F456960
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 509 | 259 | 509 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300006880|Ga0075429_100151520|Ga0075429_1001515201 |
| Length | 236 |
| Sequence | LAYTPIVAVCDLDRSGFFFAVSGSCGEWLFQPERPPSQKGLDMTKSTLDVEAILKRAAPVTRQHGHEIQPFGHLVRMPIALSENACKESVDNLNQLLADTIALRDLYKKHHWQIAGPTFYQLHLLFDKHYDEQSELVDAIAERIQLLGGVSIAMAHDVAETTLIPRPPKGREEAPVQISRLLHAHEIVLKEARAMARRASETGDDGTNDLIVSDVIRRNELQVWFVAEHVVDVPVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 111 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 162 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 176 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 177 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.82 |
| Metatranscriptomes | 1.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.95 |
| Rhizosphere | 96.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1014134 | 3300002076 | Bacteria | 1120 |
| 2 | JGI24749J21850_1034686 | 3300002076 | Unclassified | 730 |
| 3 | JGI25406J46586_10013756 | 3300003203 | Bacteria | 3461 |
| 4 | Ga0065714_10067030 | 3300005288 | Bacteria | 5973 |
| 5 | Ga0065704_10223261 | 3300005289 | Bacteria | 1067 |
| 6 | Ga0065704_10288588 | 3300005289 | Bacteria | 908 |
| 7 | Ga0065712_10068399 | 3300005290 | Bacteria | 10914 |
| 8 | Ga0065715_10000217 | 3300005293 | Bacteria | 35543 |
| 9 | Ga0065715_10224426 | 3300005293 | Unclassified | 1258 |
| 10 | Ga0065715_10563425 | 3300005293 | Bacteria | 732 |
| 11 | Ga0065707_10350939 | 3300005295 | Unclassified | 918 |
| 12 | Ga0070676_10006316 | 3300005328 | Bacteria | 6332 |
| 13 | Ga0070676_10030291 | 3300005328 | Bacteria | 3085 |
| 14 | Ga0070690_100017024 | 3300005330 | Bacteria | 4363 |
| 15 | Ga0070690_100101083 | 3300005330 | Bacteria | 1912 |
| 16 | Ga0070670_100011887 | 3300005331 | Bacteria | 7444 |
| 17 | Ga0070677_10021656 | 3300005333 | Unclassified | 2361 |
| 18 | Ga0070677_10129629 | 3300005333 | Unclassified | 1150 |
| 19 | Ga0068869_100058804 | 3300005334 | Bacteria | 2812 |
| 20 | Ga0068869_100087383 | 3300005334 | Bacteria | 2339 |
| 21 | Ga0070666_10055144 | 3300005335 | Bacteria | 2682 |
| 22 | Ga0070682_100123081 | 3300005337 | Bacteria | 1744 |
| 23 | Ga0068868_100018780 | 3300005338 | Bacteria | 5171 |
| 24 | Ga0070689_100020491 | 3300005340 | Bacteria | 4907 |
| 25 | Ga0070691_10110621 | 3300005341 | Bacteria | 1374 |
| 26 | Ga0070687_100090482 | 3300005343 | Unclassified | 1691 |
| 27 | Ga0070661_100172045 | 3300005344 | Unclassified | 1645 |
| 28 | Ga0070668_100038267 | 3300005347 | Bacteria | 3666 |
| 29 | Ga0070668_100200057 | 3300005347 | Bacteria | 1640 |
| 30 | Ga0070669_100125134 | 3300005353 | Bacteria | 1966 |
| 31 | Ga0070669_100173129 | 3300005353 | Bacteria | 1684 |
| 32 | Ga0070675_100037521 | 3300005354 | Bacteria | 3948 |
| 33 | Ga0070674_100042884 | 3300005356 | Bacteria | 3075 |
| 34 | Ga0070673_100015974 | 3300005364 | Bacteria | 5291 |
| 35 | Ga0070673_100430249 | 3300005364 | Bacteria | 1184 |
| 36 | Ga0070673_100772247 | 3300005364 | Bacteria | 886 |
| 37 | Ga0070688_100031438 | 3300005365 | Bacteria | 3193 |
| 38 | Ga0070688_100065272 | 3300005365 | Bacteria | 2313 |
| 39 | Ga0070659_100022907 | 3300005366 | Bacteria | 4774 |
| 40 | Ga0070659_100866634 | 3300005366 | Bacteria | 788 |
| 41 | Ga0070667_100067678 | 3300005367 | Bacteria | 3037 |
| 42 | Ga0070667_100408437 | 3300005367 | Bacteria | 1237 |
| 43 | Ga0070703_10053199 | 3300005406 | Bacteria | 1301 |
| 44 | Ga0070709_10020764 | 3300005434 | Bacteria | 3818 |
| 45 | Ga0070701_10166141 | 3300005438 | Unclassified | 1282 |
| 46 | Ga0070701_10242840 | 3300005438 | Bacteria | 1084 |
| 47 | Ga0070705_100011395 | 3300005440 | Bacteria | 4486 |
| 48 | Ga0070705_100014615 | 3300005440 | Bacteria | 4043 |
| 49 | Ga0070694_100023294 | 3300005444 | Bacteria | 3980 |
| 50 | Ga0070708_100017141 | 3300005445 | Bacteria | 6033 |
| 51 | Ga0070708_100027203 | 3300005445 | Bacteria | 4905 |
| 52 | Ga0070708_100176976 | 3300005445 | Bacteria | 1994 |
| 53 | Ga0070708_100282098 | 3300005445 | Bacteria | 1563 |
| 54 | Ga0070708_100314501 | 3300005445 | Bacteria | 1475 |
| 55 | Ga0070708_100799411 | 3300005445 | Unclassified | 887 |
| 56 | Ga0070663_100370431 | 3300005455 | Bacteria | 1164 |
| 57 | Ga0070678_100161653 | 3300005456 | Bacteria | 1815 |
| 58 | Ga0070678_100202608 | 3300005456 | Bacteria | 1639 |
| 59 | Ga0070662_100012508 | 3300005457 | Bacteria | 5628 |
| 60 | Ga0070662_100528737 | 3300005457 | Bacteria | 986 |
| 61 | Ga0070662_100944050 | 3300005457 | Bacteria | 737 |
| 62 | Ga0070681_10299558 | 3300005458 | Bacteria | 1518 |
| 63 | Ga0068867_100119365 | 3300005459 | Unclassified | 2036 |
| 64 | Ga0070685_10051369 | 3300005466 | Unclassified | 2384 |
| 65 | Ga0070685_10113801 | 3300005466 | Bacteria | 1671 |
| 66 | Ga0070706_100018009 | 3300005467 | Bacteria | 6515 |
| 67 | Ga0070706_100058332 | 3300005467 | Bacteria | 3563 |
| 68 | Ga0070706_100278613 | 3300005467 | Bacteria | 1561 |
| 69 | Ga0070707_100056695 | 3300005468 | Bacteria | 3758 |
| 70 | Ga0070707_100079189 | 3300005468 | Bacteria | 3171 |
| 71 | Ga0070707_100764714 | 3300005468 | Bacteria | 929 |
| 72 | Ga0070707_100795090 | 3300005468 | Unclassified | 910 |
| 73 | Ga0070698_100036849 | 3300005471 | Bacteria | 5048 |
| 74 | Ga0070698_100191364 | 3300005471 | Bacteria | 1983 |
| 75 | Ga0070698_100320237 | 3300005471 | Bacteria | 1481 |
| 76 | Ga0070698_100398353 | 3300005471 | Bacteria | 1310 |
| 77 | Ga0070698_100466810 | 3300005471 | Bacteria | 1198 |
| 78 | Ga0070699_100018519 | 3300005518 | Bacteria | 5982 |
| 79 | Ga0070699_100275207 | 3300005518 | Bacteria | 1507 |
| 80 | Ga0070699_100310483 | 3300005518 | Bacteria | 1416 |
| 81 | Ga0070699_100325077 | 3300005518 | Bacteria | 1383 |
| 82 | Ga0070697_100000671 | 3300005536 | Bacteria | 25737 |
| 83 | Ga0070697_100227597 | 3300005536 | Bacteria | 1590 |
| 84 | Ga0070697_100307249 | 3300005536 | Unclassified | 1364 |
| 85 | Ga0070697_100309684 | 3300005536 | Unclassified | 1358 |
| 86 | Ga0070672_100014624 | 3300005543 | Bacteria | 5566 |
| 87 | Ga0070672_100301625 | 3300005543 | Bacteria | 1358 |
| 88 | Ga0070686_100025014 | 3300005544 | Bacteria | 3586 |
| 89 | Ga0070695_100028889 | 3300005545 | Bacteria | 3443 |
| 90 | Ga0070695_100441696 | 3300005545 | Unclassified | 995 |
| 91 | Ga0070696_100001746 | 3300005546 | Bacteria | 14258 |
| 92 | Ga0070696_100321855 | 3300005546 | Bacteria | 1190 |
| 93 | Ga0070693_100000070 | 3300005547 | Bacteria | 42181 |
| 94 | Ga0070693_100232803 | 3300005547 | Bacteria | 1213 |
| 95 | Ga0070693_100711867 | 3300005547 | Unclassified | 736 |
| 96 | Ga0070665_100009511 | 3300005548 | Bacteria | 9829 |
| 97 | Ga0070665_100080226 | 3300005548 | Bacteria | 3268 |
| 98 | Ga0070665_100087755 | 3300005548 | Bacteria | 3116 |
| 99 | Ga0070665_100113521 | 3300005548 | Bacteria | 2712 |
| 100 | Ga0070665_100166724 | 3300005548 | Bacteria | 2205 |
| 101 | Ga0070704_100008231 | 3300005549 | Bacteria | 6239 |
| 102 | Ga0070704_100032382 | 3300005549 | Bacteria | 3525 |
| 103 | Ga0070704_100092900 | 3300005549 | Bacteria | 2253 |
| 104 | Ga0068855_100198264 | 3300005563 | Bacteria | 2261 |
| 105 | Ga0070664_100009860 | 3300005564 | Bacteria | 7740 |
| 106 | Ga0068854_100126729 | 3300005578 | Bacteria | 1945 |
| 107 | Ga0068852_100098719 | 3300005616 | Bacteria | 2630 |
| 108 | Ga0068859_100121921 | 3300005617 | Bacteria | 2674 |
| 109 | Ga0068859_100122762 | 3300005617 | Bacteria | 2664 |
| 110 | Ga0068864_100027105 | 3300005618 | Bacteria | 4835 |
| 111 | Ga0068864_100051750 | 3300005618 | Bacteria | 3539 |
| 112 | Ga0068861_100034069 | 3300005719 | Bacteria | 3763 |
| 113 | Ga0068861_100259317 | 3300005719 | Unclassified | 1487 |
| 114 | Ga0068870_10059175 | 3300005840 | Bacteria | 2053 |
| 115 | Ga0068863_100022294 | 3300005841 | Bacteria | 6047 |
| 116 | Ga0068863_100023610 | 3300005841 | Bacteria | 5871 |
| 117 | Ga0068863_100593767 | 3300005841 | Bacteria | 1095 |
| 118 | Ga0068858_100050031 | 3300005842 | Bacteria | 3868 |
| 119 | Ga0068858_100255486 | 3300005842 | Bacteria | 1665 |
| 120 | Ga0068860_100040441 | 3300005843 | Bacteria | 4455 |
| 121 | Ga0068860_100081136 | 3300005843 | Bacteria | 3085 |
| 122 | Ga0068860_100445618 | 3300005843 | Bacteria | 1287 |
| 123 | Ga0068862_100034326 | 3300005844 | Bacteria | 4291 |
| 124 | Ga0068862_100613097 | 3300005844 | Bacteria | 1046 |
| 125 | Ga0081539_10000010 | 3300005985 | Bacteria | 484386 |
| 126 | Ga0075432_10235470 | 3300006058 | Unclassified | 737 |
| 127 | Ga0070716_100044001 | 3300006173 | Unclassified | 2500 |
| 128 | Ga0070716_100515736 | 3300006173 | Unclassified | 885 |
| 129 | Ga0097621_100046359 | 3300006237 | Bacteria | 3517 |
| 130 | Ga0097621_100064190 | 3300006237 | Bacteria | 3019 |
| 131 | Ga0097621_100175470 | 3300006237 | Bacteria | 1850 |
| 132 | Ga0097621_100183018 | 3300006237 | Bacteria | 1811 |
