300006237 Ga0097621_100064190 Ga0097621_1000641902 196
55 3300006237 Ga0097621_100226909 Ga0097621_1002269093 196
56 3300006237 Ga0097621_100438815 Ga0097621_1004388152 196
57 3300006358 Ga0068871_100005904 Ga0068871_1000059049 196
58 3300006844 Ga0075428_100079272 Ga0075428_1000792723 196
59 3300006871 Ga0075434_100158113 Ga0075434_1001581133 196
60 3300006880 Ga0075429_100172369 Ga0075429_1001723692 196
61 3300006881 Ga0068865_100003401 Ga0068865_10000340110 196
62 3300006881 Ga0068865_100013766 Ga0068865_1000137664 196
63 3300006931 Ga0097620_100121922 Ga0097620_1001219222 196
64 3300007076 Ga0075435_100043026 Ga0075435_1000430264 196
65 3300009098 Ga0105245_10091033 Ga0105245_100910332 196
66 3300009147 Ga0114129_10030204 Ga0114129_100302047 196
67 3300009148 Ga0105243_10050204 Ga0105243_100502044 196
68 3300009176 Ga0105242_10032681 Ga0105242_100326813 196
69 3300009176 Ga0105242_10110368 Ga0105242_101103682 196
70 3300009177 Ga0105248_10104474 Ga0105248_101044742 196
71 3300009177 Ga0105248_10177476 Ga0105248_101774762 196
72 3300009177 Ga0105248_10409564 Ga0105248_104095642 196
73 3300009551 Ga0105238_10298845 Ga0105238_102988452 196
74 3300009553 Ga0105249_11153789 Ga0105249_111537891 196
75 3300013297 Ga0157378_11475601 Ga0157378_114756011 196
76 3300013306 Ga0163162_10010669 Ga0163162_100106696 196
77 3300013306 Ga0163162_10118177 Ga0163162_101181773 196
78 3300013308 Ga0157375_10040280 Ga0157375_100402803 196
79 3300013308 Ga0157375_10790137 Ga0157375_107901372 196
80 3300014968 Ga0157379_10370026 Ga0157379_103700262 196
81 3300014969 Ga0157376_10004354 Ga0157376_100043547 196
82 3300014969 Ga0157376_10560707 Ga0157376_105607072 196
83 3300014969 Ga0157376_10631873 Ga0157376_106318731 196
84 3300014969 Ga0157376_10671372 Ga0157376_106713722 196
85 3300025912 Ga0207707_10157218 Ga0207707_101572183 196
86 3300025922 Ga0207646_10775055 Ga0207646_107750551 196
87 3300025924 Ga0207694_10383639 Ga0207694_103836392 196
88 3300025927 Ga0207687_10012986 Ga0207687_100129862 196
89 3300025934 Ga0207686_10018772 Ga0207686_100187723 196
90 3300025934 Ga0207686_10096501 Ga0207686_100965012 196
91 3300025935 Ga0207709_10220021 Ga0207709_102200212 196
92 3300025937 Ga0207669_10081323 Ga0207669_100813233 196
93 3300025938 Ga0207704_10033489 Ga0207704_100334893 196
94 3300025938 Ga0207704_10059859 Ga0207704_100598592 196
95 3300025940 Ga0207691_10304109 Ga0207691_103041092 196
96 3300025941 Ga0207711_10155122 Ga0207711_101551222 196
97 3300025960 Ga0207651_10313338 Ga0207651_103133382 196
98 3300026023 Ga0207677_10059926 Ga0207677_100599262 196
99 3300026088 Ga0207641_10308889 Ga0207641_103088892 196
100 3300026121 Ga0207683_10244973 Ga0207683_102449732 196
101 3300028379 Ga0268266_10017882 Ga0268266_100178825 196
102 3300028379 Ga0268266_10143270 Ga0268266_101432702 196
103 3300031852 Ga0307410_10950104 Ga0307410_109501041 196
104 3300032004 Ga0307414_10927298 Ga0307414_109272982 196
105 3300035692 Ga0373935_0474048 Ga0373935_0474048_299_889 196
106 3300041459 Ga0451800_1099319 Ga0451800_1099319_166_756 196
107 3300046459 Ga0495629_0000018 Ga0495629_0000018_81355_81945 196
108 3300046472 Ga0495580_0099393 Ga0495580_0099393_1265_1855 196
109 3300046473 Ga0495582_0001254 Ga0495582_0001254_8884_9474 196
110 3300046475 Ga0495639_0007935 Ga0495639_0007935_2985_3575 196
111 3300046476 Ga0495662_0031784 Ga0495662_0031784_1396_1986 196
112 3300046499 Ga0495594_0000960 Ga0495594_0000960_14124_14714 196
113 3300046535 Ga0495586_0145543 Ga0495586_0145543_670_1260 196
114 3300046642 Ga0495634_0118005 Ga0495634_0118005_870_1460 196
115 3300046663 Ga0495635_0000069 Ga0495635_0000069_23987_24577 196
116 3300046681 Ga0495647_0002903 Ga0495647_0002903_2882_3472 196