| 133 | Ga0097621_100226909 | 3300006237 | Bacteria | 1630 |
| 134 | Ga0097621_100438815 | 3300006237 | Bacteria | 1174 |
| 135 | Ga0068871_100005904 | 3300006358 | Bacteria | 8612 |
| 136 | Ga0068871_100036279 | 3300006358 | Bacteria | 3924 |
| 137 | Ga0068871_100111125 | 3300006358 | Bacteria | 2305 |
| 138 | Ga0068871_100669554 | 3300006358 | Unclassified | 949 |
| 139 | Ga0075428_100079272 | 3300006844 | Bacteria | 3585 |
| 140 | Ga0075428_100102324 | 3300006844 | Bacteria | 3124 |
| 141 | Ga0075428_101171312 | 3300006844 | Bacteria | 811 |
| 142 | Ga0075430_100085770 | 3300006846 | Bacteria | 2636 |
| 143 | Ga0075431_100012034 | 3300006847 | Bacteria | 8731 |
| 144 | Ga0075431_100199173 | 3300006847 | Bacteria | 2049 |
| 145 | Ga0075431_100495356 | 3300006847 | Unclassified | 1214 |
| 146 | Ga0075433_10003209 | 3300006852 | Bacteria | 12611 |
| 147 | Ga0075433_10005635 | 3300006852 | Bacteria | 9844 |
| 148 | Ga0075433_10010403 | 3300006852 | Bacteria | 7465 |
| 149 | Ga0075433_10053135 | 3300006852 | Bacteria | 3531 |
| 150 | Ga0075434_100005888 | 3300006871 | Bacteria | 11205 |
| 151 | Ga0075434_100008297 | 3300006871 | Bacteria | 9650 |
| 152 | Ga0075434_100011260 | 3300006871 | Bacteria | 8425 |
| 153 | Ga0075434_100068540 | 3300006871 | Bacteria | 3534 |
| 154 | Ga0075434_100158113 | 3300006871 | Bacteria | 2286 |
| 155 | Ga0075434_100159391 | 3300006871 | Bacteria | 2276 |
| 156 | Ga0075429_100130028 | 3300006880 | Bacteria | 2202 |
| 157 | Ga0075429_100151520 | 3300006880 | Bacteria | 2030 |
| 158 | Ga0075429_100169059 | 3300006880 | Unclassified | 1915 |
| 159 | Ga0075429_100172369 | 3300006880 | Bacteria | 1895 |
| 160 | Ga0075429_100412710 | 3300006880 | Bacteria | 1182 |
| 161 | Ga0075429_100458888 | 3300006880 | Bacteria | 1116 |
| 162 | Ga0068865_100003401 | 3300006881 | Bacteria | 9522 |
| 163 | Ga0068865_100013766 | 3300006881 | Bacteria | 5124 |
| 164 | Ga0068865_100473479 | 3300006881 | Bacteria | 1039 |
| 165 | Ga0068865_100730515 | 3300006881 | Unclassified | 849 |
| 166 | Ga0075436_100001858 | 3300006914 | Bacteria | 14484 |
| 167 | Ga0075436_100008889 | 3300006914 | Bacteria | 6873 |
| 168 | Ga0075436_100020714 | 3300006914 | Bacteria | 4512 |
| 169 | Ga0075436_100150723 | 3300006914 | Bacteria | 1636 |
| 170 | Ga0075436_100187398 | 3300006914 | Bacteria | 1463 |
| 171 | Ga0075436_100249948 | 3300006914 | Bacteria | 1262 |
| 172 | Ga0075436_100425476 | 3300006914 | Unclassified | 965 |
| 173 | Ga0097620_100121922 | 3300006931 | Bacteria | 2674 |
| 174 | Ga0097620_100122761 | 3300006931 | Bacteria | 2664 |
| 175 | Ga0075435_100006637 | 3300007076 | Bacteria | 8200 |
| 176 | Ga0075435_100011923 | 3300007076 | Bacteria | 6420 |
| 177 | Ga0075435_100030367 | 3300007076 | Bacteria | 4248 |
| 178 | Ga0075435_100032642 | 3300007076 | Bacteria | 4113 |
| 179 | Ga0075435_100043026 | 3300007076 | Bacteria | 3615 |
| 180 | Ga0075435_100102481 | 3300007076 | Bacteria | 2372 |
| 181 | Ga0075435_100354719 | 3300007076 | Bacteria | 1257 |
| 182 | Ga0099794_10014958 | 3300007265 | Bacteria | 3413 |
| 183 | Ga0099794_10018141 | 3300007265 | Bacteria | 3150 |
| 184 | Ga0099794_10079020 | 3300007265 | Bacteria | 1620 |
| 185 | Ga0105250_10168189 | 3300009092 | Bacteria | 917 |
| 186 | Ga0105240_10237831 | 3300009093 | Unclassified | 2113 |
| 187 | Ga0111539_10026686 | 3300009094 | Bacteria | 7059 |
| 188 | Ga0111539_10048302 | 3300009094 | Bacteria | 5082 |
| 189 | Ga0111539_10151220 | 3300009094 | Bacteria | 2717 |
| 190 | Ga0111539_10153604 | 3300009094 | Bacteria | 2694 |
| 191 | Ga0105245_10033791 | 3300009098 | Bacteria | 4533 |
| 192 | Ga0105245_10091033 | 3300009098 | Bacteria | 2807 |
| 193 | Ga0105245_10314958 | 3300009098 | Bacteria | 1540 |
| 194 | Ga0105247_10505343 | 3300009101 | Bacteria | 881 |
| 195 | Ga0114129_10028393 | 3300009147 | Bacteria | 7928 |
| 196 | Ga0114129_10030204 | 3300009147 | Bacteria | 7675 |
| 197 | Ga0114129_10062473 | 3300009147 | Bacteria | 5202 |
| 198 | Ga0114129_10129575 | 3300009147 | Bacteria | 3467 |
| 199 | Ga0114129_10159577 | 3300009147 | Bacteria | 3082 |
| 200 | Ga0114129_10445707 | 3300009147 | Unclassified | 1699 |
| 201 | Ga0114129_10834208 | 3300009147 | Unclassified | 1173 |
| 202 | Ga0114129_10872039 | 3300009147 | Bacteria | 1143 |
| 203 | Ga0114129_10961677 | 3300009147 | Bacteria | 1078 |
| 204 | Ga0105243_10050204 | 3300009148 | Bacteria | 3295 |
| 205 | Ga0105243_10196054 | 3300009148 | Bacteria | 1768 |
| 206 | Ga0105241_10309912 | 3300009174 | Bacteria | 1357 |
| 207 | Ga0105242_10032681 | 3300009176 | Bacteria | 4162 |
| 208 | Ga0105242_10110368 | 3300009176 | Bacteria | 2343 |
| 209 | Ga0105242_10249879 | 3300009176 | Bacteria | 1598 |
| 210 | Ga0105248_10002426 | 3300009177 | Bacteria | 20687 |
| 211 | Ga0105248_10104474 | 3300009177 | Bacteria | 3194 |
| 212 | Ga0105248_10177476 | 3300009177 | Bacteria | 2401 |
| 213 | Ga0105248_10409564 | 3300009177 | Bacteria | 1527 |
| 214 | Ga0105248_10843108 | 3300009177 | Bacteria | 1034 |
| 215 | Ga0105248_11370868 | 3300009177 | Unclassified | 800 |
| 216 | Ga0105237_10007820 | 3300009545 | Bacteria | 11654 |
| 217 | Ga0105238_10298845 | 3300009551 | Bacteria | 1593 |
| 218 | Ga0105249_10005227 | 3300009553 | Bacteria | 11203 |
| 219 | Ga0105249_10075534 | 3300009553 | Bacteria | 3121 |
| 220 | Ga0105249_10284527 | 3300009553 | Unclassified | 1652 |
| 221 | Ga0105249_10835401 | 3300009553 | Bacteria | 986 |
| 222 | Ga0105249_11153789 | 3300009553 | Bacteria | 845 |
| 223 | Ga0099796_10230788 | 3300010159 | Unclassified | 762 |
| 224 | Ga0105239_10336328 | 3300010375 | Bacteria | 1704 |
| 225 | Ga0157374_10183472 | 3300013296 | Bacteria | 2045 |
| 226 | Ga0157378_10877231 | 3300013297 | Bacteria | 927 |
| 227 | Ga0157378_11475601 | 3300013297 | Bacteria | 724 |
| 228 | Ga0163162_10010669 | 3300013306 | Bacteria | 8934 |
| 229 | Ga0163162_10118177 | 3300013306 | Bacteria | 2753 |
| 230 | Ga0163162_10123668 | 3300013306 | Bacteria | 2693 |
| 231 | Ga0163162_10430987 | 3300013306 | Bacteria | 1451 |
| 232 | Ga0163162_10469701 | 3300013306 | Unclassified | 1389 |
| 233 | Ga0157372_10548419 | 3300013307 | Unclassified | 1348 |
| 234 | Ga0157375_10040280 | 3300013308 | Bacteria | 4503 |
| 235 | Ga0157375_10183780 | 3300013308 | Bacteria | 2243 |
| 236 | Ga0157375_10790137 | 3300013308 | Bacteria | 1098 |
| 237 | Ga0163163_10099300 | 3300014325 | Bacteria | 2932 |
| 238 | Ga0157380_10075881 | 3300014326 | Bacteria | 2734 |
| 239 | Ga0157380_10188425 | 3300014326 | Bacteria | 1819 |
| 240 | Ga0157380_10784448 | 3300014326 | Bacteria | 968 |
| 241 | Ga0157377_10015522 | 3300014745 | Bacteria | 3899 |
| 242 | Ga0157379_10370026 | 3300014968 | Bacteria | 1314 |
| 243 | Ga0157379_10906062 | 3300014968 | Bacteria | 837 |
| 244 | Ga0157376_10004354 | 3300014969 | Bacteria | 9846 |
| 245 | Ga0157376_10031349 | 3300014969 | Bacteria | 4255 |
| 246 | Ga0157376_10560707 | 3300014969 | Bacteria | 1132 |
| 247 | Ga0157376_10631873 | 3300014969 | Bacteria | 1069 |
| 248 | Ga0157376_10671372 | 3300014969 | Bacteria | 1039 |
| 249 | Ga0163161_10158102 | 3300017792 | Bacteria | 1727 |
| 250 | Ga0206356_11270007 | 3300020070 | Bacteria | 812 |
| 251 | Ga0213872_10001072 | 3300021361 | Bacteria | 18898 |
| 252 | Ga0213876_10025743 | 3300021384 | Bacteria | 3102 |
| 253 | Ga0224712_10239706 | 3300022467 | Bacteria | 835 |
| 254 | Ga0224572_1010248 | 3300024225 | Bacteria | 1759 |
| 255 | Ga0228598_1009860 | 3300024227 | Bacteria | 1908 |
| 256 | Ga0207697_10112345 | 3300025315 | Bacteria | 1167 |
| 257 | Ga0207653_10003016 | 3300025885 | Bacteria | 5346 |
| 258 | Ga0207682_10002915 | 3300025893 | Bacteria | 7544 |
| 259 | Ga0207710_10095441 | 3300025900 | Bacteria | 1397 |
| 260 | Ga0207688_10006975 | 3300025901 | Bacteria | 6148 |
| 261 | Ga0207680_10178848 | 3300025903 | Unclassified | 1433 |
| 262 | Ga0207699_10396661 | 3300025906 | Bacteria | 982 |
| 263 | Ga0207645_10012718 | 3300025907 | Bacteria | 5706 |
| 264 | Ga0207643_10022056 | 3300025908 | Bacteria | 3504 |
| 265 | Ga0207684_10018022 | 3300025910 | Bacteria | 6052 |
| 266 | Ga0207684_10078920 | 3300025910 | Bacteria | 2800 |
| 267 | Ga0207707_10157218 | 3300025912 | Bacteria | 1988 |
| 268 | Ga0207695_10133539 | 3300025913 | Unclassified | 2437 |
| 269 | Ga0207695_10315556 | 3300025913 | Unclassified | 1453 |
| 270 | Ga0207671_10225841 | 3300025914 | Bacteria | 1468 |
| 271 | Ga0207660_10412624 | 3300025917 | Bacteria | 1088 |
| 272 | Ga0207662_10001974 | 3300025918 | Bacteria | 10120 |
| 273 | Ga0207649_10501458 | 3300025920 | Unclassified | 923 |
| 274 | Ga0207646_10000005 | 3300025922 | Bacteria | 523896 |
| 275 | Ga0207646_10240496 | 3300025922 | Bacteria | 1635 |
| 276 | Ga0207646_10775055 | 3300025922 | Unclassified | 855 |
| 277 | Ga0207681_10227709 | 3300025923 | Unclassified | 1445 |
| 278 | Ga0207681_10423728 | 3300025923 | Bacteria | 1079 |
| 279 | Ga0207694_10383639 | 3300025924 | Bacteria | 1167 |
| 280 | Ga0207650_10003815 | 3300025925 | Bacteria | 10308 |
| 281 | Ga0207659_10040309 | 3300025926 | Bacteria | 3265 |
| 282 | Ga0207687_10012986 | 3300025927 | Bacteria | 5442 |
| 283 | Ga0207687_10333530 | 3300025927 | Bacteria | 1231 |
| 284 | Ga0207644_10122799 | 3300025931 | Bacteria | 1979 |
| 285 | Ga0207644_10252967 | 3300025931 | Bacteria | 1406 |
| 286 | Ga0207706_10017068 | 3300025933 | Bacteria | 6547 |
| 287 | Ga0207706_10043603 | 3300025933 | Bacteria | 3975 |
| 288 | Ga0207686_10018772 | 3300025934 | Bacteria | 3920 |
| 289 | Ga0207686_10096501 | 3300025934 | Bacteria | 1964 |
| 290 | Ga0207686_10401136 | 3300025934 | Bacteria | 1044 |
| 291 | Ga0207709_10220021 | 3300025935 | Bacteria | 1369 |
| 292 | Ga0207670_10059918 | 3300025936 | Bacteria | 2591 |
| 293 | Ga0207669_10081323 | 3300025937 | Bacteria | 2075 |
| 294 | Ga0207704_10033489 | 3300025938 | Bacteria | 2922 |
| 295 | Ga0207704_10059859 | 3300025938 | Bacteria | 2353 |
| 296 | Ga0207704_10100542 | 3300025938 | Bacteria | 1926 |
| 297 | Ga0207704_10610291 | 3300025938 | Unclassified | 894 |
| 298 | Ga0207665_10008672 | 3300025939 | Bacteria | 6692 |
| 299 | Ga0207691_10010467 | 3300025940 | Bacteria | 8895 |
| 300 | Ga0207691_10031364 | 3300025940 | Bacteria | 4961 |
| 301 | Ga0207691_10304109 | 3300025940 | Bacteria | 1369 |
| 302 | Ga0207711_10155122 | 3300025941 | Bacteria | 2069 |
| 303 | Ga0207711_10339351 | 3300025941 | Bacteria | 1390 |
| 304 | Ga0207711_10596631 | 3300025941 | Bacteria | 1030 |
| 305 | Ga0207689_10002575 | 3300025942 | Bacteria | 16800 |
| 306 | Ga0207679_10024682 | 3300025945 | Bacteria | 4124 |
| 307 | Ga0207667_10155766 | 3300025949 | Bacteria | 2351 |
| 308 | Ga0207651_10009309 | 3300025960 | Bacteria | 5367 |
| 309 | Ga0207651_10313338 | 3300025960 | Bacteria | 1309 |
| 310 | Ga0207712_10098589 | 3300025961 | Bacteria | 2168 |
| 311 | Ga0207712_10107147 | 3300025961 | Bacteria | 2089 |
| 312 | Ga0207712_10619234 | 3300025961 | Unclassified | 938 |
| 313 | Ga0207668_10424913 | 3300025972 | Bacteria | 1129 |
| 314 | Ga0207668_10642146 | 3300025972 | Bacteria | 928 |
| 315 | Ga0207668_11078641 | 3300025972 | Unclassified | 719 |
| 316 | Ga0207658_10947324 | 3300025986 | Bacteria | 785 |
| 317 | Ga0207677_10059926 | 3300026023 | Bacteria | 2628 |
| 318 | Ga0207677_10067722 | 3300026023 | Bacteria | 2502 |
| 319 | Ga0207703_10220411 | 3300026035 | Bacteria | 1696 |
| 320 | Ga0207678_10114023 | 3300026067 | Bacteria | 2306 |
| 321 | Ga0207641_10009460 | 3300026088 | Bacteria | 8031 |
| 322 | Ga0207641_10015591 | 3300026088 | Bacteria | 6228 |
| 323 | Ga0207641_10308889 | 3300026088 | Bacteria | 1496 |
| 324 | Ga0207648_10016241 | 3300026089 | Bacteria | 6812 |
| 325 | Ga0207676_10008185 | 3300026095 | Bacteria | 7439 |
| 326 | Ga0207675_100031483 | 3300026118 | Bacteria | 4941 |
| 327 | Ga0207675_100326474 | 3300026118 | Unclassified | 1499 |
| 328 | Ga0207683_10078682 | 3300026121 | Bacteria | 2922 |
| 329 | Ga0207683_10158924 | 3300026121 | Bacteria | 2042 |
| 330 | Ga0207683_10244973 | 3300026121 | Bacteria | 1635 |
| 331 | Ga0209588_1006633 | 3300027671 | Bacteria | 3374 |
| 332 | Ga0209588_1040120 | 3300027671 | Bacteria | 1510 |
| 333 | Ga0207428_10013895 | 3300027907 | Bacteria | 7012 |
| 334 | Ga0207428_10061336 | 3300027907 | Bacteria | 2978 |
| 335 | Ga0207428_10216112 | 3300027907 | Unclassified | 1439 |
| 336 | Ga0207428_10277567 | 3300027907 | Bacteria | 1244 |
| 337 | Ga0207428_10624804 | 3300027907 | Bacteria | 775 |
| 338 | Ga0265354_1000140 | 3300028016 | Bacteria | 13048 |
| 339 | Ga0265354_1000496 | 3300028016 | Bacteria | 6795 |
| 340 | Ga0265357_1012037 | 3300028023 | Unclassified | 887 |
| 341 | Ga0268266_10017882 | 3300028379 | Bacteria | 6041 |
| 342 | Ga0268266_10070943 | 3300028379 | Bacteria | 3019 |
| 343 | Ga0268266_10143270 | 3300028379 | Bacteria | 2146 |
| 344 | Ga0268266_10177178 | 3300028379 | Unclassified | 1939 |
| 345 | Ga0268265_10034851 | 3300028380 | Bacteria | 3672 |
| 346 | Ga0268265_10161262 | 3300028380 | Bacteria | 1905 |
| 347 | Ga0268265_10413711 | 3300028380 | Bacteria | 1250 |
| 348 | Ga0268264_10089418 | 3300028381 | Bacteria | 2652 |
| 349 | Ga0268264_10217155 | 3300028381 | Unclassified | 1758 |
| 350 | Ga0265770_1000351 | 3300030878 | Bacteria | 6312 |
| 351 | Ga0265760_10001580 | 3300031090 | Bacteria | 6713 |
| 352 | Ga0265760_10006711 | 3300031090 | Bacteria | 3294 |
| 353 | Ga0265340_10198052 | 3300031247 | Bacteria | 904 |
| 354 | Ga0265316_10000902 | 3300031344 | Bacteria | 32488 |
| 355 | Ga0307410_10950104 | 3300031852 | Bacteria | 739 |
| 356 | Ga0307416_100838162 | 3300032002 | Bacteria | 1017 |
| 357 | Ga0307414_10927298 | 3300032004 | Bacteria | 799 |
| 358 | Ga0373950_0005575 | 3300034818 | Bacteria | 1886 |
| 359 | Ga0373959_0002979 | 3300034820 | Bacteria | 2689 |
| 360 | Ga0373938_0002531 | 3300034957 | Bacteria | 2953 |
| 361 | Ga0373929_0005770 | 3300035085 | Bacteria | 2235 |
| 362 | Ga0373940_0142924 | 3300035088 | Bacteria | 757 |
| 363 | Ga0373949_0008488 | 3300035090 | Bacteria | 2248 |
| 364 | Ga0373949_0017957 | 3300035090 | Unclassified | 1599 |
| 365 | Ga0373951_0003102 | 3300035091 | Bacteria | 4100 |
| 366 | Ga0373952_0051754 | 3300035092 | Bacteria | 981 |
| 367 | Ga0373932_0015060 | 3300035112 | Bacteria | 1955 |
| 368 | Ga0373939_0003089 | 3300035114 | Bacteria | 3908 |
| 369 | Ga0373939_0079737 | 3300035114 | Bacteria | 1085 |
| 370 | Ga0373954_0009191 | 3300035118 | Bacteria | 4348 |
| 371 | Ga0373960_0001999 | 3300035121 | Bacteria | 4578 |
| 372 | Ga0373955_0058105 | 3300035172 | Bacteria | 2127 |
| 373 | Ga0373942_0017342 | 3300035207 | Bacteria | 1774 |
| 374 | Ga0373961_0004367 | 3300035241 | Bacteria | 3422 |
| 375 | Ga0373962_0024027 | 3300035242 | Bacteria | 1626 |
| 376 | Ga0373962_0033932 | 3300035242 | Bacteria | 1411 |
| 377 | Ga0373931_0012497 | 3300035691 | Bacteria | 4113 |
| 378 | Ga0373935_0474048 | 3300035692 | Bacteria | 906 |
| 379 | Ga0373927_0054205 | 3300035695 | Unclassified | 2594 |
| 380 | Ga0373927_0251937 | 3300035695 | Bacteria | 1161 |
| 381 | Ga0373947_0509251 | 3300035725 | Bacteria | 818 |
| 382 | Ga0373937_0045218 | 3300036401 | Bacteria | 4023 |
| 383 | Ga0373937_0402316 | 3300036401 | Bacteria | 1299 |
| 384 | Ga0436365_1505847 | 3300039437 | Bacteria | 6621 |
| 385 | Ga0451800_1099319 | 3300041459 | Bacteria | 827 |
| 386 | Ga0451576_0039792 | 3300045051 | Bacteria | 4976 |
| 387 | Ga0495592_0007872 | 3300046454 | Bacteria | 7988 |
| 388 | Ga0495629_0000018 | 3300046459 | Bacteria | 169239 |
| 389 | Ga0495651_0002472 | 3300046462 | Bacteria | 14281 |
| 390 | Ga0495653_0011358 | 3300046463 | Bacteria | 7276 |
| 391 | Ga0495580_0035396 | 3300046472 | Bacteria | 3591 |
| 392 | Ga0495580_0082018 | 3300046472 | Bacteria | 2248 |
| 393 | Ga0495580_0099393 | 3300046472 | Bacteria | 2024 |
| 394 | Ga0495582_0001254 | 3300046473 | Bacteria | 14252 |
| 395 | Ga0495639_0007935 | 3300046475 | Bacteria | 4562 |
| 396 | Ga0495662_0031784 | 3300046476 | Bacteria | 2550 |
| 397 | Ga0495664_0051732 | 3300046477 | Unclassified | 2439 |
| 398 | Ga0495594_0000960 | 3300046499 | Bacteria | 14991 |
| 399 | Ga0495608_0014065 | 3300046511 | Bacteria | 5554 |
| 400 | Ga0495618_0010301 | 3300046514 | Bacteria | 5656 |
| 401 | Ga0495628_0001354 | 3300046516 | Bacteria | 22458 |
| 402 | Ga0495630_0071980 | 3300046517 | Bacteria | 2602 |
| 403 | Ga0495630_0084527 | 3300046517 | Unclassified | 2396 |
| 404 | Ga0495652_0001829 | 3300046529 | Bacteria | 22590 |
| 405 | Ga0495640_0337696 | 3300046533 | Unclassified | 931 |
| 406 | Ga0495586_0145543 | 3300046535 | Bacteria | 1331 |
| 407 | Ga0495586_0171988 | 3300046535 | Bacteria | 1224 |
| 408 | Ga0495645_0073318 | 3300046543 | Unclassified | 2466 |
| 409 | Ga0495667_0002946 | 3300046559 | Bacteria | 11418 |
| 410 | Ga0495634_0118005 | 3300046642 | Bacteria | 1701 |
| 411 | Ga0495635_0000069 | 3300046663 | Bacteria | 63592 |
| 412 | Ga0495635_0055686 | 3300046663 | Unclassified | 2724 |
| 413 | Ga0495659_0007350 | 3300046664 | Bacteria | 3494 |
| 414 | Ga0495623_0086957 | 3300046679 | Unclassified | 1926 |
| 415 | Ga0495647_0002903 | 3300046681 | Bacteria | 5442 |
| 416 | Ga0495658_0000471 | 3300046683 | Bacteria | 22293 |
| 417 | Ga0495613_0005080 | 3300046689 | Bacteria | 9864 |
| 418 | Ga0495600_0001463 | 3300046809 | Bacteria | 13099 |
| 419 | Ga0495604_0016106 | 3300047317 | Bacteria | 5972 |
| 420 | Ga0495604_0524681 | 3300047317 | Bacteria | 766 |
| 421 | Ga0495674_0023499 | 3300047319 | Bacteria | 5680 |
| 422 | Ga0495674_0048005 | 3300047319 | Bacteria | 3781 |
| 423 | Ga0495674_0141358 | 3300047319 | Bacteria | 2023 |
| 424 | Ga0495674_0570850 | 3300047319 | Unclassified | 899 |
| 425 | Ga0495676_0080094 | 3300047321 | Bacteria | 2481 |
| 426 | Ga0495680_0000044 | 3300047322 | Bacteria | 97068 |