117 3300046683 Ga0495658_0000471 Ga0495658_0000471_3407_3997 196
118 3300046689 Ga0495613_0005080 Ga0495613_0005080_8341_8931 196
119 3300047319 Ga0495674_0570850 Ga0495674_0570850_257_847 196
120 3300047321 Ga0495676_0080094 Ga0495676_0080094_1744_2334 196
121 3300047322 Ga0495680_0000044 Ga0495680_0000044_45968_46558 196
122 3300048089 Ga0495614_0018343 Ga0495614_0018343_1768_2358 196
123 3300048905 Ga0496102_0044366 Ga0496102_0044366_2767_3357 196
124 3300048908 Ga0496105_0039898 Ga0496105_0039898_904_1494 196
125 3300048917 Ga0496114_0256321 Ga0496114_0256321_677_1267 196
126 3300050507 nmdc:mga05p37_518962_c1 nmdc:mga05p37_518962_c1_654_1277 196
127 3300050511 nmdc:mga08y16_282339_c1 nmdc:mga08y16_282339_c1_936_1532 196
128 3300050513 nmdc:mga0rr50_34717_c1 nmdc:mga0rr50_34717_c1_2555_3148 196
129 3300050515 nmdc:mga0a205_3521_c1 nmdc:mga0a205_3521_c1_13001_13624 196
130 3300053085 Ga0495619_0003782 Ga0495619_0003782_1697_2287 196
131 3300002076 JGI24749J21850_1014134 JGI24749J21850_10141341 197
132 3300002076 JGI24749J21850_1034686 JGI24749J21850_10346861 197
133 3300005288 Ga0065714_10067030 Ga0065714_100670307 197
134 3300005290 Ga0065712_10068399 Ga0065712_100683996 197
135 3300005293 Ga0065715_10000217 Ga0065715_100002173 197
136 3300005293 Ga0065715_10224426 Ga0065715_102244261 197
137 3300005293 Ga0065715_10563425 Ga0065715_105634251 197
138 3300005295 Ga0065707_10350939 Ga0065707_103509391 197
139 3300005328 Ga0070676_10006316 Ga0070676_100063164 197
140 3300005328 Ga0070676_10030291 Ga0070676_100302912 197
141 3300005330 Ga0070690_100017024 Ga0070690_1000170245 197
142 3300005330 Ga0070690_100101083 Ga0070690_1001010832 197
143 3300005331 Ga0070670_100011887 Ga0070670_1000118872 197
144 3300005333 Ga0070677_10021656 Ga0070677_100216564 197
145 3300005333 Ga0070677_10129629 Ga0070677_101296292 197
146 3300005334 Ga0068869_100058804 Ga0068869_1000588042 197
147 3300005335 Ga0070666_10055144 Ga0070666_100551444 197
148 3300005337 Ga0070682_100123081 Ga0070682_1001230813 197
149 3300005338 Ga0068868_100018780 Ga0068868_1000187805 197
150 3300005340 Ga0070689_100020491 Ga0070689_1000204915 197
151 3300005341 Ga0070691_10110621 Ga0070691_101106212 197
152 3300005343 Ga0070687_100090482 Ga0070687_1000904822 197
153 3300005344 Ga0070661_100172045 Ga0070661_1001720452 197
154 3300005347 Ga0070668_100038267 Ga0070668_1000382672 197
155 3300005347 Ga0070668_100200057 Ga0070668_1002000572 197
156 3300005353 Ga0070669_100125134 Ga0070669_1001251344 197
157 3300005353 Ga0070669_100173129 Ga0070669_1001731292 197
158 3300005354 Ga0070675_100037521 Ga0070675_1000375213 197
159 3300005364 Ga0070673_100015974 Ga0070673_1000159742 197
160 3300005364 Ga0070673_100772247 Ga0070673_1007722472 197
161 3300005365 Ga0070688_100031438 Ga0070688_1000314382 197
162 3300005365 Ga0070688_100065272 Ga0070688_1000652722 197
163 3300005366 Ga0070659_100022907 Ga0070659_1000229075 197
164 3300005367 Ga0070667_100067678 Ga0070667_1000676783 197
165 3300005367 Ga0070667_100408437 Ga0070667_1004084371 197
166 3300005406 Ga0070703_10053199 Ga0070703_100531992 197
167 3300005434 Ga0070709_10020764 Ga0070709_100207644 197
168 3300005438 Ga0070701_10166141 Ga0070701_101661413 197
169 3300005438 Ga0070701_10242840 Ga0070701_102428402 197
170 3300005440 Ga0070705_100011395 Ga0070705_1000113955 197
171 3300005440 Ga0070705_100014615 Ga0070705_1000146152 197
172 3300005444 Ga0070694_100023294 Ga0070694_1000232942 197
173 3300005445 Ga0070708_100017141 Ga0070708_1000171414 197
174 3300005445 Ga0070708_100027203 Ga0070708_1000272034 197
175 3300005445 Ga0070708_100176976 Ga0070708_1001769761 197
176 3300005445 Ga0070708_100282098 Ga0070708_1002820983 197
177 3300005445 Ga0070708_100314501 Ga0070708_1003145012 197
178 3300005445 Ga0070708_100799411 Ga0070708_1007994111 197
179 3300005455 Ga0070663_100370431 Ga0070663_1003704312 197
180 3300005456 Ga0070678_100161653 Ga0070678_1001616533 197
181 3300005457 Ga0070662_100012508 Ga0070662_1000125087 197
182 3300005457 Ga0070662_100528737 Ga0070662_1005287371 197
183 3300005459 Ga0068867_100119365 Ga0068867_1001193653 197
184 3300005466 Ga0070685_10051369 Ga0070685_100513694 197
185 3300005466 Ga0070685_10113801 Ga0070685_101138012 197
186 3300005467 Ga0070706_100018009 Ga0070706_1000180093 197
187 3300005467 Ga0070706_100058332 Ga0070706_1000583323 197
188 3300005467 Ga0070706_100278613 Ga0070706_1002786132 197
189 3300005468 Ga0070707_100056695 Ga0070707_1000566952 197
190 3300005468 Ga0070707_100079189 Ga0070707_1000791892 197
191 3300005468 Ga0070707_100764714 Ga0070707_1007647141 197
192 3300005471 Ga0070698_100036849 Ga0070698_1000368491 197
193 3300005471 Ga0070698_100191364 Ga0070698_1001913641 197
194 3300005471 Ga0070698_100320237 Ga0070698_1003202372 197
195 3300005471 Ga0070698_100398353 Ga0070698_1003983532 197
196 3300005471 Ga0070698_100466810 Ga0070698_1004668101 197
197 3300005518 Ga0070699_100018519 Ga0070699_1000185194 197
198 3300005518 Ga0070699_100275207 Ga0070699_1002752072 197
199 3300005518 Ga0070699_100310483 Ga0070699_1003104832 197
200 3300005518 Ga0070699_100325077 Ga0070699_1003250771 197
201 3300005536 Ga0070697_100000671 Ga0070697_10000067113 197
202 3300005536 Ga0070697_100307249 Ga0070697_1003072492 197
203 3300005536 Ga0070697_100309684 Ga0070697_1003096842 197
204 3300005543 Ga0070672_100014624 Ga0070672_1000146248 197
205 3300005544 Ga0070686_100025014 Ga0070686_1000250145 197
206 3300005545 Ga0070695_100028889 Ga0070695_1000288893 197
207 3300005545 Ga0070695_100441696 Ga0070695_1004416962 197
208 3300005546 Ga0070696_100001746 Ga0070696_10000174613 197
209 3300005547 Ga0070693_100000070 Ga0070693_10000007022 197
210 3300005547 Ga0070693_100232803 Ga0070693_1002328032 197
211 3300005547 Ga0070693_100711867 Ga0070693_1007118671 197
212 3300005548 Ga0070665_100080226 Ga0070665_1000802263 197
213 3300005548 Ga0070665_100087755 Ga0070665_1000877555 197
214 3300005549 Ga0070704_100008231 Ga0070704_1000082312 197
215 3300005549 Ga0070704_100032382 Ga0070704_1000323823 197
216 3300005549 Ga0070704_100092900 Ga0070704_1000929002 197
217 3300005563 Ga0068855_100198264 Ga0068855_1001982643 197
218 3300005564 Ga0070664_100009860 Ga0070664_1000098606 197
219 3300005578 Ga0068854_100126729 Ga0068854_1001267292 197
220 3300005616 Ga0068852_100098719 Ga0068852_1000987193 197
221 3300005617 Ga0068859_100122762 Ga0068859_1001227623 197
222 3300005618 Ga0068864_100027105 Ga0068864_1000271052 197
223 3300005618 Ga0068864_100051750 Ga0068864_1000517504 197
224 3300005719 Ga0068861_100034069 Ga0068861_1000340692 197
225 3300005719 Ga0068861_100259317 Ga0068861_1002593172 197
226 3300005840 Ga0068870_10059175 Ga0068870_100591754 197
227 3300005841 Ga0068863_100022294 Ga0068863_1000222943 197
228 3300005841 Ga0068863_100023610 Ga0068863_1000236105 197
229 3300005842 Ga0068858_100050031 Ga0068858_1000500314 197
230 3300005842 Ga0068858_100255486 Ga0068858_1002554862 197
231 3300005843 Ga0068860_100040441 Ga0068860_1000404412 197
232 3300005843 Ga0068860_100081136 Ga0068860_1000811362 197
233 3300005844 Ga0068862_100034326 Ga0068862_1000343262 197
234 3300005844 Ga0068862_100613097 Ga0068862_1006130972 197
235 3300006058 Ga0075432_10235470 Ga0075432_102354702 197
236 3300006173 Ga0070716_100044001 Ga0070716_1000440013 197
237 3300006173 Ga0070716_100515736 Ga0070716_1005157361 197
238 3300006237 Ga0097621_100046359 Ga0097621_1000463593 197