| 427 | Ga0495680_0001532 | 3300047322 | Bacteria | 24733 |
| 428 | Ga0495675_0000366 | 3300047444 | Bacteria | 31480 |
| 429 | Ga0495675_0020005 | 3300047444 | Bacteria | 4254 |
| 430 | Ga0495684_0026100 | 3300047471 | Unclassified | 4491 |
| 431 | Ga0495614_0018343 | 3300048089 | Bacteria | 3031 |
| 432 | Ga0496102_0040957 | 3300048905 | Bacteria | 4193 |
| 433 | Ga0496102_0044366 | 3300048905 | Bacteria | 4035 |
| 434 | Ga0496102_0759918 | 3300048905 | Bacteria | 892 |
| 435 | Ga0496104_0007618 | 3300048907 | Bacteria | 9585 |
| 436 | Ga0496105_0039898 | 3300048908 | Bacteria | 3871 |
| 437 | Ga0496106_0169666 | 3300048909 | Bacteria | 1729 |
| 438 | Ga0496106_0221528 | 3300048909 | Bacteria | 1509 |
| 439 | Ga0496108_0002260 | 3300048911 | Bacteria | 15425 |
| 440 | Ga0496109_0017369 | 3300048912 | Bacteria | 6305 |
| 441 | Ga0496109_0121658 | 3300048912 | Unclassified | 2432 |
| 442 | Ga0496110_0001014 | 3300048913 | Bacteria | 19798 |
| 443 | Ga0496112_0008799 | 3300048915 | Bacteria | 9059 |
| 444 | Ga0496113_0000999 | 3300048916 | Bacteria | 15144 |
| 445 | Ga0496114_0256321 | 3300048917 | Bacteria | 1540 |
| 446 | Ga0501033_0014320 | 3300049570 | Bacteria | 6027 |
| 447 | Ga0501034_0001936 | 3300049571 | Bacteria | 26215 |
| 448 | Ga0501034_0209699 | 3300049571 | Bacteria | 1904 |
| 449 | Ga0501034_0776058 | 3300049571 | Unclassified | 852 |
| 450 | Ga0501043_0384825 | 3300049579 | Bacteria | 1061 |
| 451 | Ga0501046_0009058 | 3300049580 | Bacteria | 8630 |
| 452 | Ga0501046_0051472 | 3300049580 | Bacteria | 3249 |
| 453 | Ga0501047_0022792 | 3300049581 | Bacteria | 6012 |
| 454 | Ga0501070_0002689 | 3300049586 | Bacteria | 15528 |
| 455 | Ga0501080_1152257 | 3300049742 | Bacteria | 668 |
| 456 | Ga0501044_0060576 | 3300049823 | Bacteria | 3875 |
| 457 | Ga0501044_0097268 | 3300049823 | Bacteria | 2965 |
| 458 | nmdc:mga05p37_104709_c1 | 3300050507 | Bacteria | 3481 |
| 459 | nmdc:mga05p37_187676_c1 | 3300050507 | Bacteria | 2513 |
| 460 | nmdc:mga05p37_25306_c1 | 3300050507 | Bacteria | 7218 |
| 461 | nmdc:mga05p37_518962_c1 | 3300050507 | Unclassified | 1363 |
| 462 | nmdc:mga05p37_62132_c1 | 3300050507 | Bacteria | 4597 |
| 463 | nmdc:mga05p37_85364_c1 | 3300050507 | Bacteria | 3890 |
| 464 | nmdc:mga05p37_924490_c1 | 3300050507 | Bacteria | 937 |
| 465 | nmdc:mga09592_158122_c1 | 3300050508 | Bacteria | 1957 |
| 466 | nmdc:mga09592_71066_c1 | 3300050508 | Bacteria | 2954 |
| 467 | nmdc:mga09592_798209_c1 | 3300050508 | Bacteria | 799 |
| 468 | nmdc:mga0qj67_121163_c1 | 3300050509 | Bacteria | 2116 |
| 469 | nmdc:mga0qj67_150082_c1 | 3300050509 | Bacteria | 1891 |
| 470 | nmdc:mga06r32_141118_c1 | 3300050510 | Bacteria | 2386 |
| 471 | nmdc:mga06r32_18928_c1 | 3300050510 | Bacteria | 6314 |
| 472 | nmdc:mga06r32_565810_c1 | 3300050510 | Bacteria | 1110 |
| 473 | nmdc:mga08y16_282339_c1 | 3300050511 | Bacteria | 1712 |
| 474 | nmdc:mga08y16_47922_c1 | 3300050511 | Bacteria | 4473 |
| 475 | nmdc:mga08y16_61190_c1 | 3300050511 | Bacteria | 3932 |
| 476 | nmdc:mga0n895_115046_c1 | 3300050512 | Bacteria | 2708 |
| 477 | nmdc:mga0n895_117847_c1 | 3300050512 | Bacteria | 2675 |
| 478 | nmdc:mga0n895_119652_c1 | 3300050512 | Bacteria | 2654 |
| 479 | nmdc:mga0n895_157724_c1 | 3300050512 | Bacteria | 2301 |
| 480 | nmdc:mga0n895_47526_c1 | 3300050512 | Bacteria | 4196 |
| 481 | nmdc:mga0n895_98159_c1 | 3300050512 | Bacteria | 2936 |
| 482 | nmdc:mga0rr50_105075_c1 | 3300050513 | Bacteria | 2226 |
| 483 | nmdc:mga0rr50_14521_c1 | 3300050513 | Bacteria | 5170 |
| 484 | nmdc:mga0rr50_23827_c1 | 3300050513 | Bacteria | 4231 |
| 485 | nmdc:mga0rr50_34717_c1 | 3300050513 | Bacteria | 3614 |
| 486 | nmdc:mga0rr50_58211_c1 | 3300050513 | Bacteria | 2895 |
| 487 | nmdc:mga0rr50_66888_c1 | 3300050513 | Bacteria | 2728 |
| 488 | nmdc:mga0rr50_93016_c1 | 3300050513 | Unclassified | 2352 |
| 489 | nmdc:mga0rr50_97855_c1 | 3300050513 | Bacteria | 2299 |
| 490 | nmdc:mga08x19_113439_c1 | 3300050514 | Bacteria | 1810 |
| 491 | nmdc:mga08x19_11576_c1 | 3300050514 | Bacteria | 5310 |
| 492 | nmdc:mga08x19_1552_c1 | 3300050514 | Bacteria | 14249 |
| 493 | nmdc:mga08x19_161072_c1 | 3300050514 | Bacteria | 1524 |
| 494 | nmdc:mga08x19_174587_c1 | 3300050514 | Bacteria | 1465 |
| 495 | nmdc:mga08x19_385234_c1 | 3300050514 | Bacteria | 982 |
| 496 | nmdc:mga08x19_421967_c1 | 3300050514 | Bacteria | 937 |
| 497 | nmdc:mga08x19_42410_c1 | 3300050514 | Bacteria | 2901 |
| 498 | nmdc:mga08x19_72084_c1 | 3300050514 | Bacteria | 2253 |
| 499 | nmdc:mga08x19_89009_c1 | 3300050514 | Bacteria | 2036 |
| 500 | nmdc:mga0a205_161_c1 | 3300050515 | Bacteria | 44265 |
| 501 | nmdc:mga0a205_281895_c1 | 3300050515 | Bacteria | 1537 |
| 502 | nmdc:mga0a205_341270_c1 | 3300050515 | Bacteria | 1366 |
| 503 | nmdc:mga0a205_3521_c1 | 3300050515 | Bacteria | 13991 |
| 504 | nmdc:mga0a205_39439_c1 | 3300050515 | Bacteria | 4546 |
| 505 | nmdc:mga0a205_42795_c1 | 3300050515 | Bacteria | 4365 |
| 506 | nmdc:mga0a205_47188_c1 | 3300050515 | Bacteria | 4156 |
| 507 | Ga0495619_0003782 | 3300053085 | Bacteria | 9735 |
| 508 | Ga0495619_0293266 | 3300053085 | Unclassified | 1127 |
| 509 | Ga0587111_0006492 | 3300060346 | Bacteria | 1857 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300024227 | Ga0228598_1009860 | Ga0228598_10098602 | 185 |
| 2 | 3300005457 | Ga0070662_100944050 | Ga0070662_1009440501 | 189 |
| 3 | 3300013306 | Ga0163162_10123668 | Ga0163162_101236682 | 189 |
| 4 | 3300049570 | Ga0501033_0014320 | Ga0501033_0014320_2261_2854 | 192 |
| 5 | 3300049571 | Ga0501034_0001936 | Ga0501034_0001936_3531_4124 | 192 |
| 6 | 3300049571 | Ga0501034_0776058 | Ga0501034_0776058_12_605 | 192 |
| 7 | 3300049579 | Ga0501043_0384825 | Ga0501043_0384825_273_866 | 192 |
| 8 | 3300049580 | Ga0501046_0009058 | Ga0501046_0009058_4845_5438 | 192 |
| 9 | 3300049580 | Ga0501046_0051472 | Ga0501046_0051472_566_1159 | 192 |
| 10 | 3300049581 | Ga0501047_0022792 | Ga0501047_0022792_599_1192 | 192 |
| 11 | 3300049586 | Ga0501070_0002689 | Ga0501070_0002689_9737_10330 | 192 |
| 12 | 3300049742 | Ga0501080_1152257 | Ga0501080_1152257_20_613 | 192 |
| 13 | 3300049823 | Ga0501044_0060576 | Ga0501044_0060576_179_772 | 192 |
| 14 | 3300049823 | Ga0501044_0097268 | Ga0501044_0097268_2306_2899 | 192 |
| 15 | 3300005289 | Ga0065704_10288588 | Ga0065704_102885881 | 193 |
| 16 | 3300006844 | Ga0075428_101171312 | Ga0075428_1011713121 | 193 |
| 17 | 3300025906 | Ga0207699_10396661 | Ga0207699_103966612 | 193 |
| 18 | 3300025922 | Ga0207646_10240496 | Ga0207646_102404962 | 193 |
| 19 | 3300050512 | nmdc:mga0n895_119652_c1 | nmdc:mga0n895_119652_c1_1518_2120 | 193 |
| 20 | 3300050514 | nmdc:mga08x19_385234_c1 | nmdc:mga08x19_385234_c1_235_837 | 193 |
| 21 | 3300050515 | nmdc:mga0a205_281895_c1 | nmdc:mga0a205_281895_c1_25_630 | 193 |
| 22 | 3300005289 | Ga0065704_10223261 | Ga0065704_102232611 | 194 |
| 23 | 3300005546 | Ga0070696_100321855 | Ga0070696_1003218552 | 194 |
| 24 | 3300006844 | Ga0075428_100102324 | Ga0075428_1001023244 | 194 |
| 25 | 3300006880 | Ga0075429_100151520 | Ga0075429_1001515201 | 194 |
| 26 | 3300009094 | Ga0111539_10153604 | Ga0111539_101536042 | 194 |
| 27 | 3300009147 | Ga0114129_10062473 | Ga0114129_100624734 | 194 |
| 28 | 3300009147 | Ga0114129_10834208 | Ga0114129_108342081 | 194 |
| 29 | 3300025917 | Ga0207660_10412624 | Ga0207660_104126242 | 194 |
| 30 | 3300050507 | nmdc:mga05p37_85364_c1 | nmdc:mga05p37_85364_c1_2551_3135 | 194 |
| 31 | 3300050507 | nmdc:mga05p37_924490_c1 | nmdc:mga05p37_924490_c1_282_866 | 194 |
| 32 | 3300050508 | nmdc:mga09592_158122_c1 | nmdc:mga09592_158122_c1_1239_1823 | 194 |
| 33 | 3300003203 | JGI25406J46586_10013756 | JGI25406J46586_100137562 | 195 |
| 34 | 3300005985 | Ga0081539_10000010 | Ga0081539_1000001032 | 195 |
| 35 | 3300020070 | Ga0206356_11270007 | Ga0206356_112700071 | 195 |
| 36 | 3300022467 | Ga0224712_10239706 | Ga0224712_102397062 | 195 |
| 37 | 3300035725 | Ga0373947_0509251 | Ga0373947_0509251_70_657 | 195 |
| 38 | 3300036401 | Ga0373937_0402316 | Ga0373937_0402316_411_998 | 195 |
| 39 | 3300005334 | Ga0068869_100087383 | Ga0068869_1000873832 | 196 |
| 40 | 3300005356 | Ga0070674_100042884 | Ga0070674_1000428842 | 196 |
| 41 | 3300005364 | Ga0070673_100430249 | Ga0070673_1004302492 | 196 |
| 42 | 3300005366 | Ga0070659_100866634 | Ga0070659_1008666342 | 196 |
| 43 | 3300005456 | Ga0070678_100202608 | Ga0070678_1002026082 | 196 |
| 44 | 3300005458 | Ga0070681_10299558 | Ga0070681_102995582 | 196 |
| 45 | 3300005468 | Ga0070707_100795090 | Ga0070707_1007950901 | 196 |
| 46 | 3300005536 | Ga0070697_100227597 | Ga0070697_1002275971 | 196 |
| 47 | 3300005543 | Ga0070672_100301625 | Ga0070672_1003016252 | 196 |
| 48 | 3300005548 | Ga0070665_100009511 | Ga0070665_10000951110 | 196 |
| 49 | 3300005548 | Ga0070665_100113521 | Ga0070665_1001135213 | 196 |