239 3300006237 Ga0097621_100175470 Ga0097621_1001754702 197
240 3300006237 Ga0097621_100183018 Ga0097621_1001830182 197
241 3300006358 Ga0068871_100036279 Ga0068871_1000362792 197
242 3300006358 Ga0068871_100111125 Ga0068871_1001111252 197
243 3300006358 Ga0068871_100669554 Ga0068871_1006695541 197
244 3300006846 Ga0075430_100085770 Ga0075430_1000857704 197
245 3300006847 Ga0075431_100012034 Ga0075431_1000120346 197
246 3300006847 Ga0075431_100199173 Ga0075431_1001991731 197
247 3300006847 Ga0075431_100495356 Ga0075431_1004953562 197
248 3300006852 Ga0075433_10003209 Ga0075433_100032091 197
249 3300006852 Ga0075433_10005635 Ga0075433_100056353 197
250 3300006852 Ga0075433_10010403 Ga0075433_100104034 197
251 3300006852 Ga0075433_10053135 Ga0075433_100531353 197
252 3300006871 Ga0075434_100005888 Ga0075434_1000058888 197
253 3300006871 Ga0075434_100008297 Ga0075434_10000829710 197
254 3300006871 Ga0075434_100011260 Ga0075434_1000112606 197
255 3300006871 Ga0075434_100068540 Ga0075434_1000685404 197
256 3300006871 Ga0075434_100159391 Ga0075434_1001593912 197
257 3300006880 Ga0075429_100130028 Ga0075429_1001300283 197
258 3300006880 Ga0075429_100169059 Ga0075429_1001690594 197
259 3300006880 Ga0075429_100412710 Ga0075429_1004127102 197
260 3300006880 Ga0075429_100458888 Ga0075429_1004588882 197
261 3300006881 Ga0068865_100473479 Ga0068865_1004734792 197
262 3300006881 Ga0068865_100730515 Ga0068865_1007305151 197
263 3300006914 Ga0075436_100001858 Ga0075436_1000018582 197
264 3300006914 Ga0075436_100008889 Ga0075436_1000088896 197
265 3300006914 Ga0075436_100020714 Ga0075436_1000207144 197
266 3300006914 Ga0075436_100150723 Ga0075436_1001507232 197
267 3300006914 Ga0075436_100187398 Ga0075436_1001873983 197
268 3300006914 Ga0075436_100249948 Ga0075436_1002499482 197
269 3300006914 Ga0075436_100425476 Ga0075436_1004254762 197
270 3300006931 Ga0097620_100122761 Ga0097620_1001227613 197
271 3300007076 Ga0075435_100006637 Ga0075435_1000066375 197
272 3300007076 Ga0075435_100011923 Ga0075435_1000119233 197
273 3300007076 Ga0075435_100030367 Ga0075435_1000303671 197
274 3300007076 Ga0075435_100032642 Ga0075435_1000326424 197
275 3300007076 Ga0075435_100102481 Ga0075435_1001024813 197
276 3300007076 Ga0075435_100354719 Ga0075435_1003547191 197
277 3300007265 Ga0099794_10014958 Ga0099794_100149584 197
278 3300007265 Ga0099794_10018141 Ga0099794_100181414 197
279 3300007265 Ga0099794_10079020 Ga0099794_100790201 197
280 3300009092 Ga0105250_10168189 Ga0105250_101681892 197
281 3300009093 Ga0105240_10237831 Ga0105240_102378313 197
282 3300009094 Ga0111539_10026686 Ga0111539_100266865 197
283 3300009094 Ga0111539_10048302 Ga0111539_100483025 197
284 3300009094 Ga0111539_10151220 Ga0111539_101512202 197
285 3300009098 Ga0105245_10033791 Ga0105245_100337914 197
286 3300009098 Ga0105245_10314958 Ga0105245_103149582 197
287 3300009101 Ga0105247_10505343 Ga0105247_105053431 197
288 3300009147 Ga0114129_10028393 Ga0114129_100283932 197
289 3300009147 Ga0114129_10129575 Ga0114129_101295752 197
290 3300009147 Ga0114129_10159577 Ga0114129_101595774 197
291 3300009147 Ga0114129_10445707 Ga0114129_104457071 197
292 3300009147 Ga0114129_10872039 Ga0114129_108720391 197
293 3300009147 Ga0114129_10961677 Ga0114129_109616772 197
294 3300009148 Ga0105243_10196054 Ga0105243_101960542 197
295 3300009174 Ga0105241_10309912 Ga0105241_103099121 197
296 3300009176 Ga0105242_10249879 Ga0105242_102498792 197
297 3300009177 Ga0105248_10002426 Ga0105248_1000242613 197
298 3300009177 Ga0105248_10843108 Ga0105248_108431082 197
299 3300009177 Ga0105248_11370868 Ga0105248_113708681 197
300 3300009545 Ga0105237_10007820 Ga0105237_100078205 197
301 3300009553 Ga0105249_10005227 Ga0105249_100052273 197