| 50 | 3300005548 | Ga0070665_100166724 | Ga0070665_1001667242 | 196 |
| 51 | 3300005617 | Ga0068859_100121921 | Ga0068859_1001219212 | 196 |
| 52 | 3300005841 | Ga0068863_100593767 | Ga0068863_1005937671 | 196 |
| 53 | 3300005843 | Ga0068860_100445618 | Ga0068860_1004456182 | 196 |
| 54 | 3300006237 | Ga0097621_100064190 | Ga0097621_1000641902 | 196 |
| 55 | 3300006237 | Ga0097621_100226909 | Ga0097621_1002269093 | 196 |
| 56 | 3300006237 | Ga0097621_100438815 | Ga0097621_1004388152 | 196 |
| 57 | 3300006358 | Ga0068871_100005904 | Ga0068871_1000059049 | 196 |
| 58 | 3300006844 | Ga0075428_100079272 | Ga0075428_1000792723 | 196 |
| 59 | 3300006871 | Ga0075434_100158113 | Ga0075434_1001581133 | 196 |
| 60 | 3300006880 | Ga0075429_100172369 | Ga0075429_1001723692 | 196 |
| 61 | 3300006881 | Ga0068865_100003401 | Ga0068865_10000340110 | 196 |
| 62 | 3300006881 | Ga0068865_100013766 | Ga0068865_1000137664 | 196 |
| 63 | 3300006931 | Ga0097620_100121922 | Ga0097620_1001219222 | 196 |
| 64 | 3300007076 | Ga0075435_100043026 | Ga0075435_1000430264 | 196 |
| 65 | 3300009098 | Ga0105245_10091033 | Ga0105245_100910332 | 196 |
| 66 | 3300009147 | Ga0114129_10030204 | Ga0114129_100302047 | 196 |
| 67 | 3300009148 | Ga0105243_10050204 | Ga0105243_100502044 | 196 |
| 68 | 3300009176 | Ga0105242_10032681 | Ga0105242_100326813 | 196 |
| 69 | 3300009176 | Ga0105242_10110368 | Ga0105242_101103682 | 196 |
| 70 | 3300009177 | Ga0105248_10104474 | Ga0105248_101044742 | 196 |
| 71 | 3300009177 | Ga0105248_10177476 | Ga0105248_101774762 | 196 |
| 72 | 3300009177 | Ga0105248_10409564 | Ga0105248_104095642 | 196 |
| 73 | 3300009551 | Ga0105238_10298845 | Ga0105238_102988452 | 196 |
| 74 | 3300009553 | Ga0105249_11153789 | Ga0105249_111537891 | 196 |
| 75 | 3300013297 | Ga0157378_11475601 | Ga0157378_114756011 | 196 |
| 76 | 3300013306 | Ga0163162_10010669 | Ga0163162_100106696 | 196 |
| 77 | 3300013306 | Ga0163162_10118177 | Ga0163162_101181773 | 196 |
| 78 | 3300013308 | Ga0157375_10040280 | Ga0157375_100402803 | 196 |
| 79 | 3300013308 | Ga0157375_10790137 | Ga0157375_107901372 | 196 |
| 80 | 3300014968 | Ga0157379_10370026 | Ga0157379_103700262 | 196 |
| 81 | 3300014969 | Ga0157376_10004354 | Ga0157376_100043547 | 196 |
| 82 | 3300014969 | Ga0157376_10560707 | Ga0157376_105607072 | 196 |
| 83 | 3300014969 | Ga0157376_10631873 | Ga0157376_106318731 | 196 |
| 84 | 3300014969 | Ga0157376_10671372 | Ga0157376_106713722 | 196 |
| 85 | 3300025912 | Ga0207707_10157218 | Ga0207707_101572183 | 196 |
| 86 | 3300025922 | Ga0207646_10775055 | Ga0207646_107750551 | 196 |
| 87 | 3300025924 | Ga0207694_10383639 | Ga0207694_103836392 | 196 |
| 88 | 3300025927 | Ga0207687_10012986 | Ga0207687_100129862 | 196 |
| 89 | 3300025934 | Ga0207686_10018772 | Ga0207686_100187723 | 196 |
| 90 | 3300025934 | Ga0207686_10096501 | Ga0207686_100965012 | 196 |
| 91 | 3300025935 | Ga0207709_10220021 | Ga0207709_102200212 | 196 |
| 92 | 3300025937 | Ga0207669_10081323 | Ga0207669_100813233 | 196 |
| 93 | 3300025938 | Ga0207704_10033489 | Ga0207704_100334893 | 196 |
| 94 | 3300025938 | Ga0207704_10059859 | Ga0207704_100598592 | 196 |
| 95 | 3300025940 | Ga0207691_10304109 | Ga0207691_103041092 | 196 |
| 96 | 3300025941 | Ga0207711_10155122 | Ga0207711_101551222 | 196 |
| 97 | 3300025960 | Ga0207651_10313338 | Ga0207651_103133382 | 196 |
| 98 | 3300026023 | Ga0207677_10059926 | Ga0207677_100599262 | 196 |
| 99 | 3300026088 | Ga0207641_10308889 | Ga0207641_103088892 | 196 |
| 100 | 3300026121 | Ga0207683_10244973 | Ga0207683_102449732 | 196 |
| 101 | 3300028379 | Ga0268266_10017882 | Ga0268266_100178825 | 196 |
| 102 | 3300028379 | Ga0268266_10143270 | Ga0268266_101432702 | 196 |
| 103 | 3300031852 | Ga0307410_10950104 | Ga0307410_109501041 | 196 |
| 104 | 3300032004 | Ga0307414_10927298 | Ga0307414_109272982 | 196 |
| 105 | 3300035692 | Ga0373935_0474048 | Ga0373935_0474048_299_889 | 196 |
| 106 | 3300041459 | Ga0451800_1099319 | Ga0451800_1099319_166_756 | 196 |
| 107 | 3300046459 | Ga0495629_0000018 | Ga0495629_0000018_81355_81945 | 196 |
| 108 | 3300046472 | Ga0495580_0099393 | Ga0495580_0099393_1265_1855 | 196 |
| 109 | 3300046473 | Ga0495582_0001254 | Ga0495582_0001254_8884_9474 | 196 |
| 110 | 3300046475 | Ga0495639_0007935 | Ga0495639_0007935_2985_3575 | 196 |
| 111 | 3300046476 | Ga0495662_0031784 | Ga0495662_0031784_1396_1986 | 196 |
| 112 | 3300046499 | Ga0495594_0000960 | Ga0495594_0000960_14124_14714 | 196 |
| 113 | 3300046535 | Ga0495586_0145543 | Ga0495586_0145543_670_1260 | 196 |
| 114 | 3300046642 | Ga0495634_0118005 | Ga0495634_0118005_870_1460 | 196 |
| 115 | 3300046663 | Ga0495635_0000069 | Ga0495635_0000069_23987_24577 | 196 |
| 116 | 3300046681 | Ga0495647_0002903 | Ga0495647_0002903_2882_3472 | 196 |
| 117 | 3300046683 | Ga0495658_0000471 | Ga0495658_0000471_3407_3997 | 196 |
| 118 | 3300046689 | Ga0495613_0005080 | Ga0495613_0005080_8341_8931 | 196 |
| 119 | 3300047319 | Ga0495674_0570850 | Ga0495674_0570850_257_847 | 196 |
| 120 | 3300047321 | Ga0495676_0080094 | Ga0495676_0080094_1744_2334 | 196 |
| 121 | 3300047322 | Ga0495680_0000044 | Ga0495680_0000044_45968_46558 | 196 |
| 122 | 3300048089 | Ga0495614_0018343 | Ga0495614_0018343_1768_2358 | 196 |
| 123 | 3300048905 | Ga0496102_0044366 | Ga0496102_0044366_2767_3357 | 196 |
| 124 | 3300048908 | Ga0496105_0039898 | Ga0496105_0039898_904_1494 | 196 |
| 125 | 3300048917 | Ga0496114_0256321 | Ga0496114_0256321_677_1267 | 196 |
| 126 | 3300050507 | nmdc:mga05p37_518962_c1 | nmdc:mga05p37_518962_c1_654_1277 | 196 |
| 127 | 3300050511 | nmdc:mga08y16_282339_c1 | nmdc:mga08y16_282339_c1_936_1532 | 196 |
| 128 | 3300050513 | nmdc:mga0rr50_34717_c1 | nmdc:mga0rr50_34717_c1_2555_3148 | 196 |
| 129 | 3300050515 | nmdc:mga0a205_3521_c1 | nmdc:mga0a205_3521_c1_13001_13624 | 196 |
| 130 | 3300053085 | Ga0495619_0003782 | Ga0495619_0003782_1697_2287 | 196 |
| 131 | 3300002076 | JGI24749J21850_1014134 | JGI24749J21850_10141341 | 197 |
| 132 | 3300002076 | JGI24749J21850_1034686 | JGI24749J21850_10346861 | 197 |
| 133 | 3300005288 | Ga0065714_10067030 | Ga0065714_100670307 | 197 |
| 134 | 3300005290 | Ga0065712_10068399 | Ga0065712_100683996 | 197 |
| 135 | 3300005293 | Ga0065715_10000217 | Ga0065715_100002173 | 197 |
| 136 | 3300005293 | Ga0065715_10224426 | Ga0065715_102244261 | 197 |
| 137 | 3300005293 | Ga0065715_10563425 | Ga0065715_105634251 | 197 |
| 138 | 3300005295 | Ga0065707_10350939 | Ga0065707_103509391 | 197 |
| 139 | 3300005328 | Ga0070676_10006316 | Ga0070676_100063164 | 197 |
| 140 | 3300005328 | Ga0070676_10030291 | Ga0070676_100302912 | 197 |
| 141 | 3300005330 | Ga0070690_100017024 | Ga0070690_1000170245 | 197 |
| 142 | 3300005330 | Ga0070690_100101083 | Ga0070690_1001010832 | 197 |
| 143 | 3300005331 | Ga0070670_100011887 | Ga0070670_1000118872 | 197 |
| 144 | 3300005333 | Ga0070677_10021656 | Ga0070677_100216564 | 197 |
| 145 | 3300005333 | Ga0070677_10129629 | Ga0070677_101296292 | 197 |
| 146 | 3300005334 | Ga0068869_100058804 | Ga0068869_1000588042 | 197 |
| 147 | 3300005335 | Ga0070666_10055144 | Ga0070666_100551444 | 197 |
| 148 | 3300005337 | Ga0070682_100123081 | Ga0070682_1001230813 | 197 |
| 149 | 3300005338 | Ga0068868_100018780 | Ga0068868_1000187805 | 197 |
| 150 | 3300005340 | Ga0070689_100020491 | Ga0070689_1000204915 | 197 |
| 151 | 3300005341 | Ga0070691_10110621 | Ga0070691_101106212 | 197 |
| 152 | 3300005343 | Ga0070687_100090482 | Ga0070687_1000904822 | 197 |
| 153 | 3300005344 | Ga0070661_100172045 | Ga0070661_1001720452 | 197 |
| 154 | 3300005347 | Ga0070668_100038267 | Ga0070668_1000382672 | 197 |
| 155 | 3300005347 | Ga0070668_100200057 | Ga0070668_1002000572 | 197 |
| 156 | 3300005353 | Ga0070669_100125134 | Ga0070669_1001251344 | 197 |
| 157 | 3300005353 | Ga0070669_100173129 | Ga0070669_1001731292 | 197 |
| 158 | 3300005354 | Ga0070675_100037521 | Ga0070675_1000375213 | 197 |
| 159 | 3300005364 | Ga0070673_100015974 | Ga0070673_1000159742 | 197 |
| 160 | 3300005364 | Ga0070673_100772247 | Ga0070673_1007722472 | 197 |
| 161 | 3300005365 | Ga0070688_100031438 | Ga0070688_1000314382 | 197 |
| 162 | 3300005365 | Ga0070688_100065272 | Ga0070688_1000652722 | 197 |
| 163 | 3300005366 | Ga0070659_100022907 | Ga0070659_1000229075 | 197 |
| 164 | 3300005367 | Ga0070667_100067678 | Ga0070667_1000676783 | 197 |
| 165 | 3300005367 | Ga0070667_100408437 | Ga0070667_1004084371 | 197 |
| 166 | 3300005406 | Ga0070703_10053199 | Ga0070703_100531992 | 197 |
| 167 | 3300005434 | Ga0070709_10020764 | Ga0070709_100207644 | 197 |
| 168 | 3300005438 | Ga0070701_10166141 | Ga0070701_101661413 | 197 |
| 169 | 3300005438 | Ga0070701_10242840 | Ga0070701_102428402 | 197 |
| 170 | 3300005440 | Ga0070705_100011395 | Ga0070705_1000113955 | 197 |
| 171 | 3300005440 | Ga0070705_100014615 | Ga0070705_1000146152 | 197 |
| 172 | 3300005444 | Ga0070694_100023294 | Ga0070694_1000232942 | 197 |
| 173 | 3300005445 | Ga0070708_100017141 | Ga0070708_1000171414 | 197 |
| 174 | 3300005445 | Ga0070708_100027203 | Ga0070708_1000272034 | 197 |
| 175 | 3300005445 | Ga0070708_100176976 | Ga0070708_1001769761 | 197 |
| 176 | 3300005445 | Ga0070708_100282098 | Ga0070708_1002820983 | 197 |
| 177 | 3300005445 | Ga0070708_100314501 | Ga0070708_1003145012 | 197 |
| 178 | 3300005445 | Ga0070708_100799411 | Ga0070708_1007994111 | 197 |
| 179 | 3300005455 | Ga0070663_100370431 | Ga0070663_1003704312 | 197 |
| 180 | 3300005456 | Ga0070678_100161653 | Ga0070678_1001616533 | 197 |
| 181 | 3300005457 | Ga0070662_100012508 | Ga0070662_1000125087 | 197 |
| 182 | 3300005457 | Ga0070662_100528737 | Ga0070662_1005287371 | 197 |
| 183 | 3300005459 | Ga0068867_100119365 | Ga0068867_1001193653 | 197 |
| 184 | 3300005466 | Ga0070685_10051369 | Ga0070685_100513694 | 197 |
| 185 | 3300005466 | Ga0070685_10113801 | Ga0070685_101138012 | 197 |
| 186 | 3300005467 | Ga0070706_100018009 | Ga0070706_1000180093 | 197 |
| 187 | 3300005467 | Ga0070706_100058332 | Ga0070706_1000583323 | 197 |
| 188 | 3300005467 | Ga0070706_100278613 | Ga0070706_1002786132 | 197 |
| 189 | 3300005468 | Ga0070707_100056695 | Ga0070707_1000566952 | 197 |
| 190 | 3300005468 | Ga0070707_100079189 | Ga0070707_1000791892 | 197 |
| 191 | 3300005468 | Ga0070707_100764714 | Ga0070707_1007647141 | 197 |
| 192 | 3300005471 | Ga0070698_100036849 | Ga0070698_1000368491 | 197 |
| 193 | 3300005471 | Ga0070698_100191364 | Ga0070698_1001913641 | 197 |
| 194 | 3300005471 | Ga0070698_100320237 | Ga0070698_1003202372 | 197 |
| 195 | 3300005471 | Ga0070698_100398353 | Ga0070698_1003983532 | 197 |
| 196 | 3300005471 | Ga0070698_100466810 | Ga0070698_1004668101 | 197 |
| 197 | 3300005518 | Ga0070699_100018519 | Ga0070699_1000185194 | 197 |
| 198 | 3300005518 | Ga0070699_100275207 | Ga0070699_1002752072 | 197 |
| 199 | 3300005518 | Ga0070699_100310483 | Ga0070699_1003104832 | 197 |
| 200 | 3300005518 | Ga0070699_100325077 | Ga0070699_1003250771 | 197 |
| 201 | 3300005536 | Ga0070697_100000671 | Ga0070697_10000067113 | 197 |
| 202 | 3300005536 | Ga0070697_100307249 | Ga0070697_1003072492 | 197 |
| 203 | 3300005536 | Ga0070697_100309684 | Ga0070697_1003096842 | 197 |
| 204 | 3300005543 | Ga0070672_100014624 | Ga0070672_1000146248 | 197 |
| 205 | 3300005544 | Ga0070686_100025014 | Ga0070686_1000250145 | 197 |
| 206 | 3300005545 | Ga0070695_100028889 | Ga0070695_1000288893 | 197 |
| 207 | 3300005545 | Ga0070695_100441696 | Ga0070695_1004416962 | 197 |
| 208 | 3300005546 | Ga0070696_100001746 | Ga0070696_10000174613 | 197 |
| 209 | 3300005547 | Ga0070693_100000070 | Ga0070693_10000007022 | 197 |
| 210 | 3300005547 | Ga0070693_100232803 | Ga0070693_1002328032 | 197 |
| 211 | 3300005547 | Ga0070693_100711867 | Ga0070693_1007118671 | 197 |
| 212 | 3300005548 | Ga0070665_100080226 | Ga0070665_1000802263 | 197 |
| 213 | 3300005548 | Ga0070665_100087755 | Ga0070665_1000877555 | 197 |
| 214 | 3300005549 | Ga0070704_100008231 | Ga0070704_1000082312 | 197 |
| 215 | 3300005549 | Ga0070704_100032382 | Ga0070704_1000323823 | 197 |
| 216 | 3300005549 | Ga0070704_100092900 | Ga0070704_1000929002 | 197 |
| 217 | 3300005563 | Ga0068855_100198264 | Ga0068855_1001982643 | 197 |
| 218 | 3300005564 | Ga0070664_100009860 | Ga0070664_1000098606 | 197 |
| 219 | 3300005578 | Ga0068854_100126729 | Ga0068854_1001267292 | 197 |
| 220 | 3300005616 | Ga0068852_100098719 | Ga0068852_1000987193 | 197 |
| 221 | 3300005617 | Ga0068859_100122762 | Ga0068859_1001227623 | 197 |
| 222 | 3300005618 | Ga0068864_100027105 | Ga0068864_1000271052 | 197 |
| 223 | 3300005618 | Ga0068864_100051750 | Ga0068864_1000517504 | 197 |
| 224 | 3300005719 | Ga0068861_100034069 | Ga0068861_1000340692 | 197 |
| 225 | 3300005719 | Ga0068861_100259317 | Ga0068861_1002593172 | 197 |
| 226 | 3300005840 | Ga0068870_10059175 | Ga0068870_100591754 | 197 |
| 227 | 3300005841 | Ga0068863_100022294 | Ga0068863_1000222943 | 197 |
| 228 | 3300005841 | Ga0068863_100023610 | Ga0068863_1000236105 | 197 |
| 229 | 3300005842 | Ga0068858_100050031 | Ga0068858_1000500314 | 197 |
| 230 | 3300005842 | Ga0068858_100255486 | Ga0068858_1002554862 | 197 |
| 231 | 3300005843 | Ga0068860_100040441 | Ga0068860_1000404412 | 197 |
| 232 | 3300005843 | Ga0068860_100081136 | Ga0068860_1000811362 | 197 |
| 233 | 3300005844 | Ga0068862_100034326 | Ga0068862_1000343262 | 197 |
| 234 | 3300005844 | Ga0068862_100613097 | Ga0068862_1006130972 | 197 |
| 235 | 3300006058 | Ga0075432_10235470 | Ga0075432_102354702 | 197 |
| 236 | 3300006173 | Ga0070716_100044001 | Ga0070716_1000440013 | 197 |
| 237 | 3300006173 | Ga0070716_100515736 | Ga0070716_1005157361 | 197 |
| 238 | 3300006237 | Ga0097621_100046359 | Ga0097621_1000463593 | 197 |
| 239 | 3300006237 | Ga0097621_100175470 | Ga0097621_1001754702 | 197 |
| 240 | 3300006237 | Ga0097621_100183018 | Ga0097621_1001830182 | 197 |
| 241 | 3300006358 | Ga0068871_100036279 | Ga0068871_1000362792 | 197 |
| 242 | 3300006358 | Ga0068871_100111125 | Ga0068871_1001111252 | 197 |
| 243 | 3300006358 | Ga0068871_100669554 | Ga0068871_1006695541 | 197 |
| 244 | 3300006846 | Ga0075430_100085770 | Ga0075430_1000857704 | 197 |
| 245 | 3300006847 | Ga0075431_100012034 | Ga0075431_1000120346 | 197 |
| 246 | 3300006847 | Ga0075431_100199173 | Ga0075431_1001991731 | 197 |
| 247 | 3300006847 | Ga0075431_100495356 | Ga0075431_1004953562 | 197 |
| 248 | 3300006852 | Ga0075433_10003209 | Ga0075433_100032091 | 197 |
| 249 | 3300006852 | Ga0075433_10005635 | Ga0075433_100056353 | 197 |
| 250 | 3300006852 | Ga0075433_10010403 | Ga0075433_100104034 | 197 |
| 251 | 3300006852 | Ga0075433_10053135 | Ga0075433_100531353 | 197 |
| 252 | 3300006871 | Ga0075434_100005888 | Ga0075434_1000058888 | 197 |
| 253 | 3300006871 | Ga0075434_100008297 | Ga0075434_10000829710 | 197 |
| 254 | 3300006871 | Ga0075434_100011260 | Ga0075434_1000112606 | 197 |
| 255 | 3300006871 | Ga0075434_100068540 | Ga0075434_1000685404 | 197 |
| 256 | 3300006871 | Ga0075434_100159391 | Ga0075434_1001593912 | 197 |
| 257 | 3300006880 | Ga0075429_100130028 | Ga0075429_1001300283 | 197 |
| 258 | 3300006880 | Ga0075429_100169059 | Ga0075429_1001690594 | 197 |
| 259 | 3300006880 | Ga0075429_100412710 | Ga0075429_1004127102 | 197 |
| 260 | 3300006880 | Ga0075429_100458888 | Ga0075429_1004588882 | 197 |
| 261 | 3300006881 | Ga0068865_100473479 | Ga0068865_1004734792 | 197 |
| 262 | 3300006881 | Ga0068865_100730515 | Ga0068865_1007305151 | 197 |
| 263 | 3300006914 | Ga0075436_100001858 | Ga0075436_1000018582 | 197 |
| 264 | 3300006914 | Ga0075436_100008889 | Ga0075436_1000088896 | 197 |
| 265 | 3300006914 | Ga0075436_100020714 | Ga0075436_1000207144 | 197 |
| 266 | 3300006914 | Ga0075436_100150723 | Ga0075436_1001507232 | 197 |
| 267 | 3300006914 | Ga0075436_100187398 | Ga0075436_1001873983 | 197 |
| 268 | 3300006914 | Ga0075436_100249948 | Ga0075436_1002499482 | 197 |
| 269 | 3300006914 | Ga0075436_100425476 | Ga0075436_1004254762 | 197 |
| 270 | 3300006931 | Ga0097620_100122761 | Ga0097620_1001227613 | 197 |
| 271 | 3300007076 | Ga0075435_100006637 | Ga0075435_1000066375 | 197 |
| 272 | 3300007076 | Ga0075435_100011923 | Ga0075435_1000119233 | 197 |
| 273 | 3300007076 | Ga0075435_100030367 | Ga0075435_1000303671 | 197 |
| 274 | 3300007076 | Ga0075435_100032642 | Ga0075435_1000326424 | 197 |
| 275 | 3300007076 | Ga0075435_100102481 | Ga0075435_1001024813 | 197 |
| 276 | 3300007076 | Ga0075435_100354719 | Ga0075435_1003547191 | 197 |
| 277 | 3300007265 | Ga0099794_10014958 | Ga0099794_100149584 | 197 |
| 278 | 3300007265 | Ga0099794_10018141 | Ga0099794_100181414 | 197 |
| 279 | 3300007265 | Ga0099794_10079020 | Ga0099794_100790201 | 197 |
| 280 | 3300009092 | Ga0105250_10168189 | Ga0105250_101681892 | 197 |
| 281 | 3300009093 | Ga0105240_10237831 | Ga0105240_102378313 | 197 |
| 282 | 3300009094 | Ga0111539_10026686 | Ga0111539_100266865 | 197 |
| 283 | 3300009094 | Ga0111539_10048302 | Ga0111539_100483025 | 197 |
| 284 | 3300009094 | Ga0111539_10151220 | Ga0111539_101512202 | 197 |
| 285 | 3300009098 | Ga0105245_10033791 | Ga0105245_100337914 | 197 |
| 286 | 3300009098 | Ga0105245_10314958 | Ga0105245_103149582 | 197 |
| 287 | 3300009101 | Ga0105247_10505343 | Ga0105247_105053431 | 197 |
| 288 | 3300009147 | Ga0114129_10028393 | Ga0114129_100283932 | 197 |
| 289 | 3300009147 | Ga0114129_10129575 | Ga0114129_101295752 | 197 |
| 290 | 3300009147 | Ga0114129_10159577 | Ga0114129_101595774 | 197 |
| 291 | 3300009147 | Ga0114129_10445707 | Ga0114129_104457071 | 197 |
| 292 | 3300009147 | Ga0114129_10872039 | Ga0114129_108720391 | 197 |
| 293 | 3300009147 | Ga0114129_10961677 | Ga0114129_109616772 | 197 |
| 294 | 3300009148 | Ga0105243_10196054 | Ga0105243_101960542 | 197 |
| 295 | 3300009174 | Ga0105241_10309912 | Ga0105241_103099121 | 197 |
| 296 | 3300009176 | Ga0105242_10249879 | Ga0105242_102498792 | 197 |