302 3300009553 Ga0105249_10075534 Ga0105249_100755342 197
303 3300009553 Ga0105249_10284527 Ga0105249_102845273 197
304 3300009553 Ga0105249_10835401 Ga0105249_108354012 197
305 3300010159 Ga0099796_10230788 Ga0099796_102307881 197
306 3300010375 Ga0105239_10336328 Ga0105239_103363282 197
307 3300013296 Ga0157374_10183472 Ga0157374_101834722 197
308 3300013297 Ga0157378_10877231 Ga0157378_108772311 197
309 3300013306 Ga0163162_10430987 Ga0163162_104309872 197
310 3300013306 Ga0163162_10469701 Ga0163162_104697011 197
311 3300013307 Ga0157372_10548419 Ga0157372_105484192 197
312 3300013308 Ga0157375_10183780 Ga0157375_101837802 197
313 3300014325 Ga0163163_10099300 Ga0163163_100993002 197
314 3300014326 Ga0157380_10075881 Ga0157380_100758813 197
315 3300014326 Ga0157380_10188425 Ga0157380_101884252 197
316 3300014326 Ga0157380_10784448 Ga0157380_107844482 197
317 3300014745 Ga0157377_10015522 Ga0157377_100155222 197
318 3300014968 Ga0157379_10906062 Ga0157379_109060622 197
319 3300014969 Ga0157376_10031349 Ga0157376_100313493 197
320 3300017792 Ga0163161_10158102 Ga0163161_101581022 197
321 3300021361 Ga0213872_10001072 Ga0213872_100010729 197
322 3300021384 Ga0213876_10025743 Ga0213876_100257433 197
323 3300024225 Ga0224572_1010248 Ga0224572_10102483 197
324 3300025315 Ga0207697_10112345 Ga0207697_101123451 197
325 3300025885 Ga0207653_10003016 Ga0207653_100030166 197
326 3300025893 Ga0207682_10002915 Ga0207682_100029156 197
327 3300025900 Ga0207710_10095441 Ga0207710_100954412 197
328 3300025901 Ga0207688_10006975 Ga0207688_100069753 197
329 3300025903 Ga0207680_10178848 Ga0207680_101788482 197
330 3300025907 Ga0207645_10012718 Ga0207645_100127185 197
331 3300025908 Ga0207643_10022056 Ga0207643_100220562 197
332 3300025910 Ga0207684_10018022 Ga0207684_100180226 197
333 3300025910 Ga0207684_10078920 Ga0207684_100789203 197
334 3300025913 Ga0207695_10133539 Ga0207695_101335391 197
335 3300025913 Ga0207695_10315556 Ga0207695_103155563 197
336 3300025914 Ga0207671_10225841 Ga0207671_102258412 197
337 3300025918 Ga0207662_10001974 Ga0207662_100019749 197
338 3300025920 Ga0207649_10501458 Ga0207649_105014581 197
339 3300025922 Ga0207646_10000005 Ga0207646_10000005241 197
340 3300025923 Ga0207681_10227709 Ga0207681_102277091 197
341 3300025923 Ga0207681_10423728 Ga0207681_104237282 197
342 3300025925 Ga0207650_10003815 Ga0207650_1000381513 197
343 3300025926 Ga0207659_10040309 Ga0207659_100403091 197
344 3300025927 Ga0207687_10333530 Ga0207687_103335302 197
345 3300025931 Ga0207644_10122799 Ga0207644_101227991 197
346 3300025931 Ga0207644_10252967 Ga0207644_102529672 197
347 3300025933 Ga0207706_10017068 Ga0207706_100170686 197
348 3300025933 Ga0207706_10043603 Ga0207706_100436033 197
349 3300025934 Ga0207686_10401136 Ga0207686_104011362 197
350 3300025936 Ga0207670_10059918 Ga0207670_100599185 197
351 3300025938 Ga0207704_10100542 Ga0207704_101005422 197
352 3300025938 Ga0207704_10610291 Ga0207704_106102911 197
353 3300025939 Ga0207665_10008672 Ga0207665_100086726 197
354 3300025940 Ga0207691_10010467 Ga0207691_100104678 197
355 3300025940 Ga0207691_10031364 Ga0207691_100313645 197
356 3300025941 Ga0207711_10339351 Ga0207711_103393511 197
357 3300025941 Ga0207711_10596631 Ga0207711_105966312 197
358 3300025942 Ga0207689_10002575 Ga0207689_1000257510 197
359 3300025945 Ga0207679_10024682 Ga0207679_100246822 197
360 3300025949 Ga0207667_10155766 Ga0207667_101557663 197
361 3300025960 Ga0207651_10009309 Ga0207651_100093092 197
362 3300025961 Ga0207712_10098589 Ga0207712_100985892 197
363 3300025961 Ga0207712_10107147 Ga0207712_101071472 197
364 3300025961 Ga0207712_10619234 Ga0207712_106192342 197
365 3300025972 Ga0207668_10424913 Ga0207668_104249132 197
366 3300025972 Ga0207668_10642146 Ga0207668_106421461 197
367 3300025972 Ga0207668_11078641 Ga0207668_110786411 197
368 3300025986 Ga0207658_10947324 Ga0207658_109473241 197
369 3300026023 Ga0207677_10067722 Ga0207677_100677222 197
370 3300026035 Ga0207703_10220411 Ga0207703_102204112 197
371 3300026067 Ga0207678_10114023 Ga0207678_101140233 197
372 3300026088 Ga0207641_10009460 Ga0207641_100094607 197
373 3300026088 Ga0207641_10015591 Ga0207641_100155913 197
374 3300026089 Ga0207648_10016241 Ga0207648_100162416 197
375 3300026095 Ga0207676_10008185 Ga0207676_100081853 197
376 3300026118 Ga0207675_100031483 Ga0207675_1000314832 197
377 3300026118 Ga0207675_100326474 Ga0207675_1003264742 197
378 3300026121 Ga0207683_10078682 Ga0207683_100786823 197
379 3300026121 Ga0207683_10158924 Ga0207683_101589241 197
380 3300027671 Ga0209588_1006633 Ga0209588_10066335 197
381 3300027671 Ga0209588_1040120 Ga0209588_10401202 197
382 3300027907 Ga0207428_10013895 Ga0207428_100138951 197
383 3300027907 Ga0207428_10061336 Ga0207428_100613365 197
384 3300027907 Ga0207428_10216112 Ga0207428_102161122 197
385 3300027907 Ga0207428_10277567 Ga0207428_102775671 197
386 3300027907 Ga0207428_10624804 Ga0207428_106248041 197
387 3300028016 Ga0265354_1000140 Ga0265354_10001407 197
388 3300028016 Ga0265354_1000496 Ga0265354_10004966 197
389 3300028023 Ga0265357_1012037 Ga0265357_10120371 197
390 3300028379 Ga0268266_10070943 Ga0268266_100709433 197
391 3300028379 Ga0268266_10177178 Ga0268266_101771781 197
392 3300028380 Ga0268265_10034851 Ga0268265_100348514 197
393 3300028380 Ga0268265_10161262 Ga0268265_101612622 197
394 3300028380 Ga0268265_10413711 Ga0268265_104137112 197
395 3300028381 Ga0268264_10089418 Ga0268264_100894183 197
396 3300028381 Ga0268264_10217155 Ga0268264_102171552 197
397 3300030878 Ga0265770_1000351 Ga0265770_10003515 197
398 3300031090 Ga0265760_10001580 Ga0265760_100015802 197
399 3300031090 Ga0265760_10006711 Ga0265760_100067113 197
400 3300031247 Ga0265340_10198052 Ga0265340_101980522 197
401 3300031344 Ga0265316_10000902 Ga0265316_1000090215 197
402 3300032002 Ga0307416_100838162 Ga0307416_1008381621 197
403 3300034818 Ga0373950_0005575 Ga0373950_0005575_678_1271 197
404 3300034820 Ga0373959_0002979 Ga0373959_0002979_481_1074 197
405 3300034957 Ga0373938_0002531 Ga0373938_0002531_873_1466 197
406 3300035085 Ga0373929_0005770 Ga0373929_0005770_40_633 197
407 3300035088 Ga0373940_0142924 Ga0373940_0142924_130_723 197
408 3300035090 Ga0373949_0008488 Ga0373949_0008488_632_1225 197
409 3300035090 Ga0373949_0017957 Ga0373949_0017957_806_1399 197
410 3300035091 Ga0373951_0003102 Ga0373951_0003102_2797_3390 197
411 3300035092 Ga0373952_0051754 Ga0373952_0051754_17_610 197
412 3300035112 Ga0373932_0015060 Ga0373932_0015060_325_918 197
413 3300035114 Ga0373939_0003089 Ga0373939_0003089_1919_2512 197
414 3300035114 Ga0373939_0079737 Ga0373939_0079737_283_876 197
415 3300035118 Ga0373954_0009191 Ga0373954_0009191_422_1063 197
416 3300035121 Ga0373960_0001999 Ga0373960_0001999_1342_1935 197
417 3300035172 Ga0373955_0058105 Ga0373955_0058105_478_1119 197
418 3300035207 Ga0373942_0017342 Ga0373942_0017342_681_1274 197
419 3300035241 Ga0373961_0004367 Ga0373961_0004367_2257_2850 197
420 3300035242 Ga0373962_0024027 Ga0373962_0024027_313_906 197
421 3300035242 Ga0373962_0033932 Ga0373962_0033932_124_717 197
422 3300035691 Ga0373931_0012497 Ga0373931_0012497_2753_3346 197
423 3300035695 Ga0373927_0054205 Ga0373927_0054205_996_1628 197
424 3300035695 Ga0373927_0251937 Ga0373927_0251937_324_965 197
425 3300036401 Ga0373937_0045218 Ga0373937_0045218_1944_2585 197
426 3300039437 Ga0436365_1505847 Ga0436365_1505847_4763_5428 197