| 297 | 3300009177 | Ga0105248_10002426 | Ga0105248_1000242613 | 197 |
| 298 | 3300009177 | Ga0105248_10843108 | Ga0105248_108431082 | 197 |
| 299 | 3300009177 | Ga0105248_11370868 | Ga0105248_113708681 | 197 |
| 300 | 3300009545 | Ga0105237_10007820 | Ga0105237_100078205 | 197 |
| 301 | 3300009553 | Ga0105249_10005227 | Ga0105249_100052273 | 197 |
| 302 | 3300009553 | Ga0105249_10075534 | Ga0105249_100755342 | 197 |
| 303 | 3300009553 | Ga0105249_10284527 | Ga0105249_102845273 | 197 |
| 304 | 3300009553 | Ga0105249_10835401 | Ga0105249_108354012 | 197 |
| 305 | 3300010159 | Ga0099796_10230788 | Ga0099796_102307881 | 197 |
| 306 | 3300010375 | Ga0105239_10336328 | Ga0105239_103363282 | 197 |
| 307 | 3300013296 | Ga0157374_10183472 | Ga0157374_101834722 | 197 |
| 308 | 3300013297 | Ga0157378_10877231 | Ga0157378_108772311 | 197 |
| 309 | 3300013306 | Ga0163162_10430987 | Ga0163162_104309872 | 197 |
| 310 | 3300013306 | Ga0163162_10469701 | Ga0163162_104697011 | 197 |
| 311 | 3300013307 | Ga0157372_10548419 | Ga0157372_105484192 | 197 |
| 312 | 3300013308 | Ga0157375_10183780 | Ga0157375_101837802 | 197 |
| 313 | 3300014325 | Ga0163163_10099300 | Ga0163163_100993002 | 197 |
| 314 | 3300014326 | Ga0157380_10075881 | Ga0157380_100758813 | 197 |
| 315 | 3300014326 | Ga0157380_10188425 | Ga0157380_101884252 | 197 |
| 316 | 3300014326 | Ga0157380_10784448 | Ga0157380_107844482 | 197 |
| 317 | 3300014745 | Ga0157377_10015522 | Ga0157377_100155222 | 197 |
| 318 | 3300014968 | Ga0157379_10906062 | Ga0157379_109060622 | 197 |
| 319 | 3300014969 | Ga0157376_10031349 | Ga0157376_100313493 | 197 |
| 320 | 3300017792 | Ga0163161_10158102 | Ga0163161_101581022 | 197 |
| 321 | 3300021361 | Ga0213872_10001072 | Ga0213872_100010729 | 197 |
| 322 | 3300021384 | Ga0213876_10025743 | Ga0213876_100257433 | 197 |
| 323 | 3300024225 | Ga0224572_1010248 | Ga0224572_10102483 | 197 |
| 324 | 3300025315 | Ga0207697_10112345 | Ga0207697_101123451 | 197 |
| 325 | 3300025885 | Ga0207653_10003016 | Ga0207653_100030166 | 197 |
| 326 | 3300025893 | Ga0207682_10002915 | Ga0207682_100029156 | 197 |
| 327 | 3300025900 | Ga0207710_10095441 | Ga0207710_100954412 | 197 |
| 328 | 3300025901 | Ga0207688_10006975 | Ga0207688_100069753 | 197 |
| 329 | 3300025903 | Ga0207680_10178848 | Ga0207680_101788482 | 197 |
| 330 | 3300025907 | Ga0207645_10012718 | Ga0207645_100127185 | 197 |
| 331 | 3300025908 | Ga0207643_10022056 | Ga0207643_100220562 | 197 |
| 332 | 3300025910 | Ga0207684_10018022 | Ga0207684_100180226 | 197 |
| 333 | 3300025910 | Ga0207684_10078920 | Ga0207684_100789203 | 197 |
| 334 | 3300025913 | Ga0207695_10133539 | Ga0207695_101335391 | 197 |
| 335 | 3300025913 | Ga0207695_10315556 | Ga0207695_103155563 | 197 |
| 336 | 3300025914 | Ga0207671_10225841 | Ga0207671_102258412 | 197 |
| 337 | 3300025918 | Ga0207662_10001974 | Ga0207662_100019749 | 197 |
| 338 | 3300025920 | Ga0207649_10501458 | Ga0207649_105014581 | 197 |
| 339 | 3300025922 | Ga0207646_10000005 | Ga0207646_10000005241 | 197 |
| 340 | 3300025923 | Ga0207681_10227709 | Ga0207681_102277091 | 197 |
| 341 | 3300025923 | Ga0207681_10423728 | Ga0207681_104237282 | 197 |
| 342 | 3300025925 | Ga0207650_10003815 | Ga0207650_1000381513 | 197 |
| 343 | 3300025926 | Ga0207659_10040309 | Ga0207659_100403091 | 197 |
| 344 | 3300025927 | Ga0207687_10333530 | Ga0207687_103335302 | 197 |
| 345 | 3300025931 | Ga0207644_10122799 | Ga0207644_101227991 | 197 |
| 346 | 3300025931 | Ga0207644_10252967 | Ga0207644_102529672 | 197 |
| 347 | 3300025933 | Ga0207706_10017068 | Ga0207706_100170686 | 197 |
| 348 | 3300025933 | Ga0207706_10043603 | Ga0207706_100436033 | 197 |
| 349 | 3300025934 | Ga0207686_10401136 | Ga0207686_104011362 | 197 |
| 350 | 3300025936 | Ga0207670_10059918 | Ga0207670_100599185 | 197 |
| 351 | 3300025938 | Ga0207704_10100542 | Ga0207704_101005422 | 197 |
| 352 | 3300025938 | Ga0207704_10610291 | Ga0207704_106102911 | 197 |
| 353 | 3300025939 | Ga0207665_10008672 | Ga0207665_100086726 | 197 |
| 354 | 3300025940 | Ga0207691_10010467 | Ga0207691_100104678 | 197 |
| 355 | 3300025940 | Ga0207691_10031364 | Ga0207691_100313645 | 197 |
| 356 | 3300025941 | Ga0207711_10339351 | Ga0207711_103393511 | 197 |
| 357 | 3300025941 | Ga0207711_10596631 | Ga0207711_105966312 | 197 |
| 358 | 3300025942 | Ga0207689_10002575 | Ga0207689_1000257510 | 197 |
| 359 | 3300025945 | Ga0207679_10024682 | Ga0207679_100246822 | 197 |
| 360 | 3300025949 | Ga0207667_10155766 | Ga0207667_101557663 | 197 |
| 361 | 3300025960 | Ga0207651_10009309 | Ga0207651_100093092 | 197 |
| 362 | 3300025961 | Ga0207712_10098589 | Ga0207712_100985892 | 197 |
| 363 | 3300025961 | Ga0207712_10107147 | Ga0207712_101071472 | 197 |
| 364 | 3300025961 | Ga0207712_10619234 | Ga0207712_106192342 | 197 |
| 365 | 3300025972 | Ga0207668_10424913 | Ga0207668_104249132 | 197 |
| 366 | 3300025972 | Ga0207668_10642146 | Ga0207668_106421461 | 197 |
| 367 | 3300025972 | Ga0207668_11078641 | Ga0207668_110786411 | 197 |
| 368 | 3300025986 | Ga0207658_10947324 | Ga0207658_109473241 | 197 |
| 369 | 3300026023 | Ga0207677_10067722 | Ga0207677_100677222 | 197 |
| 370 | 3300026035 | Ga0207703_10220411 | Ga0207703_102204112 | 197 |
| 371 | 3300026067 | Ga0207678_10114023 | Ga0207678_101140233 | 197 |
| 372 | 3300026088 | Ga0207641_10009460 | Ga0207641_100094607 | 197 |
| 373 | 3300026088 | Ga0207641_10015591 | Ga0207641_100155913 | 197 |
| 374 | 3300026089 | Ga0207648_10016241 | Ga0207648_100162416 | 197 |
| 375 | 3300026095 | Ga0207676_10008185 | Ga0207676_100081853 | 197 |
| 376 | 3300026118 | Ga0207675_100031483 | Ga0207675_1000314832 | 197 |
| 377 | 3300026118 | Ga0207675_100326474 | Ga0207675_1003264742 | 197 |
| 378 | 3300026121 | Ga0207683_10078682 | Ga0207683_100786823 | 197 |
| 379 | 3300026121 | Ga0207683_10158924 | Ga0207683_101589241 | 197 |
| 380 | 3300027671 | Ga0209588_1006633 | Ga0209588_10066335 | 197 |
| 381 | 3300027671 | Ga0209588_1040120 | Ga0209588_10401202 | 197 |
| 382 | 3300027907 | Ga0207428_10013895 | Ga0207428_100138951 | 197 |
| 383 | 3300027907 | Ga0207428_10061336 | Ga0207428_100613365 | 197 |
| 384 | 3300027907 | Ga0207428_10216112 | Ga0207428_102161122 | 197 |
| 385 | 3300027907 | Ga0207428_10277567 | Ga0207428_102775671 | 197 |
| 386 | 3300027907 | Ga0207428_10624804 | Ga0207428_106248041 | 197 |
| 387 | 3300028016 | Ga0265354_1000140 | Ga0265354_10001407 | 197 |
| 388 | 3300028016 | Ga0265354_1000496 | Ga0265354_10004966 | 197 |
| 389 | 3300028023 | Ga0265357_1012037 | Ga0265357_10120371 | 197 |
| 390 | 3300028379 | Ga0268266_10070943 | Ga0268266_100709433 | 197 |
| 391 | 3300028379 | Ga0268266_10177178 | Ga0268266_101771781 | 197 |
| 392 | 3300028380 | Ga0268265_10034851 | Ga0268265_100348514 | 197 |
| 393 | 3300028380 | Ga0268265_10161262 | Ga0268265_101612622 | 197 |
| 394 | 3300028380 | Ga0268265_10413711 | Ga0268265_104137112 | 197 |
| 395 | 3300028381 | Ga0268264_10089418 | Ga0268264_100894183 | 197 |
| 396 | 3300028381 | Ga0268264_10217155 | Ga0268264_102171552 | 197 |
| 397 | 3300030878 | Ga0265770_1000351 | Ga0265770_10003515 | 197 |
| 398 | 3300031090 | Ga0265760_10001580 | Ga0265760_100015802 | 197 |
| 399 | 3300031090 | Ga0265760_10006711 | Ga0265760_100067113 | 197 |
| 400 | 3300031247 | Ga0265340_10198052 | Ga0265340_101980522 | 197 |
| 401 | 3300031344 | Ga0265316_10000902 | Ga0265316_1000090215 | 197 |
| 402 | 3300032002 | Ga0307416_100838162 | Ga0307416_1008381621 | 197 |
| 403 | 3300034818 | Ga0373950_0005575 | Ga0373950_0005575_678_1271 | 197 |
| 404 | 3300034820 | Ga0373959_0002979 | Ga0373959_0002979_481_1074 | 197 |
| 405 | 3300034957 | Ga0373938_0002531 | Ga0373938_0002531_873_1466 | 197 |
| 406 | 3300035085 | Ga0373929_0005770 | Ga0373929_0005770_40_633 | 197 |
| 407 | 3300035088 | Ga0373940_0142924 | Ga0373940_0142924_130_723 | 197 |
| 408 | 3300035090 | Ga0373949_0008488 | Ga0373949_0008488_632_1225 | 197 |
| 409 | 3300035090 | Ga0373949_0017957 | Ga0373949_0017957_806_1399 | 197 |
| 410 | 3300035091 | Ga0373951_0003102 | Ga0373951_0003102_2797_3390 | 197 |
| 411 | 3300035092 | Ga0373952_0051754 | Ga0373952_0051754_17_610 | 197 |
| 412 | 3300035112 | Ga0373932_0015060 | Ga0373932_0015060_325_918 | 197 |
| 413 | 3300035114 | Ga0373939_0003089 | Ga0373939_0003089_1919_2512 | 197 |
| 414 | 3300035114 | Ga0373939_0079737 | Ga0373939_0079737_283_876 | 197 |
| 415 | 3300035118 | Ga0373954_0009191 | Ga0373954_0009191_422_1063 | 197 |
| 416 | 3300035121 | Ga0373960_0001999 | Ga0373960_0001999_1342_1935 | 197 |
| 417 | 3300035172 | Ga0373955_0058105 | Ga0373955_0058105_478_1119 | 197 |
| 418 | 3300035207 | Ga0373942_0017342 | Ga0373942_0017342_681_1274 | 197 |
| 419 | 3300035241 | Ga0373961_0004367 | Ga0373961_0004367_2257_2850 | 197 |
| 420 | 3300035242 | Ga0373962_0024027 | Ga0373962_0024027_313_906 | 197 |
| 421 | 3300035242 | Ga0373962_0033932 | Ga0373962_0033932_124_717 | 197 |