427 3300045051 Ga0451576_0039792 Ga0451576_0039792_1820_2413 197
428 3300046454 Ga0495592_0007872 Ga0495592_0007872_6352_6987 197
429 3300046462 Ga0495651_0002472 Ga0495651_0002472_5434_6069 197
430 3300046463 Ga0495653_0011358 Ga0495653_0011358_1172_1807 197
431 3300046472 Ga0495580_0035396 Ga0495580_0035396_1828_2475 197
432 3300046472 Ga0495580_0082018 Ga0495580_0082018_1614_2210 197
433 3300046477 Ga0495664_0051732 Ga0495664_0051732_190_825 197
434 3300046511 Ga0495608_0014065 Ga0495608_0014065_183_818 197
435 3300046514 Ga0495618_0010301 Ga0495618_0010301_733_1368 197
436 3300046516 Ga0495628_0001354 Ga0495628_0001354_11077_11712 197
437 3300046517 Ga0495630_0071980 Ga0495630_0071980_643_1287 197
438 3300046517 Ga0495630_0084527 Ga0495630_0084527_885_1520 197
439 3300046529 Ga0495652_0001829 Ga0495652_0001829_7689_8324 197
440 3300046533 Ga0495640_0337696 Ga0495640_0337696_120_755 197
441 3300046535 Ga0495586_0171988 Ga0495586_0171988_430_1077 197
442 3300046543 Ga0495645_0073318 Ga0495645_0073318_1169_1804 197
443 3300046559 Ga0495667_0002946 Ga0495667_0002946_3399_4034 197
444 3300046663 Ga0495635_0055686 Ga0495635_0055686_1986_2621 197
445 3300046664 Ga0495659_0007350 Ga0495659_0007350_307_900 197
446 3300046679 Ga0495623_0086957 Ga0495623_0086957_93_728 197
447 3300046809 Ga0495600_0001463 Ga0495600_0001463_4212_4847 197
448 3300047317 Ga0495604_0016106 Ga0495604_0016106_4328_4963 197
449 3300047317 Ga0495604_0524681 Ga0495604_0524681_18_662 197
450 3300047319 Ga0495674_0023499 Ga0495674_0023499_2276_2911 197
451 3300047319 Ga0495674_0048005 Ga0495674_0048005_1095_1739 197
452 3300047319 Ga0495674_0141358 Ga0495674_0141358_941_1582 197
453 3300047322 Ga0495680_0001532 Ga0495680_0001532_23193_23828 197
454 3300047444 Ga0495675_0000366 Ga0495675_0000366_7390_8025 197
455 3300047444 Ga0495675_0020005 Ga0495675_0020005_3141_3785 197
456 3300047471 Ga0495684_0026100 Ga0495684_0026100_3317_3952 197
457 3300048905 Ga0496102_0040957 Ga0496102_0040957_2586_3182 197
458 3300048905 Ga0496102_0759918 Ga0496102_0759918_231_824 197
459 3300048907 Ga0496104_0007618 Ga0496104_0007618_729_1325 197
460 3300048909 Ga0496106_0169666 Ga0496106_0169666_485_1081 197
461 3300048909 Ga0496106_0221528 Ga0496106_0221528_194_787 197
462 3300048911 Ga0496108_0002260 Ga0496108_0002260_7313_7909 197
463 3300048912 Ga0496109_0017369 Ga0496109_0017369_373_969 197
464 3300048912 Ga0496109_0121658 Ga0496109_0121658_930_1523 197
465 3300048913 Ga0496110_0001014 Ga0496110_0001014_10147_10743 197
466 3300048915 Ga0496112_0008799 Ga0496112_0008799_7743_8339 197
467 3300048916 Ga0496113_0000999 Ga0496113_0000999_11243_11839 197
468 3300049571 Ga0501034_0209699 Ga0501034_0209699_251_853 197
469 3300050507 nmdc:mga05p37_104709_c1 nmdc:mga05p37_104709_c1_302_895 197
470 3300050507 nmdc:mga05p37_187676_c1 nmdc:mga05p37_187676_c1_1151_1744 197
471 3300050507 nmdc:mga05p37_25306_c1 nmdc:mga05p37_25306_c1_2017_2610 197
472 3300050507 nmdc:mga05p37_62132_c1 nmdc:mga05p37_62132_c1_2558_3151 197
473 3300050508 nmdc:mga09592_71066_c1 nmdc:mga09592_71066_c1_770_1363 197
474 3300050508 nmdc:mga09592_798209_c1 nmdc:mga09592_798209_c1_148_741 197
475 3300050509 nmdc:mga0qj67_121163_c1 nmdc:mga0qj67_121163_c1_1032_1625 197
476 3300050509 nmdc:mga0qj67_150082_c1 nmdc:mga0qj67_150082_c1_26_619 197
477 3300050510 nmdc:mga06r32_141118_c1 nmdc:mga06r32_141118_c1_1011_1604 197
478 3300050510 nmdc:mga06r32_18928_c1 nmdc:mga06r32_18928_c1_1361_1954 197
479 3300050510 nmdc:mga06r32_565810_c1 nmdc:mga06r32_565810_c1_343_936 197
480 3300050511 nmdc:mga08y16_47922_c1 nmdc:mga08y16_47922_c1_2034_2627 197
481 3300050511 nmdc:mga08y16_61190_c1 nmdc:mga08y16_61190_c1_113_706 197
482 3300050512 nmdc:mga0n895_115046_c1 nmdc:mga0n895_115046_c1_1128_1721 197
483 3300050512 nmdc:mga0n895_117847_c1 nmdc:mga0n895_117847_c1_1366_1959 197
484 3300050512 nmdc:mga0n895_157724_c1 nmdc:mga0n895_157724_c1_234_833 197
485 3300050512 nmdc:mga0n895_47526_c1 nmdc:mga0n895_47526_c1_1053_1646 197
486 3300050512 nmdc:mga0n895_98159_c1 nmdc:mga0n895_98159_c1_2070_2663 197
487 3300050513 nmdc:mga0rr50_105075_c1 nmdc:mga0rr50_105075_c1_121_714 197
488 3300050513 nmdc:mga0rr50_14521_c1 nmdc:mga0rr50_14521_c1_2496_3089 197
489 3300050513 nmdc:mga0rr50_23827_c1 nmdc:mga0rr50_23827_c1_3580_4206 197
490 3300050513 nmdc:mga0rr50_58211_c1 nmdc:mga0rr50_58211_c1_44_637 197
491 3300050513 nmdc:mga0rr50_66888_c1 nmdc:mga0rr50_66888_c1_2069_2662 197
492 3300050513 nmdc:mga0rr50_93016_c1 nmdc:mga0rr50_93016_c1_987_1586 197
493 3300050513 nmdc:mga0rr50_97855_c1 nmdc:mga0rr50_97855_c1_1565_2158 197
494 3300050514 nmdc:mga08x19_113439_c1 nmdc:mga08x19_113439_c1_1170_1763 197
495 3300050514 nmdc:mga08x19_11576_c1 nmdc:mga08x19_11576_c1_3526_4152 197
496 3300050514 nmdc:mga08x19_1552_c1 nmdc:mga08x19_1552_c1_7428_8060 197
497 3300050514 nmdc:mga08x19_161072_c1 nmdc:mga08x19_161072_c1_825_1418 197
498 3300050514 nmdc:mga08x19_174587_c1 nmdc:mga08x19_174587_c1_283_876 197
499 3300050514 nmdc:mga08x19_421967_c1 nmdc:mga08x19_421967_c1_264_857 197
500 3300050514 nmdc:mga08x19_42410_c1 nmdc:mga08x19_42410_c1_389_982 197
501 3300050514 nmdc:mga08x19_72084_c1 nmdc:mga08x19_72084_c1_955_1548 197
502 3300050514 nmdc:mga08x19_89009_c1 nmdc:mga08x19_89009_c1_449_1042 197
503 3300050515 nmdc:mga0a205_161_c1 nmdc:mga0a205_161_c1_10037_10630 197
504 3300050515 nmdc:mga0a205_341270_c1 nmdc:mga0a205_341270_c1_12_605 197
505 3300050515 nmdc:mga0a205_39439_c1 nmdc:mga0a205_39439_c1_3700_4293 197
506 3300050515 nmdc:mga0a205_42795_c1 nmdc:mga0a205_42795_c1_2506_3099 197
507 3300050515 nmdc:mga0a205_47188_c1 nmdc:mga0a205_47188_c1_75_674 197
508 3300053085 Ga0495619_0293266 Ga0495619_0293266_82_717 197
509 3300060346 Ga0587111_0006492 Ga0587111_0006492_249_845 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

90

235

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lkp-assembly1.cif.gz_F-2 crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 0.9332 36 191
8ff9-assembly1.cif.gz_B crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) 0.9244 37 186
2bjy-assembly1.cif.gz_L the x-ray crystal structure of listeria innocua dps h31g-h43g mutant. 0.9243 47 183
2bkc-assembly1.cif.gz_A the x-ray structure of the h43g listeria innocua dps mutant 0.9232 47 183
2bkc-assembly1.cif.gz_H the x-ray structure of the h43g listeria innocua dps mutant 0.9221 47 186
ID Description Score Start End Superfamily
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9266 42 186 1.20.1260.10
1qghA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9201 47 183 1.20.1260.10
6hv1D00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9187 47 186 1.20.1260.10
1mojA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9178 42 196 1.20.1260.10
2bk6C00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9178 47 186 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A4U7EUU8-F1-model_v4 DNA starvation/stationary phase protection protein 0.9544 39 186 GO:0008199
AF-A0A537Z9P4-F1-model_v4 DNA starvation/stationary phase protection protein 0.9402 37 195 GO:0008199
GO:0016722
AF-A0A395JLR1-F1-model_v4 Starvation-inducible DNA-binding protein 0.9387 37 186 GO:0003677
GO:0008199
GO:0016722
AF-I0W7Q8-F1-model_v4 Ferritin Dps family protein 0.9377 33 190 GO:0008199
AF-A0A660MWD4-F1-model_v4 DNA starvation/stationary phase protection protein 0.9375 44 186 GO:0008199

Feature Viewer

pLDDT pTM Quality
82.1 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map