| 422 | 3300035691 | Ga0373931_0012497 | Ga0373931_0012497_2753_3346 | 197 |
| 423 | 3300035695 | Ga0373927_0054205 | Ga0373927_0054205_996_1628 | 197 |
| 424 | 3300035695 | Ga0373927_0251937 | Ga0373927_0251937_324_965 | 197 |
| 425 | 3300036401 | Ga0373937_0045218 | Ga0373937_0045218_1944_2585 | 197 |
| 426 | 3300039437 | Ga0436365_1505847 | Ga0436365_1505847_4763_5428 | 197 |
| 427 | 3300045051 | Ga0451576_0039792 | Ga0451576_0039792_1820_2413 | 197 |
| 428 | 3300046454 | Ga0495592_0007872 | Ga0495592_0007872_6352_6987 | 197 |
| 429 | 3300046462 | Ga0495651_0002472 | Ga0495651_0002472_5434_6069 | 197 |
| 430 | 3300046463 | Ga0495653_0011358 | Ga0495653_0011358_1172_1807 | 197 |
| 431 | 3300046472 | Ga0495580_0035396 | Ga0495580_0035396_1828_2475 | 197 |
| 432 | 3300046472 | Ga0495580_0082018 | Ga0495580_0082018_1614_2210 | 197 |
| 433 | 3300046477 | Ga0495664_0051732 | Ga0495664_0051732_190_825 | 197 |
| 434 | 3300046511 | Ga0495608_0014065 | Ga0495608_0014065_183_818 | 197 |
| 435 | 3300046514 | Ga0495618_0010301 | Ga0495618_0010301_733_1368 | 197 |
| 436 | 3300046516 | Ga0495628_0001354 | Ga0495628_0001354_11077_11712 | 197 |
| 437 | 3300046517 | Ga0495630_0071980 | Ga0495630_0071980_643_1287 | 197 |
| 438 | 3300046517 | Ga0495630_0084527 | Ga0495630_0084527_885_1520 | 197 |
| 439 | 3300046529 | Ga0495652_0001829 | Ga0495652_0001829_7689_8324 | 197 |
| 440 | 3300046533 | Ga0495640_0337696 | Ga0495640_0337696_120_755 | 197 |
| 441 | 3300046535 | Ga0495586_0171988 | Ga0495586_0171988_430_1077 | 197 |
| 442 | 3300046543 | Ga0495645_0073318 | Ga0495645_0073318_1169_1804 | 197 |
| 443 | 3300046559 | Ga0495667_0002946 | Ga0495667_0002946_3399_4034 | 197 |
| 444 | 3300046663 | Ga0495635_0055686 | Ga0495635_0055686_1986_2621 | 197 |
| 445 | 3300046664 | Ga0495659_0007350 | Ga0495659_0007350_307_900 | 197 |
| 446 | 3300046679 | Ga0495623_0086957 | Ga0495623_0086957_93_728 | 197 |
| 447 | 3300046809 | Ga0495600_0001463 | Ga0495600_0001463_4212_4847 | 197 |
| 448 | 3300047317 | Ga0495604_0016106 | Ga0495604_0016106_4328_4963 | 197 |
| 449 | 3300047317 | Ga0495604_0524681 | Ga0495604_0524681_18_662 | 197 |
| 450 | 3300047319 | Ga0495674_0023499 | Ga0495674_0023499_2276_2911 | 197 |
| 451 | 3300047319 | Ga0495674_0048005 | Ga0495674_0048005_1095_1739 | 197 |
| 452 | 3300047319 | Ga0495674_0141358 | Ga0495674_0141358_941_1582 | 197 |
| 453 | 3300047322 | Ga0495680_0001532 | Ga0495680_0001532_23193_23828 | 197 |
| 454 | 3300047444 | Ga0495675_0000366 | Ga0495675_0000366_7390_8025 | 197 |
| 455 | 3300047444 | Ga0495675_0020005 | Ga0495675_0020005_3141_3785 | 197 |
| 456 | 3300047471 | Ga0495684_0026100 | Ga0495684_0026100_3317_3952 | 197 |
| 457 | 3300048905 | Ga0496102_0040957 | Ga0496102_0040957_2586_3182 | 197 |
| 458 | 3300048905 | Ga0496102_0759918 | Ga0496102_0759918_231_824 | 197 |
| 459 | 3300048907 | Ga0496104_0007618 | Ga0496104_0007618_729_1325 | 197 |
| 460 | 3300048909 | Ga0496106_0169666 | Ga0496106_0169666_485_1081 | 197 |
| 461 | 3300048909 | Ga0496106_0221528 | Ga0496106_0221528_194_787 | 197 |
| 462 | 3300048911 | Ga0496108_0002260 | Ga0496108_0002260_7313_7909 | 197 |
| 463 | 3300048912 | Ga0496109_0017369 | Ga0496109_0017369_373_969 | 197 |
| 464 | 3300048912 | Ga0496109_0121658 | Ga0496109_0121658_930_1523 | 197 |
| 465 | 3300048913 | Ga0496110_0001014 | Ga0496110_0001014_10147_10743 | 197 |
| 466 | 3300048915 | Ga0496112_0008799 | Ga0496112_0008799_7743_8339 | 197 |
| 467 | 3300048916 | Ga0496113_0000999 | Ga0496113_0000999_11243_11839 | 197 |
| 468 | 3300049571 | Ga0501034_0209699 | Ga0501034_0209699_251_853 | 197 |
| 469 | 3300050507 | nmdc:mga05p37_104709_c1 | nmdc:mga05p37_104709_c1_302_895 | 197 |
| 470 | 3300050507 | nmdc:mga05p37_187676_c1 | nmdc:mga05p37_187676_c1_1151_1744 | 197 |
| 471 | 3300050507 | nmdc:mga05p37_25306_c1 | nmdc:mga05p37_25306_c1_2017_2610 | 197 |
| 472 | 3300050507 | nmdc:mga05p37_62132_c1 | nmdc:mga05p37_62132_c1_2558_3151 | 197 |
| 473 | 3300050508 | nmdc:mga09592_71066_c1 | nmdc:mga09592_71066_c1_770_1363 | 197 |
| 474 | 3300050508 | nmdc:mga09592_798209_c1 | nmdc:mga09592_798209_c1_148_741 | 197 |
| 475 | 3300050509 | nmdc:mga0qj67_121163_c1 | nmdc:mga0qj67_121163_c1_1032_1625 | 197 |
| 476 | 3300050509 | nmdc:mga0qj67_150082_c1 | nmdc:mga0qj67_150082_c1_26_619 | 197 |
| 477 | 3300050510 | nmdc:mga06r32_141118_c1 | nmdc:mga06r32_141118_c1_1011_1604 | 197 |
| 478 | 3300050510 | nmdc:mga06r32_18928_c1 | nmdc:mga06r32_18928_c1_1361_1954 | 197 |
| 479 | 3300050510 | nmdc:mga06r32_565810_c1 | nmdc:mga06r32_565810_c1_343_936 | 197 |
| 480 | 3300050511 | nmdc:mga08y16_47922_c1 | nmdc:mga08y16_47922_c1_2034_2627 | 197 |
| 481 | 3300050511 | nmdc:mga08y16_61190_c1 | nmdc:mga08y16_61190_c1_113_706 | 197 |
| 482 | 3300050512 | nmdc:mga0n895_115046_c1 | nmdc:mga0n895_115046_c1_1128_1721 | 197 |
| 483 | 3300050512 | nmdc:mga0n895_117847_c1 | nmdc:mga0n895_117847_c1_1366_1959 | 197 |
| 484 | 3300050512 | nmdc:mga0n895_157724_c1 | nmdc:mga0n895_157724_c1_234_833 | 197 |
| 485 | 3300050512 | nmdc:mga0n895_47526_c1 | nmdc:mga0n895_47526_c1_1053_1646 | 197 |
| 486 | 3300050512 | nmdc:mga0n895_98159_c1 | nmdc:mga0n895_98159_c1_2070_2663 | 197 |
| 487 | 3300050513 | nmdc:mga0rr50_105075_c1 | nmdc:mga0rr50_105075_c1_121_714 | 197 |
| 488 | 3300050513 | nmdc:mga0rr50_14521_c1 | nmdc:mga0rr50_14521_c1_2496_3089 | 197 |
| 489 | 3300050513 | nmdc:mga0rr50_23827_c1 | nmdc:mga0rr50_23827_c1_3580_4206 | 197 |
| 490 | 3300050513 | nmdc:mga0rr50_58211_c1 | nmdc:mga0rr50_58211_c1_44_637 | 197 |
| 491 | 3300050513 | nmdc:mga0rr50_66888_c1 | nmdc:mga0rr50_66888_c1_2069_2662 | 197 |
| 492 | 3300050513 | nmdc:mga0rr50_93016_c1 | nmdc:mga0rr50_93016_c1_987_1586 | 197 |
| 493 | 3300050513 | nmdc:mga0rr50_97855_c1 | nmdc:mga0rr50_97855_c1_1565_2158 | 197 |
| 494 | 3300050514 | nmdc:mga08x19_113439_c1 | nmdc:mga08x19_113439_c1_1170_1763 | 197 |
| 495 | 3300050514 | nmdc:mga08x19_11576_c1 | nmdc:mga08x19_11576_c1_3526_4152 | 197 |
| 496 | 3300050514 | nmdc:mga08x19_1552_c1 | nmdc:mga08x19_1552_c1_7428_8060 | 197 |
| 497 | 3300050514 | nmdc:mga08x19_161072_c1 | nmdc:mga08x19_161072_c1_825_1418 | 197 |
| 498 | 3300050514 | nmdc:mga08x19_174587_c1 | nmdc:mga08x19_174587_c1_283_876 | 197 |
| 499 | 3300050514 | nmdc:mga08x19_421967_c1 | nmdc:mga08x19_421967_c1_264_857 | 197 |
| 500 | 3300050514 | nmdc:mga08x19_42410_c1 | nmdc:mga08x19_42410_c1_389_982 | 197 |
| 501 | 3300050514 | nmdc:mga08x19_72084_c1 | nmdc:mga08x19_72084_c1_955_1548 | 197 |
| 502 | 3300050514 | nmdc:mga08x19_89009_c1 | nmdc:mga08x19_89009_c1_449_1042 | 197 |
| 503 | 3300050515 | nmdc:mga0a205_161_c1 | nmdc:mga0a205_161_c1_10037_10630 | 197 |
| 504 | 3300050515 | nmdc:mga0a205_341270_c1 | nmdc:mga0a205_341270_c1_12_605 | 197 |
| 505 | 3300050515 | nmdc:mga0a205_39439_c1 | nmdc:mga0a205_39439_c1_3700_4293 | 197 |
| 506 | 3300050515 | nmdc:mga0a205_42795_c1 | nmdc:mga0a205_42795_c1_2506_3099 | 197 |
| 507 | 3300050515 | nmdc:mga0a205_47188_c1 | nmdc:mga0a205_47188_c1_75_674 | 197 |
| 508 | 3300053085 | Ga0495619_0293266 | Ga0495619_0293266_82_717 | 197 |
| 509 | 3300060346 | Ga0587111_0006492 | Ga0587111_0006492_249_845 | 197 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lkp-assembly1.cif.gz_F-2 | crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 | 0.9332 | 36 | 191 |
| 8ff9-assembly1.cif.gz_B | crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) | 0.9244 | 37 | 186 |
| 2bjy-assembly1.cif.gz_L | the x-ray crystal structure of listeria innocua dps h31g-h43g mutant. | 0.9243 | 47 | 183 |
| 2bkc-assembly1.cif.gz_A | the x-ray structure of the h43g listeria innocua dps mutant | 0.9232 | 47 | 183 |
| 2bkc-assembly1.cif.gz_H | the x-ray structure of the h43g listeria innocua dps mutant | 0.9221 | 47 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c41C01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9266 | 42 | 186 | 1.20.1260.10 |
| 1qghA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9201 | 47 | 183 | 1.20.1260.10 |
| 6hv1D00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9187 | 47 | 186 | 1.20.1260.10 |
| 1mojA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9178 | 42 | 196 | 1.20.1260.10 |
| 2bk6C00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9178 | 47 | 186 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U7EUU8-F1-model_v4 | DNA starvation/stationary phase protection protein | 0.9544 | 39 | 186 |
GO:0008199
|
| AF-A0A537Z9P4-F1-model_v4 | DNA starvation/stationary phase protection protein | 0.9402 | 37 | 195 |
GO:0008199
GO:0016722 |
| AF-A0A395JLR1-F1-model_v4 | Starvation-inducible DNA-binding protein | 0.9387 | 37 | 186 |
GO:0003677
GO:0008199 GO:0016722 |
| AF-I0W7Q8-F1-model_v4 | Ferritin Dps family protein | 0.9377 | 33 | 190 |
GO:0008199
|
| AF-A0A660MWD4-F1-model_v4 | DNA starvation/stationary phase protection protein | 0.9375 | 44 | 186 |
GO:0008199
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar