metagRoot

F456978

General Info

Members	Datasets	Scaffolds	Average Seq Length
509	294	481	346

Family's Representative Sequence

Representative Sequence	3300010375\|Ga0105239_10124000\|Ga0105239_101240002
Length	396
Sequence	MASSSPNGHLGAEVRVNRALSSISARAAELQRTATLSRVAPVTYNWLMKAAVYHGPNKVEIADVPEPTXXXGTVKLKVGFNGICGTDLHEYYAGPIFVPTEPHPLTHRQMPLVMGHEFAGVITDVGDGVTGWNEGDRVAVEPIYKCGHCAPCRAGTYNICQQIGFHGLMSDGGMAEYTVVPTTMLHKLPANVSLQLGALVEPMSVAYHAATLGDAKAGDTAVVFGAGPIGIGLWFALRGKGIDDVFVVEPSATRRAAIEALGAGTLDPTDVDVPAFIADHTDRRGADAVFDAAGVAPAVETALGCVGHRRPMVSVAIYERPLTTPLLNLVMNESRIQGSLCYTADDFEAVIALMARDAYDTSGWVTSIALGDVIEEGFEALHGGTKMKVLVDPAAA

Samples

	Sample ID	Description	Type	Environment
1	2523231044	Gordonia rhizosphera NBRC 16068	Isolate	Rhizosphere
2	2523533628	Maridesulfovibrio zosterae DSM 11974	Isolate	Rhizosphere
3	2582581313	Streptomyces mirabilis OV308	Isolate	Rhizosphere
4	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
5	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
6	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
7	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
8	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
9	2738543034	Rhodococcus sp. OK269	Isolate	Unclassified
10	2739367898	Nocardioides sp. CF479	Isolate	Unclassified
11	2751185725	Microbispora sp. NRRL B-24597	Isolate	Unclassified
12	2751185792	Kitasatospora arboriphila NRRL B-24581	Isolate	Unclassified
13	2863067949	Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2)	Isolate	Rhizosphere
14	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
15	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
16	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
17	2904765812	Rhodococcus fascians 1590	Isolate	Rhizosphere
18	2904770941	Rhodococcus fascians 1339	Isolate	Rhizosphere
19	2908811453	Rhodococcus sp. 1R11	Isolate	Unclassified
20	2919420072	Rhodococcus fascians 3241	Isolate	Rhizosphere
21	2919432681	Rhodococcus sp. 3258	Isolate	Rhizosphere
22	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
23	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
24	2974315732	Rhodococcus sp. SORGH_AS 301	Isolate	Unclassified
25	2984523437	Rhodococcus sp. SORGH_AS303	Isolate	Aerial Root
26	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
27	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
28	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
29	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
30	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
31	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
32	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
33	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
34	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
35	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
36	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
37	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
38	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
39	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
40	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
41	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
42	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
43	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
44	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
45	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
46	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
47	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
48	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
49	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
50	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
51	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
52	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
53	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
54	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
55	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
56	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
57	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
58	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
59	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
60	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
61	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
62	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
63	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
64	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
65	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
66	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
67	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
68	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
69	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
70	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
71	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
72	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
73	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
74	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
75	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
76	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
77	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
78	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
79	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
80	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
81	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
82	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
83	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
84	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
85	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
86	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
87	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
88	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
89	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
91	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
92	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
93	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
94	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
95	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
96	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
97	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
98	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
99	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
100	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
101	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
102	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
103	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
104	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
105	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
106	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
107	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
108	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
109	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
110	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
111	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
112	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
113	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
151	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
152	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
156	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
157	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
158	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
159	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
160	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
161	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
162	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
163	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
164	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
165	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
166	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
167	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
168	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
169	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
170	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
171	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
172	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
173	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
174	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
175	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
176	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
177	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
178	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
179	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
180	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
181	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
182	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
183	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
184	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
185	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
186	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
187	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
188	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
189	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
190	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
191	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
192	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
193	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
194	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
195	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
196	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
197	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
198	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
199	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
200	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
201	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
202	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
203	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
204	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
205	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
206	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
207	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
208	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
209	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
210	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
211	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
212	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
213	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
214	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
215	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
216	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
217	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
218	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
219	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
220	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
221	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
222	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
223	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
224	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
225	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
226	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
227	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
228	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
229	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
230	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
231	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
232	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
233	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
234	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
235	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
236	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
237	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
238	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
239	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
240	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
241	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
242	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
243	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
244	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
245	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
246	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
247	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
248	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
249	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
250	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
251	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
252	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
253	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
254	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
255	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
256	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
257	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
258	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
259	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
260	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
261	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
262	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
263	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
264	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
265	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
266	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
267	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
268	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
269	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
270	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
271	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
272	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
273	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
274	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
275	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
276	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
277	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
278	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
279	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
280	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
281	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
282	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
283	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
284	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
285	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
286	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
287	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
288	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
289	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
290	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
291	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
292	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
293	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
294	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.5
Metatranscriptomes	0
Isolates	5.5

Biome Distribution

Category	Percentage (%)
Aerial Root	0.2
Bulb	0
Endosphere	12.97
Nodule	0
Rhizoplane	11.2
Rhizosphere	61.3
Stem	0
Stem Tuber	0
Unclassified	14.34

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1003839	3300001977	Bacteria	2375
2	JGI24749J21850_1005537	3300002076	Bacteria	1768
3	JGI24744J21845_10001068	3300002077	Bacteria	5301
4	JGI24742J22300_10001534	3300002244	Bacteria	3660
5	Ga0055540_1000068	3300003792	Bacteria	120413
6	Ga0055540_1016337	3300003792	Bacteria	2116
7	Ga0070676_10007007	3300005328	Bacteria	6036
8	Ga0070676_10085332	3300005328	Bacteria	1924
9	Ga0070690_100008960	3300005330	Bacteria	5783
10	Ga0068869_100007294	3300005334	Bacteria	7047
11	Ga0070666_10074436	3300005335	Bacteria	2315
12	Ga0070682_100019626	3300005337	Bacteria	3967
13	Ga0070682_100152612	3300005337	Bacteria	1587
14	Ga0068868_100003553	3300005338	Bacteria	10865
15	Ga0068868_100242251	3300005338	Bacteria	1515
16	Ga0070691_10000606	3300005341	Bacteria	13759
17	Ga0070692_10038140	3300005345	Bacteria	2447
18	Ga0070668_100012850	3300005347	Bacteria	6233
19	Ga0070668_100104124	3300005347	Bacteria	2252
20	Ga0070669_100000503	3300005353	Bacteria	29454
21	Ga0070669_100020740	3300005353	Bacteria	4694
22	Ga0070671_100002964	3300005355	Bacteria	13208
23	Ga0070671_100013078	3300005355	Bacteria	6687
24	Ga0070674_100254906	3300005356	Bacteria	1380
25	Ga0070673_100088131	3300005364	Bacteria	2531
26	Ga0070688_100027402	3300005365	Bacteria	3394
27	Ga0070659_100138280	3300005366	Bacteria	1982
28	Ga0070659_100297102	3300005366	Bacteria	1346
29	Ga0070667_100000054	3300005367	Bacteria	151864
30	Ga0070667_100001437	3300005367	Bacteria	21368
31	Ga0070667_100021474	3300005367	Bacteria	5359
32	Ga0070667_100024556	3300005367	Bacteria	5007
33	Ga0070667_100304036	3300005367	Bacteria	1436
34	Ga0070710_10017350	3300005437	Bacteria	3682
35	Ga0070701_10001511	3300005438	Bacteria	8622
36	Ga0070711_100001990	3300005439	Bacteria	11483
37	Ga0070711_100009797	3300005439	Bacteria	5909
38	Ga0070705_100002411	3300005440	Bacteria	9407
39	Ga0070700_100003675	3300005441	Bacteria	7934
40	Ga0070694_100017533	3300005444	Bacteria	4526
41	Ga0070663_100048129	3300005455	Bacteria	3022
42	Ga0070663_100212057	3300005455	Bacteria	1517
43	Ga0070678_100006149	3300005456	Bacteria	7013
44	Ga0070678_100307991	3300005456	Bacteria	1348
45	Ga0070678_100325404	3300005456	Bacteria	1314
46	Ga0070662_100013815	3300005457	Bacteria	5379
47	Ga0070662_100151941	3300005457	Bacteria	1803
48	Ga0070681_10325048	3300005458	Bacteria	1448
49	Ga0068867_100015703	3300005459	Bacteria	5373
50	Ga0068867_100125505	3300005459	Bacteria	1989
51	Ga0068867_100268931	3300005459	Bacteria	1393
52	Ga0070685_10029438	3300005466	Bacteria	3051
53	Ga0068853_100038797	3300005539	Bacteria	4058
54	Ga0068853_100054720	3300005539	Bacteria	3440
55	Ga0070696_100001219	3300005546	Bacteria	16713
56	Ga0070696_100192493	3300005546	Bacteria	1518
57	Ga0070693_100004864	3300005547	Bacteria	6411
58	Ga0070665_100002478	3300005548	Bacteria	20335
59	Ga0070665_100075359	3300005548	Bacteria	3381
60	Ga0070665_100335127	3300005548	Bacteria	1517
61	Ga0070704_100000691	3300005549	Bacteria	16364
62	Ga0070704_100019162	3300005549	Bacteria	4392
63	Ga0068855_100067121	3300005563	Bacteria	4180
64	Ga0068854_100000413	3300005578	Bacteria	26804
65	Ga0068854_100109164	3300005578	Bacteria	2085
66	Ga0068852_100054833	3300005616	Bacteria	3438
67	Ga0068859_100001074	3300005617	Bacteria	27981
68	Ga0068859_100007370	3300005617	Bacteria	11161
69	Ga0068866_10001212	3300005718	Bacteria	11217
70	Ga0068866_10147198	3300005718	Bacteria	1359
71	Ga0068861_100003002	3300005719	Bacteria	11135
72	Ga0068861_100040694	3300005719	Bacteria	3477
73	Ga0068863_100002763	3300005841	Bacteria	17382
74	Ga0068863_100004887	3300005841	Bacteria	13207
75	Ga0068858_100002996	3300005842	Bacteria	16933
76	Ga0068858_100004217	3300005842	Bacteria	14157
77	Ga0068858_100017962	3300005842	Bacteria	6624
78	Ga0068860_100000246	3300005843	Bacteria	81869
79	Ga0068860_100022649	3300005843	Bacteria	6073
80	Ga0068862_100000024	3300005844	Bacteria	197686
81	Ga0068862_100022779	3300005844	Bacteria	5241
82	Ga0068862_100394496	3300005844	Bacteria	1293
83	Ga0081455_10037120	3300005937	Bacteria	4331
84	Ga0075365_10011580	3300006038	Bacteria	5193
85	Ga0075365_10014157	3300006038	Bacteria	4792
86	Ga0075365_10045050	3300006038	Bacteria	2892
87	Ga0075365_10063760	3300006038	Bacteria	2467
88	Ga0075368_10002034	3300006042	Bacteria	6541
89	Ga0075363_100026004	3300006048	Bacteria	2991
90	Ga0075363_100027264	3300006048	Bacteria	2928
91	Ga0075363_100097088	3300006048	Bacteria	1628
92	Ga0075363_100114220	3300006048	Bacteria	1503
93	Ga0075364_10017028	3300006051	Bacteria	4532
94	Ga0075364_10031561	3300006051	Bacteria	3403
95	Ga0075364_10138336	3300006051	Bacteria	1637
96	Ga0075364_10141757	3300006051	Bacteria	1617
97	Ga0075432_10001344	3300006058	Bacteria	7968
98	Ga0070716_100059838	3300006173	Bacteria	2197
99	Ga0070712_100002423	3300006175	Bacteria	11488
100	Ga0075367_10004354	3300006178	Bacteria	6900
101	Ga0075369_10006568	3300006186	Bacteria	4402
102	Ga0075369_10007235	3300006186	Bacteria	4220
103	Ga0075369_10027888	3300006186	Bacteria	2363
104	Ga0075369_10054908	3300006186	Bacteria	1730
105	Ga0075369_10066981	3300006186	Bacteria	1576
106	Ga0075369_10104123	3300006186	Bacteria	1275
107	Ga0075370_10022583	3300006353	Bacteria	3456
108	Ga0075370_10024122	3300006353	Bacteria	3357
109	Ga0068871_100056348	3300006358	Bacteria	3195
110	Ga0075430_100214444	3300006846	Bacteria	1597
111	Ga0075431_100025593	3300006847	Bacteria	6049
112	Ga0075434_100187253	3300006871	Bacteria	2090
113	Ga0097620_100001074	3300006931	Bacteria	27981
114	Ga0097620_100007370	3300006931	Bacteria	11161
115	Ga0111539_10390212	3300009094	Bacteria	1621
116	Ga0105245_10006444	3300009098	Bacteria	10333
117	Ga0105245_10026782	3300009098	Bacteria	5076
118	Ga0105245_10118800	3300009098	Bacteria	2467
119	Ga0105245_10136554	3300009098	Bacteria	2305
120	Ga0105245_10322590	3300009098	Bacteria	1522
121	Ga0105247_10000073	3300009101	Bacteria	113714
122	Ga0105247_10000520	3300009101	Bacteria	31535
123	Ga0105247_10037744	3300009101	Bacteria	2947
124	Ga0105243_10005167	3300009148	Bacteria	10223
125	Ga0105241_10056118	3300009174	Bacteria	3019
126	Ga0105242_10001241	3300009176	Bacteria	20079
127	Ga0105242_10260393	3300009176	Bacteria	1567
128	Ga0105248_10000088	3300009177	Bacteria	103505
129	Ga0105248_10009464	3300009177	Bacteria	10724
130	Ga0105237_10000368	3300009545	Bacteria	63943
131	Ga0105237_10074131	3300009545	Bacteria	3395
132	Ga0105238_10246254	3300009551	Bacteria	1765
133	Ga0105249_10000126	3300009553	Bacteria	103461
134	Ga0105249_10003731	3300009553	Bacteria	13142
135	Ga0105239_10046949	3300010375	Bacteria	4731
136	Ga0105239_10050950	3300010375	Bacteria	4540
137	Ga0105239_10124000	3300010375	Bacteria	2870
138	Ga0105239_10273826	3300010375	Bacteria	1899
139	Ga0105239_10360976	3300010375	Bacteria	1641
140	Ga0105246_10211541	3300011119	Bacteria	1514
141	Ga0105246_10217789	3300011119	Bacteria	1494
142	Ga0157374_10011714	3300013296	Bacteria	7607
143	Ga0157374_10186588	3300013296	Bacteria	2028
144	Ga0157374_10320492	3300013296	Bacteria	1536
145	Ga0157378_10019202	3300013297	Bacteria	6007
146	Ga0163162_10032481	3300013306	Bacteria	5186
147	Ga0163162_10095192	3300013306	Bacteria	3064
148	Ga0163162_10116209	3300013306	Bacteria	2776
149	Ga0157372_10021280	3300013307	Bacteria	7005
150	Ga0157372_10336822	3300013307	Bacteria	1757
151	Ga0157375_10007867	3300013308	Bacteria	9329
152	Ga0163163_10012797	3300014325	Bacteria	7655
153	Ga0163163_10025143	3300014325	Bacteria	5675
154	Ga0157380_10007954	3300014326	Bacteria	7551
155	Ga0157380_10396338	3300014326	Bacteria	1308
156	Ga0157377_10073276	3300014745	Bacteria	1984
157	Ga0157379_10037011	3300014968	Bacteria	4350
158	Ga0157379_10050497	3300014968	Bacteria	3713
159	Ga0163161_10191087	3300017792	Bacteria	1574
160	Ga0213875_10002664	3300021388	Bacteria	10538
161	Ga0209051_1000057	3300025303	Bacteria	263902
162	Ga0209051_1000404	3300025303	Bacteria	59919
163	Ga0209051_1014595	3300025303	Bacteria	3656
164	Ga0209051_1014614	3300025303	Bacteria	3652
165	Ga0207682_10080170	3300025893	Bacteria	1398
166	Ga0207692_10017422	3300025898	Bacteria	3204
167	Ga0207710_10000099	3300025900	Bacteria	113735
168	Ga0207710_10002553	3300025900	Bacteria	8413
169	Ga0207688_10000416	3300025901	Bacteria	20015
170	Ga0207688_10009651	3300025901	Bacteria	5254
171	Ga0207688_10023928	3300025901	Bacteria	3348
172	Ga0207688_10108739	3300025901	Bacteria	1608
173	Ga0207680_10153528	3300025903	Bacteria	1537
174	Ga0207647_10014956	3300025904	Bacteria	5333
175	Ga0207685_10010518	3300025905	Bacteria	2737
176	Ga0207645_10011321	3300025907	Bacteria	6096
177	Ga0207654_10049334	3300025911	Bacteria	2414
178	Ga0207671_10061437	3300025914	Bacteria	2788
179	Ga0207693_10000816	3300025915	Bacteria	27785
180	Ga0207693_10008551	3300025915	Bacteria	8377
181	Ga0207663_10122057	3300025916	Bacteria	1786
182	Ga0207652_10106566	3300025921	Bacteria	2481
183	Ga0207681_10006507	3300025923	Bacteria	7172
184	Ga0207681_10012104	3300025923	Bacteria	5316
185	Ga0207687_10018224	3300025927	Bacteria	4631
186	Ga0207687_10074937	3300025927	Bacteria	2427
187	Ga0207644_10001907	3300025931	Bacteria	13520
188	Ga0207644_10112864	3300025931	Bacteria	2057
189	Ga0207690_10083960	3300025932	Bacteria	2231
190	Ga0207690_10120219	3300025932	Bacteria	1907
191	Ga0207686_10039603	3300025934	Bacteria	2860
192	Ga0207669_10004231	3300025937	Bacteria	6294
193	Ga0207704_10002242	3300025938	Bacteria	8675
194	Ga0207665_10021473	3300025939	Bacteria	4245
195	Ga0207711_10000386	3300025941	Bacteria	46700
196	Ga0207711_10027575	3300025941	Bacteria	4772
197	Ga0207689_10015678	3300025942	Bacteria	6417
198	Ga0207712_10000093	3300025961	Bacteria	103470
199	Ga0207712_10019125	3300025961	Bacteria	4469
200	Ga0207668_10033537	3300025972	Bacteria	3401
201	Ga0207658_10000096	3300025986	Bacteria	98147
202	Ga0207658_10002536	3300025986	Bacteria	13288
203	Ga0207658_10013742	3300025986	Bacteria	5539
204	Ga0207658_10025566	3300025986	Bacteria	4134
205	Ga0207703_10003513	3300026035	Bacteria	13110
206	Ga0207703_10011694	3300026035	Bacteria	6827
207	Ga0207639_10051201	3300026041	Bacteria	3140
208	Ga0207678_10012320	3300026067	Bacteria	7509
209	Ga0207708_10010638	3300026075	Bacteria	6833
210	Ga0207641_10000164	3300026088	Bacteria	93616
211	Ga0207641_10002894	3300026088	Bacteria	15534
212	Ga0207648_10001409	3300026089	Bacteria	26469
213	Ga0207648_10029726	3300026089	Bacteria	4845
214	Ga0207674_10025021	3300026116	Bacteria	6372
215	Ga0207675_100007311	3300026118	Bacteria	10442
216	Ga0207675_100013271	3300026118	Bacteria	7691
217	Ga0207683_10001091	3300026121	Bacteria	24695
218	Ga0207683_10002701	3300026121	Bacteria	15496
219	Ga0207683_10294161	3300026121	Bacteria	1485
220	Ga0207698_10042433	3300026142	Bacteria	3398
221	Ga0209813_10003565	3300027866	Bacteria	3650
222	Ga0207428_10163516	3300027907	Bacteria	1689
223	Ga0268266_10072156	3300028379	Bacteria	2993
224	Ga0268265_10000012	3300028380	Bacteria	343132
225	Ga0268265_10078383	3300028380	Bacteria	2598
226	Ga0268264_10000104	3300028381	Bacteria	217837
227	Ga0268264_10004594	3300028381	Bacteria	11733
228	Ga0268264_10239860	3300028381	Bacteria	1679
229	Ga0307517_10001261	3300028786	Bacteria	42531
230	Ga0307515_10002359	3300028794	Bacteria	41195
231	Ga0307515_10020750	3300028794	Bacteria	11696
232	Ga0307515_10116691	3300028794	Bacteria	3063
233	Ga0307515_10173148	3300028794	Bacteria	2141
234	Ga0307512_10004382	3300030522	Bacteria	15532
235	Ga0265340_10024228	3300031247	Bacteria	3085
236	Ga0265339_10051007	3300031249	Unclassified	2260
237	Ga0265339_10110573	3300031249	Bacteria	1422
238	Ga0265327_10000336	3300031251	Bacteria	89407
239	Ga0307513_10036877	3300031456	Bacteria	5446
240	Ga0307513_10074389	3300031456	Bacteria	3533
241	Ga0307513_10151923	3300031456	Bacteria	2222
242	Ga0307509_10005713	3300031507	Bacteria	17145
243	Ga0307509_10006251	3300031507	Bacteria	16096
244	Ga0307408_100136271	3300031548	Bacteria	1921
245	Ga0307508_10008064	3300031616	Bacteria	9766
246	Ga0307514_10001238	3300031649	Bacteria	33583
247	Ga0307514_10010214	3300031649	Bacteria	7858
248	Ga0307516_10000216	3300031730	Bacteria	74437
249	Ga0307516_10009345	3300031730	Bacteria	10946
250	Ga0307516_10009403	3300031730	Bacteria	10905
251	Ga0307518_10001367	3300031838	Bacteria	18139
252	Ga0307406_10056812	3300031901	Bacteria	2508
253	Ga0307409_100437508	3300031995	Bacteria	1259
254	Ga0307416_100361659	3300032002	Bacteria	1474
255	Ga0307507_10013071	3300033179	Bacteria	10150
256	Ga0307507_10035631	3300033179	Bacteria	5107
257	Ga0307510_10040252	3300033180	Bacteria	5134
258	Ga0307510_10085717	3300033180	Bacteria	3025
259	Ga0373932_0052652	3300035112	Bacteria	1213
260	Ga0373954_0061275	3300035118	Bacteria	1776
261	Ga0373956_0102610	3300035119	Bacteria	1328
262	Ga0373931_0004239	3300035691	Bacteria	6524
263	Ga0373933_0043324	3300035724	Bacteria	2663
264	Ga0373925_0002117	3300037068	Bacteria	16275
265	Ga0373925_0040477	3300037068	Bacteria	3450
266	Ga0436364_0737248	3300037853	Bacteria	154680
267	Ga0439466_0012306	3300041411	Bacteria	3154
268	Ga0439466_0024210	3300041411	Bacteria	2131
269	Ga0439465_0001019	3300041413	Bacteria	8912
270	Ga0439431_0002584	3300041997	Bacteria	3999
271	Ga0439445_0001380	3300042004	Bacteria	5261
272	Ga0466972_0006601	3300044658	Bacteria	5828
273	Ga0466972_0030271	3300044658	Bacteria	2664
274	Ga0466965_0003465	3300044683	Bacteria	6921
275	Ga0466965_0008269	3300044683	Bacteria	4808
276	Ga0453684_0003501	3300044712	Bacteria	35245
277	Ga0453684_0307617	3300044712	Bacteria	1800
278	Ga0466968_0002311	3300044735	Bacteria	6969
279	Ga0466970_0155451	3300044765	Bacteria	1264
280	Ga0466957_0006527	3300044842	Bacteria	6587
281	Ga0466960_0007340	3300044901	Bacteria	4473
282	Ga0466960_0008407	3300044901	Bacteria	4226
283	Ga0466959_0083232	3300045049	Bacteria	2304
284	Ga0451576_0040501	3300045051	Bacteria	4930
285	Ga0466967_0001639	3300045976	Bacteria	13223
286	Ga0466967_0054873	3300045976	Bacteria	3509
287	Ga0466967_0237784	3300045976	Bacteria	1736
288	Ga0495603_0056108	3300046455	Bacteria	2333
289	Ga0495629_0001095	3300046459	Bacteria	21490
290	Ga0495638_0003301	3300046460	Bacteria	12725
291	Ga0495638_0029041	3300046460	Bacteria	3566
292	Ga0495638_0063692	3300046460	Bacteria	2273
293	Ga0495638_0071613	3300046460	Unclassified	2121
294	Ga0495653_0051441	3300046463	Bacteria	3163
295	Ga0495580_0003049	3300046472	Bacteria	14348
296	Ga0495580_0036525	3300046472	Bacteria	3527
297	Ga0495582_0068800	3300046473	Bacteria	1957
298	Ga0495605_0019446	3300046474	Bacteria	3627
299	Ga0495639_0039315	3300046475	Bacteria	2127
300	Ga0495594_0140435	3300046499	Bacteria	1370
301	Ga0495583_0084503	3300046506	Bacteria	1375
302	Ga0495606_0006496	3300046507	Bacteria	10756
303	Ga0495618_0096229	3300046514	Bacteria	1894
304	Ga0495620_0026422	3300046515	Bacteria	2731
305	Ga0495643_0042692	3300046522	Bacteria	2470
306	Ga0495643_0150476	3300046522	Bacteria	1153
307	Ga0495648_0001445	3300046524	Bacteria	23245
308	Ga0495648_0080436	3300046524	Bacteria	1856
309	Ga0495666_0017621	3300046526	Bacteria	3556
310	Ga0495640_0124739	3300046533	Bacteria	1671
311	Ga0495645_0017744	3300046543	Bacteria	5103
312	Ga0495645_0200608	3300046543	Bacteria	1354
313	Ga0495645_0208087	3300046543	Bacteria	1323
314	Ga0495667_0033152	3300046559	Bacteria	3457
315	Ga0495668_0007445	3300046616	Bacteria	6994
316	Ga0495625_0002380	3300046660	Bacteria	20470
317	Ga0495635_0048554	3300046663	Bacteria	2926
318	Ga0495657_0151110	3300046675	Bacteria	1442
319	Ga0495599_0031697	3300046678	Bacteria	3317
320	Ga0495646_0054789	3300046680	Unclassified	2397
321	Ga0495613_0003509	3300046689	Bacteria	11739
322	Ga0495613_0279062	3300046689	Bacteria	1161
323	Ga0495624_0001032	3300046690	Bacteria	21928
324	Ga0495624_0096022	3300046690	Bacteria	1826
325	Ga0495649_0003414	3300046694	Bacteria	10735
326	Ga0495649_0037647	3300046694	Bacteria	2655
327	Ga0495600_0047001	3300046809	Bacteria	2815
328	Ga0495581_0010777	3300047315	Bacteria	5287
329	Ga0495636_0009811	3300047318	Bacteria	3771
330	Ga0495674_0014851	3300047319	Bacteria	7286
331	Ga0495672_0001553	3300047320	Bacteria	22467
332	Ga0495672_0011774	3300047320	Bacteria	6148
333	Ga0495672_0035412	3300047320	Bacteria	3074
334	Ga0495683_0001317	3300047323	Bacteria	16662
335	Ga0495683_0016974	3300047323	Bacteria	3776
336	Ga0495687_038337	3300047443	Bacteria	2127
337	Ga0495675_0031391	3300047444	Bacteria	3391
338	Ga0495685_003559	3300047447	Bacteria	4983
339	Ga0495673_0000583	3300047469	Bacteria	36759
340	Ga0495681_0002098	3300047470	Bacteria	14494
341	Ga0495686_0005284	3300047472	Bacteria	10244
342	Ga0495686_0012504	3300047472	Bacteria	5935
343	Ga0495593_0149897	3300047673	Bacteria	1180
344	Ga0495602_0275140	3300048088	Bacteria	1243
345	Ga0495626_0101629	3300048091	Bacteria	1253
346	Ga0496100_0000277	3300048903	Bacteria	25885
347	Ga0496100_0002228	3300048903	Bacteria	9789
348	Ga0496100_0037640	3300048903	Bacteria	3060
349	Ga0496101_0000042	3300048904	Bacteria	163148
350	Ga0496101_0000145	3300048904	Bacteria	62824
351	Ga0496101_0003636	3300048904	Bacteria	9629
352	Ga0496101_0008960	3300048904	Bacteria	6559
353	Ga0496101_0030480	3300048904	Bacteria	3782
354	Ga0496102_0000016	3300048905	Bacteria	286787
355	Ga0496102_0000133	3300048905	Bacteria	101632
356	Ga0496102_0014598	3300048905	Bacteria	6827
357	Ga0496102_0030778	3300048905	Bacteria	4806
358	Ga0496102_0061153	3300048905	Bacteria	3446
359	Ga0496102_0083606	3300048905	Bacteria	2945
360	Ga0496102_0137679	3300048905	Bacteria	2288
361	Ga0496103_0000015	3300048906	Bacteria	287966
362	Ga0496103_0000421	3300048906	Bacteria	37035
363	Ga0496103_0000637	3300048906	Bacteria	26749
364	Ga0496103_0004664	3300048906	Bacteria	8303
365	Ga0496103_0014985	3300048906	Bacteria	4609
366	Ga0496104_0045779	3300048907	Bacteria	4117
367	Ga0496104_0054645	3300048907	Bacteria	3774
368	Ga0496104_0242634	3300048907	Bacteria	1714
369	Ga0496104_0419197	3300048907	Bacteria	1251
370	Ga0496105_0002206	3300048908	Bacteria	14108
371	Ga0496105_0029809	3300048908	Bacteria	4467
372	Ga0496105_0037845	3300048908	Bacteria	3974
373	Ga0496106_0001315	3300048909	Bacteria	18626
374	Ga0496106_0004501	3300048909	Bacteria	10331
375	Ga0496106_0005866	3300048909	Bacteria	9085
376	Ga0496106_0015142	3300048909	Bacteria	5707
377	Ga0496106_0164470	3300048909	Bacteria	1756
378	Ga0496107_0001292	3300048910	Bacteria	15316
379	Ga0496107_0021368	3300048910	Bacteria	4574
380	Ga0496107_0026377	3300048910	Bacteria	4118
381	Ga0496107_0032854	3300048910	Bacteria	3710
382	Ga0496108_0003110	3300048911	Bacteria	13342
383	Ga0496109_0000135	3300048912	Bacteria	74407
384	Ga0496109_0006313	3300048912	Bacteria	9981
385	Ga0496109_0231438	3300048912	Bacteria	1739
386	Ga0496110_0001845	3300048913	Bacteria	15632
387	Ga0496111_0006560	3300048914	Bacteria	7566
388	Ga0496111_0084434	3300048914	Bacteria	2321
389	Ga0496112_0040465	3300048915	Bacteria	4557
390	Ga0496112_0461646	3300048915	Bacteria	1207
391	Ga0496113_0015764	3300048916	Bacteria	5205
392	Ga0496113_0035869	3300048916	Bacteria	3630
393	Ga0496113_0141385	3300048916	Bacteria	1894
394	Ga0496114_0000344	3300048917	Bacteria	33940
395	Ga0496114_0001281	3300048917	Bacteria	18990
396	Ga0496114_0006899	3300048917	Bacteria	8946
397	Ga0496114_0034770	3300048917	Bacteria	4159
398	Ga0496114_0100006	3300048917	Bacteria	2474
399	Ga0496115_0001234	3300048918	Bacteria	18336
400	Ga0496115_0002390	3300048918	Bacteria	13454
401	Ga0496115_0036044	3300048918	Bacteria	3915
402	Ga0496115_0147882	3300048918	Bacteria	1939
403	Ga0496116_0000055	3300048919	Bacteria	286923
404	Ga0496116_0008499	3300048919	Bacteria	8898
405	Ga0496116_0017929	3300048919	Bacteria	5474
406	Ga0496117_0000006	3300048920	Bacteria	758420
407	Ga0496117_0002362	3300048920	Bacteria	24107
408	Ga0496117_0023504	3300048920	Bacteria	4907
409	Ga0496117_0110589	3300048920	Bacteria	1712
410	Ga0496118_0000004	3300048921	Bacteria	758420
411	Ga0496118_0000710	3300048921	Bacteria	53670
412	Ga0496118_0000825	3300048921	Bacteria	49332
413	Ga0496119_0000392	3300048922	Bacteria	60458
414	Ga0496119_0004531	3300048922	Bacteria	13788
415	Ga0496119_0005803	3300048922	Bacteria	11678
416	Ga0496120_0003357	3300048923	Bacteria	14687
417	Ga0496120_0005791	3300048923	Bacteria	9690
418	Ga0496120_0018690	3300048923	Bacteria	4457
419	Ga0496121_0000139	3300048924	Bacteria	163176
420	Ga0496121_0000999	3300048924	Bacteria	50561
421	Ga0496121_0001286	3300048924	Bacteria	43221
422	Ga0496122_0000149	3300048925	Bacteria	163504
423	Ga0496122_0047780	3300048925	Bacteria	3299
424	Ga0496124_0000114	3300048927	Bacteria	165215
425	Ga0496124_0163050	3300048927	Bacteria	1735
426	Ga0496124_0265419	3300048927	Bacteria	1260
427	Ga0496125_0000130	3300048928	Bacteria	163176
428	Ga0496125_0023653	3300048928	Bacteria	5666
429	Ga0496125_0240952	3300048928	Bacteria	1148
430	Ga0496126_0000149	3300048929	Bacteria	163176
431	Ga0496126_0003455	3300048929	Bacteria	19932
432	Ga0496126_0003501	3300048929	Bacteria	19807
433	Ga0496126_0006102	3300048929	Bacteria	13514
434	Ga0501034_0007588	3300049571	Bacteria	11542
435	Ga0501036_0009855	3300049572	Bacteria	7866
436	Ga0501037_0001229	3300049573	Bacteria	18909
437	Ga0501038_0007157	3300049574	Bacteria	10312
438	Ga0501039_0008401	3300049575	Bacteria	7869
439	Ga0501043_0000937	3300049579	Bacteria	25850
440	Ga0501070_0000839	3300049586	Bacteria	27914
441	nmdc:mga03683_64031_c1	3300050489	Bacteria	1559
442	nmdc:mga03n38_28179_c1	3300050490	Bacteria	2338
443	nmdc:mga03n38_54457_c1	3300050490	Bacteria	1798
444	nmdc:mga03n38_84026_c1	3300050490	Bacteria	1502
445	nmdc:mga00v17_153301_c1	3300050491	Bacteria	1481
446	nmdc:mga00v17_16884_c1	3300050491	Bacteria	4121
447	nmdc:mga00v17_18133_c1	3300050491	Bacteria	3994
448	nmdc:mga00v17_31481_c1	3300050491	Bacteria	3128
449	nmdc:mga00v17_47987_c1	3300050491	Bacteria	2587
450	nmdc:mga0yw44_120149_c1	3300050492	Bacteria	1692
451	nmdc:mga06z11_145349_c1	3300050494	Bacteria	1343
452	nmdc:mga06z11_16032_c1	3300050494	Bacteria	3363
453	nmdc:mga06z11_71073_c1	3300050494	Bacteria	1842
454	nmdc:mga04h51_12029_c1	3300050495	Bacteria	2418
455	nmdc:mga07m45_46082_c1	3300050496	Bacteria	2448
456	nmdc:mga0qj67_190329_c1	3300050509	Bacteria	1667
457	nmdc:mga08y16_311959_c1	3300050511	Bacteria	1620
458	nmdc:mga08y16_82496_c1	3300050511	Bacteria	3351
459	nmdc:mga0sz30_1634_c1	3300050516	Bacteria	7982
460	nmdc:mga0sz30_19771_c1	3300050516	Bacteria	1271
461	nmdc:mga0sz30_56738_c1	3300050516	Bacteria	1668
462	nmdc:mga0sz30_67537_c1	3300050516	Bacteria	1535
463	Ga0500635_0003651	3300053080	Bacteria	3890
464	Ga0495655_0004548	3300053083	Bacteria	2380
465	Ga0500578_0118787	3300053086	Bacteria	1663
466	Ga0500643_004477	3300053087	Bacteria	6307
467	Ga0500644_0003140	3300053088	Bacteria	4093
468	Ga0500556_0000505	3300053104	Bacteria	26812
469	Ga0500556_0001630	3300053104	Bacteria	8807
470	Ga0500556_0002028	3300053104	Bacteria	7054
471	Ga0500560_000250	3300053107	Bacteria	6629
472	Ga0500562_004689	3300053108	Bacteria	3446
473	Ga0500608_040342	3300053122	Bacteria	2238
474	Ga0500652_018415	3300053131	Bacteria	2578
475	Ga0500652_031228	3300053131	Bacteria	2088
476	Ga0500559_0013751	3300053136	Bacteria	3424
477	Ga0500573_0004371	3300053140	Bacteria	7438
478	Ga0500577_0001051	3300053142	Bacteria	7111
479	Ga0500616_0001210	3300053153	Bacteria	26060
480	Ga0500616_0055153	3300053153	Bacteria	2079
481	Ga0500645_000171	3300053730	Bacteria	51112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009098	Ga0105245_10322590	Ga0105245_103225901	322
2	3300046689	Ga0495613_0279062	Ga0495613_0279062_179_1147	322
3	3300013307	Ga0157372_10336822	Ga0157372_103368222	325
4	3300005338	Ga0068868_100242251	Ga0068868_1002422512	326
5	3300005356	Ga0070674_100254906	Ga0070674_1002549062	326
6	3300005459	Ga0068867_100268931	Ga0068867_1002689312	326
7	3300005546	Ga0070696_100192493	Ga0070696_1001924932	326
8	3300005718	Ga0068866_10147198	Ga0068866_101471981	326
9	3300005844	Ga0068862_100394496	Ga0068862_1003944961	326
10	3300013296	Ga0157374_10320492	Ga0157374_103204922	326
11	3300017792	Ga0163161_10191087	Ga0163161_101910872	326
12	3300025901	Ga0207688_10108739	Ga0207688_101087392	326
13	3300028381	Ga0268264_10239860	Ga0268264_102398602	326
14	3300031995	Ga0307409_100437508	Ga0307409_1004375082	327
15	3300032002	Ga0307416_100361659	Ga0307416_1003616592	327
16	3300005456	Ga0070678_100325404	Ga0070678_1003254041	328
17	3300026121	Ga0207683_10294161	Ga0207683_102941612	328
18	3300046460	Ga0495638_0071613	Ga0495638_0071613_942_2030	328
19	3300006038	Ga0075365_10011580	Ga0075365_100115802	329
20	3300006048	Ga0075363_100027264	Ga0075363_1000272643	329
21	3300006058	Ga0075432_10001344	Ga0075432_100013443	329
22	3300006186	Ga0075369_10006568	Ga0075369_100065685	329
23	3300006353	Ga0075370_10022583	Ga0075370_100225831	329
24	3300027907	Ga0207428_10163516	Ga0207428_101635162	329
25	3300046522	Ga0495643_0042692	Ga0495643_0042692_474_1523	329
26	3300046694	Ga0495649_0037647	Ga0495649_0037647_496_1545	329
27	3300050490	nmdc:mga03n38_28179_c1	nmdc:mga03n38_28179_c1_334_1383	329
28	3300050492	nmdc:mga0yw44_120149_c1	nmdc:mga0yw44_120149_c1_276_1325	329
29	3300050494	nmdc:mga06z11_16032_c1	nmdc:mga06z11_16032_c1_1129_2178	329
30	3300050516	nmdc:mga0sz30_56738_c1	nmdc:mga0sz30_56738_c1_473_1522	329
31	3300046543	Ga0495645_0208087	Ga0495645_0208087_245_1294	330
32	3300006048	Ga0075363_100114220	Ga0075363_1001142202	331
33	3300021388	Ga0213875_10002664	Ga0213875_1000266415	331
34	3300037853	Ga0436364_0737248	Ga0436364_0737248_152106_153149	331
35	3300050490	nmdc:mga03n38_84026_c1	nmdc:mga03n38_84026_c1_57_1106	331
36	3300053131	Ga0500652_018415	Ga0500652_018415_887_1921	331
37	3300028786	Ga0307517_10001261	Ga0307517_1000126124	332
38	3300028794	Ga0307515_10002359	Ga0307515_1000235915	332
39	3300031649	Ga0307514_10001238	Ga0307514_1000123811	332
40	3300033179	Ga0307507_10013071	Ga0307507_100130717	332
41	3300033180	Ga0307510_10040252	Ga0307510_100402522	332
42	3300044712	Ga0453684_0003501	Ga0453684_0003501_9873_10931	332
43	3300046459	Ga0495629_0001095	Ga0495629_0001095_2487_3548	332
44	3300046515	Ga0495620_0026422	Ga0495620_0026422_1356_2417	332
45	3300046543	Ga0495645_0200608	Ga0495645_0200608_307_1338	332
46	3300046660	Ga0495625_0002380	Ga0495625_0002380_3501_4562	332
47	3300047470	Ga0495681_0002098	Ga0495681_0002098_6043_7104	332
48	3300053083	Ga0495655_0004548	Ga0495655_0004548_249_1310	332
49	3300053107	Ga0500560_000250	Ga0500560_000250_931_1992	332
50	3300030522	Ga0307512_10004382	Ga0307512_100043822	333
51	3300031507	Ga0307509_10005713	Ga0307509_1000571311	333
52	3300031507	Ga0307509_10006251	Ga0307509_100062514	333
53	3300031616	Ga0307508_10008064	Ga0307508_100080646	333
54	3300031730	Ga0307516_10009345	Ga0307516_100093452	333
55	3300046522	Ga0495643_0150476	Ga0495643_0150476_70_1131	333
56	3300046689	Ga0495613_0003509	Ga0495613_0003509_5955_7016	333
57	3300047318	Ga0495636_0009811	Ga0495636_0009811_1119_2168	333
58	3300047323	Ga0495683_0016974	Ga0495683_0016974_2221_3270	333
59	3300047447	Ga0495685_003559	Ga0495685_003559_98_1147	333
60	3300031548	Ga0307408_100136271	Ga0307408_1001362712	334
61	3300045051	Ga0451576_0040501	Ga0451576_0040501_1237_2295	334
62	3300046472	Ga0495580_0003049	Ga0495580_0003049_5842_6891	334
63	3300005355	Ga0070671_100013078	Ga0070671_1000130782	335
64	3300005842	Ga0068858_100002996	Ga0068858_10000299620	335
65	3300009101	Ga0105247_10037744	Ga0105247_100377442	335
66	3300025931	Ga0207644_10112864	Ga0207644_101128642	335
67	3300026035	Ga0207703_10003513	Ga0207703_1000351316	335
68	3300046475	Ga0495639_0039315	Ga0495639_0039315_1006_2055	335
69	3300047673	Ga0495593_0149897	Ga0495593_0149897_23_1072	335
70	3300048905	Ga0496102_0137679	Ga0496102_0137679_438_1490	335
71	3300048907	Ga0496104_0242634	Ga0496104_0242634_547_1599	335
72	3300048907	Ga0496104_0419197	Ga0496104_0419197_221_1228	335
73	3300006051	Ga0075364_10031561	Ga0075364_100315613	336
74	3300031838	Ga0307518_10001367	Ga0307518_100013676	336
75	3300031901	Ga0307406_10056812	Ga0307406_100568122	336
76	3300033179	Ga0307507_10035631	Ga0307507_100356314	336
77	3300041411	Ga0439466_0012306	Ga0439466_0012306_1145_2206	336
78	3300041997	Ga0439431_0002584	Ga0439431_0002584_333_1394	336
79	3300042004	Ga0439445_0001380	Ga0439445_0001380_1538_2599	336
80	3300050491	nmdc:mga00v17_16884_c1	nmdc:mga00v17_16884_c1_300_1361	336
81	3300050491	nmdc:mga00v17_18133_c1	nmdc:mga00v17_18133_c1_2569_3672	336
82	3300028794	Ga0307515_10020750	Ga0307515_100207509	337
83	3300028794	Ga0307515_10173148	Ga0307515_101731482	337
84	3300031456	Ga0307513_10036877	Ga0307513_100368773	337
85	3300046694	Ga0495649_0003414	Ga0495649_0003414_220_1269	337
86	3300005367	Ga0070667_100001437	Ga0070667_10000143717	338
87	3300006038	Ga0075365_10014157	Ga0075365_100141574	338
88	3300006847	Ga0075431_100025593	Ga0075431_1000255937	338
89	3300010375	Ga0105239_10046949	Ga0105239_100469493	338
90	3300025986	Ga0207658_10002536	Ga0207658_100025364	338
91	3300048903	Ga0496100_0000277	Ga0496100_0000277_10908_11954	338
92	3300048904	Ga0496101_0000042	Ga0496101_0000042_67741_68787	338
93	3300048905	Ga0496102_0083606	Ga0496102_0083606_1375_2421	338
94	3300048906	Ga0496103_0000637	Ga0496103_0000637_23711_24757	338
95	3300048909	Ga0496106_0005866	Ga0496106_0005866_327_1373	338
96	3300048912	Ga0496109_0000135	Ga0496109_0000135_4497_5543	338
97	3300048913	Ga0496110_0001845	Ga0496110_0001845_7496_8542	338
98	3300048914	Ga0496111_0006560	Ga0496111_0006560_4347_5393	338
99	3300048916	Ga0496113_0141385	Ga0496113_0141385_617_1663	338
100	3300048917	Ga0496114_0000344	Ga0496114_0000344_16093_17139	338
101	3300048918	Ga0496115_0147882	Ga0496115_0147882_752_1798	338
102	3300048919	Ga0496116_0017929	Ga0496116_0017929_1613_2659	338
103	3300048920	Ga0496117_0110589	Ga0496117_0110589_397_1443	338
104	3300048922	Ga0496119_0004531	Ga0496119_0004531_5635_6681	338
105	3300048923	Ga0496120_0005791	Ga0496120_0005791_1491_2537	338
106	3300048924	Ga0496121_0000139	Ga0496121_0000139_67741_68787	338
107	3300048925	Ga0496122_0000149	Ga0496122_0000149_67969_69015	338
108	3300048927	Ga0496124_0000114	Ga0496124_0000114_69780_70826	338
109	3300048928	Ga0496125_0000130	Ga0496125_0000130_67741_68787	338
110	3300048929	Ga0496126_0000149	Ga0496126_0000149_94390_95436	338
111	3300003792	Ga0055540_1000068	Ga0055540_100006887	339
112	3300005456	Ga0070678_100307991	Ga0070678_1003079911	339
113	3300014326	Ga0157380_10396338	Ga0157380_103963382	339
114	3300025303	Ga0209051_1000057	Ga0209051_100005788	339
115	3300041411	Ga0439466_0024210	Ga0439466_0024210_1024_2070	339
116	3300041413	Ga0439465_0001019	Ga0439465_0001019_4419_5465	339
117	3300044712	Ga0453684_0307617	Ga0453684_0307617_314_1372	339
118	3300045976	Ga0466967_0237784	Ga0466967_0237784_600_1646	339
119	3300031249	Ga0265339_10051007	Ga0265339_100510072	340
120	3300006871	Ga0075434_100187253	Ga0075434_1001872532	341
121	3300005937	Ga0081455_10037120	Ga0081455_100371203	342
122	iso_pu_bacteria	2863067949	2863069435	342
123	3300009101	Ga0105247_10000073	Ga0105247_1000007351	343
124	3300009177	Ga0105248_10000088	Ga0105248_1000008850	343
125	3300009553	Ga0105249_10000126	Ga0105249_1000012651	343
126	3300013306	Ga0163162_10095192	Ga0163162_100951923	343
127	3300014325	Ga0163163_10012797	Ga0163163_100127973	343
128	3300014968	Ga0157379_10050497	Ga0157379_100504971	343
129	3300048905	Ga0496102_0000133	Ga0496102_0000133_51626_52657	343
130	3300048906	Ga0496103_0000421	Ga0496103_0000421_28377_29408	343
131	3300048909	Ga0496106_0164470	Ga0496106_0164470_311_1342	343
132	3300048919	Ga0496116_0008499	Ga0496116_0008499_5484_6515	343
133	3300048920	Ga0496117_0002362	Ga0496117_0002362_5491_6522	343
134	3300048921	Ga0496118_0000825	Ga0496118_0000825_9714_10745	343
135	3300048922	Ga0496119_0005803	Ga0496119_0005803_8221_9252	343
136	3300048923	Ga0496120_0018690	Ga0496120_0018690_2466_3497	343
137	3300048924	Ga0496121_0001286	Ga0496121_0001286_1470_2501	343
138	3300048927	Ga0496124_0163050	Ga0496124_0163050_510_1541	343
139	3300048927	Ga0496124_0265419	Ga0496124_0265419_195_1226	343
140	3300048928	Ga0496125_0023653	Ga0496125_0023653_2190_3221	343
141	3300048929	Ga0496126_0006102	Ga0496126_0006102_3907_4938	343
142	iso_pu_bacteria	2902792274	2902792752	343
143	3300046460	Ga0495638_0003301	Ga0495638_0003301_4561_5598	344
144	3300050489	nmdc:mga03683_64031_c1	nmdc:mga03683_64031_c1_498_1532	344
145	3300053104	Ga0500556_0002028	Ga0500556_0002028_800_1837	344
146	iso_pu_bacteria	2582581313	2585309812	344
147	iso_pu_bacteria	2738541264	2738669135	344
148	iso_pu_bacteria	2738541274	2738706749	344
149	iso_pu_bacteria	2738541356	2739147672	344
150	iso_pu_bacteria	2738543028	2739331878	344
151	iso_pu_bacteria	2738543034	2739363335	344
152	iso_pu_bacteria	2739367898	2740169564	344
153	iso_pu_bacteria	2751185725	2753036167	344
154	iso_pu_bacteria	2751185792	2753324039	344
155	iso_pu_bacteria	2902792274	2902794206	344
156	iso_pu_bacteria	2939582691	2939584229	344
157	iso_pu_bacteria	2974315732	2974317755	344
158	iso_pu_bacteria	2984523437	2984525966	344
159	3300005366	Ga0070659_100297102	Ga0070659_1002971021	345
160	3300005455	Ga0070663_100212057	Ga0070663_1002120572	345
161	3300005548	Ga0070665_100335127	Ga0070665_1003351272	345
162	3300006038	Ga0075365_10045050	Ga0075365_100450502	345
163	3300006042	Ga0075368_10002034	Ga0075368_100020346	345
164	3300006048	Ga0075363_100097088	Ga0075363_1000970882	345
165	3300006051	Ga0075364_10017028	Ga0075364_100170284	345
166	3300006178	Ga0075367_10004354	Ga0075367_100043546	345
167	3300006353	Ga0075370_10024122	Ga0075370_100241225	345
168	3300006846	Ga0075430_100214444	Ga0075430_1002144442	345
169	3300009094	Ga0111539_10390212	Ga0111539_103902121	345
170	3300009098	Ga0105245_10026782	Ga0105245_100267823	345
171	3300011119	Ga0105246_10211541	Ga0105246_102115412	345
172	3300026116	Ga0207674_10025021	Ga0207674_100250212	345
173	3300027866	Ga0209813_10003565	Ga0209813_100035655	345
174	3300047472	Ga0495686_0005284	Ga0495686_0005284_5925_6977	345
175	3300048912	Ga0496109_0231438	Ga0496109_0231438_372_1418	345
176	3300050490	nmdc:mga03n38_54457_c1	nmdc:mga03n38_54457_c1_451_1515	345
177	3300050491	nmdc:mga00v17_31481_c1	nmdc:mga00v17_31481_c1_397_1446	345
178	3300050491	nmdc:mga00v17_47987_c1	nmdc:mga00v17_47987_c1_21_1085	345
179	3300050494	nmdc:mga06z11_71073_c1	nmdc:mga06z11_71073_c1_249_1313	345
180	3300050495	nmdc:mga04h51_12029_c1	nmdc:mga04h51_12029_c1_448_1512	345
181	3300050509	nmdc:mga0qj67_190329_c1	nmdc:mga0qj67_190329_c1_364_1407	345
182	3300050511	nmdc:mga08y16_311959_c1	nmdc:mga08y16_311959_c1_504_1547	345
183	3300050516	nmdc:mga0sz30_19771_c1	nmdc:mga0sz30_19771_c1_130_1194	345
184	3300053153	Ga0500616_0001210	Ga0500616_0001210_16747_17850	345
185	iso_pu_bacteria	2523231044	2523384449	345
186	iso_pu_bacteria	2643221687	2644488583	345
187	iso_pu_bacteria	2738541274	2738702664	345
188	iso_pu_bacteria	2738543028	2739329574	345
189	iso_pu_bacteria	2902810491	2902811468	345
190	iso_pu_bacteria	2902837492	2902842706	345
191	iso_pu_bacteria	2904765812	2904767947	345
192	iso_pu_bacteria	2904770941	2904774281	345
193	iso_pu_bacteria	2908811453	2908813592	345
194	iso_pu_bacteria	2919420072	2919423624	345
195	iso_pu_bacteria	2919432681	2919436232	345
196	iso_pu_bacteria	2929212328	2929213206	345
197	3300025916	Ga0207663_10122057	Ga0207663_101220573	346
198	3300033180	Ga0307510_10085717	Ga0307510_100857173	346
199	3300035119	Ga0373956_0102610	Ga0373956_0102610_31_1104	346
200	3300044765	Ga0466970_0155451	Ga0466970_0155451_139_1182	346
201	3300045976	Ga0466967_0001639	Ga0466967_0001639_7735_8778	346
202	3300046472	Ga0495580_0036525	Ga0495580_0036525_2222_3295	346
203	3300048907	Ga0496104_0054645	Ga0496104_0054645_2661_3716	346
204	3300048908	Ga0496105_0002206	Ga0496105_0002206_3449_4504	346
205	3300048917	Ga0496114_0001281	Ga0496114_0001281_3431_4486	346
206	3300048918	Ga0496115_0002390	Ga0496115_0002390_2484_3539	346
207	3300005353	Ga0070669_100000503	Ga0070669_1000005033	347
208	3300005367	Ga0070667_100000054	Ga0070667_10000005451	347
209	3300005548	Ga0070665_100075359	Ga0070665_1000753593	347
210	3300005617	Ga0068859_100001074	Ga0068859_1000010745	347
211	3300005841	Ga0068863_100004887	Ga0068863_1000048878	347
212	3300005842	Ga0068858_100017962	Ga0068858_1000179624	347
213	3300005843	Ga0068860_100000246	Ga0068860_10000024633	347
214	3300005844	Ga0068862_100000024	Ga0068862_10000002451	347
215	3300006186	Ga0075369_10054908	Ga0075369_100549082	347
216	3300006931	Ga0097620_100001074	Ga0097620_1000010745	347
217	3300009545	Ga0105237_10000368	Ga0105237_1000036838	347
218	3300010375	Ga0105239_10273826	Ga0105239_102738262	347
219	3300025900	Ga0207710_10000099	Ga0207710_1000009952	347
220	3300025923	Ga0207681_10006507	Ga0207681_100065073	347
221	3300025941	Ga0207711_10000386	Ga0207711_1000038618	347
222	3300025961	Ga0207712_10000093	Ga0207712_1000009349	347
223	3300025986	Ga0207658_10000096	Ga0207658_1000009644	347
224	3300026088	Ga0207641_10000164	Ga0207641_100001647	347
225	3300028379	Ga0268266_10072156	Ga0268266_100721563	347
226	3300028380	Ga0268265_10000012	Ga0268265_10000012165	347
227	3300028381	Ga0268264_10000104	Ga0268264_1000010452	347
228	3300031247	Ga0265340_10024228	Ga0265340_100242282	347
229	3300031249	Ga0265339_10110573	Ga0265339_101105732	347
230	3300031730	Ga0307516_10000216	Ga0307516_1000021612	347
231	3300046507	Ga0495606_0006496	Ga0495606_0006496_9209_10252	347
232	3300046524	Ga0495648_0080436	Ga0495648_0080436_84_1127	347
233	3300047320	Ga0495672_0035412	Ga0495672_0035412_1289_2332	347
234	3300048904	Ga0496101_0000145	Ga0496101_0000145_50795_51838	347
235	3300048905	Ga0496102_0000016	Ga0496102_0000016_143929_144972	347
236	3300048906	Ga0496103_0000015	Ga0496103_0000015_141803_142846	347
237	3300048909	Ga0496106_0004501	Ga0496106_0004501_7926_8969	347
238	3300048910	Ga0496107_0026377	Ga0496107_0026377_1419_2462	347
239	3300048919	Ga0496116_0000055	Ga0496116_0000055_141990_143033	347
240	3300048920	Ga0496117_0000006	Ga0496117_0000006_615562_616605	347
241	3300048921	Ga0496118_0000004	Ga0496118_0000004_615562_616605	347
242	3300048922	Ga0496119_0000392	Ga0496119_0000392_10939_11982	347
243	3300048923	Ga0496120_0003357	Ga0496120_0003357_11163_12206	347
244	3300048924	Ga0496121_0000999	Ga0496121_0000999_38506_39549	347
245	3300048929	Ga0496126_0003455	Ga0496126_0003455_7866_8909	347
246	3300050516	nmdc:mga0sz30_67537_c1	nmdc:mga0sz30_67537_c1_215_1258	347
247	3300053087	Ga0500643_004477	Ga0500643_004477_3517_4560	347
248	3300002076	JGI24749J21850_1005537	JGI24749J21850_10055372	348
249	3300002077	JGI24744J21845_10001068	JGI24744J21845_100010682	348
250	3300002244	JGI24742J22300_10001534	JGI24742J22300_100015342	348
251	3300005328	Ga0070676_10007007	Ga0070676_100070073	348
252	3300005330	Ga0070690_100008960	Ga0070690_1000089602	348
253	3300005335	Ga0070666_10074436	Ga0070666_100744362	348
254	3300005337	Ga0070682_100019626	Ga0070682_1000196262	348
255	3300005338	Ga0068868_100003553	Ga0068868_1000035538	348
256	3300005341	Ga0070691_10000606	Ga0070691_1000060610	348
257	3300005347	Ga0070668_100012850	Ga0070668_1000128503	348
258	3300005347	Ga0070668_100104124	Ga0070668_1001041242	348
259	3300005353	Ga0070669_100020740	Ga0070669_1000207403	348
260	3300005366	Ga0070659_100138280	Ga0070659_1001382802	348
261	3300005367	Ga0070667_100021474	Ga0070667_1000214743	348
262	3300005437	Ga0070710_10017350	Ga0070710_100173502	348
263	3300005438	Ga0070701_10001511	Ga0070701_100015113	348
264	3300005439	Ga0070711_100001990	Ga0070711_1000019908	348
265	3300005440	Ga0070705_100002411	Ga0070705_1000024112	348
266	3300005441	Ga0070700_100003675	Ga0070700_1000036752	348
267	3300005444	Ga0070694_100017533	Ga0070694_1000175332	348
268	3300005456	Ga0070678_100006149	Ga0070678_1000061493	348
269	3300005457	Ga0070662_100013815	Ga0070662_1000138154	348
270	3300005458	Ga0070681_10325048	Ga0070681_103250481	348
271	3300005459	Ga0068867_100015703	Ga0068867_1000157034	348
272	3300005459	Ga0068867_100125505	Ga0068867_1001255052	348
273	3300005539	Ga0068853_100054720	Ga0068853_1000547202	348
274	3300005546	Ga0070696_100001219	Ga0070696_10000121914	348
275	3300005547	Ga0070693_100004864	Ga0070693_1000048642	348
276	3300005549	Ga0070704_100000691	Ga0070704_10000069113	348
277	3300005578	Ga0068854_100000413	Ga0068854_10000041325	348
278	3300005616	Ga0068852_100054833	Ga0068852_1000548331	348
279	3300005617	Ga0068859_100007370	Ga0068859_1000073702	348
280	3300005718	Ga0068866_10001212	Ga0068866_100012128	348
281	3300005719	Ga0068861_100003002	Ga0068861_1000030022	348
282	3300005719	Ga0068861_100040694	Ga0068861_1000406943	348
283	3300005842	Ga0068858_100004217	Ga0068858_1000042174	348
284	3300005843	Ga0068860_100022649	Ga0068860_1000226493	348
285	3300005844	Ga0068862_100022779	Ga0068862_1000227793	348
286	3300006038	Ga0075365_10063760	Ga0075365_100637602	348
287	3300006048	Ga0075363_100026004	Ga0075363_1000260043	348
288	3300006175	Ga0070712_100002423	Ga0070712_1000024237	348
289	3300006186	Ga0075369_10104123	Ga0075369_101041231	348
290	3300006358	Ga0068871_100056348	Ga0068871_1000563482	348
291	3300006931	Ga0097620_100007370	Ga0097620_10000737011	348
292	3300009098	Ga0105245_10006444	Ga0105245_100064444	348
293	3300009101	Ga0105247_10000520	Ga0105247_1000052010	348
294	3300009148	Ga0105243_10005167	Ga0105243_100051674	348
295	3300009174	Ga0105241_10056118	Ga0105241_100561183	348
296	3300009176	Ga0105242_10001241	Ga0105242_1000124120	348
297	3300009176	Ga0105242_10260393	Ga0105242_102603932	348
298	3300009177	Ga0105248_10009464	Ga0105248_100094647	348
299	3300009545	Ga0105237_10074131	Ga0105237_100741312	348
300	3300009553	Ga0105249_10003731	Ga0105249_100037313	348
301	3300010375	Ga0105239_10050950	Ga0105239_100509502	348
302	3300013296	Ga0157374_10186588	Ga0157374_101865882	348
303	3300013297	Ga0157378_10019202	Ga0157378_100192024	348
304	3300013306	Ga0163162_10032481	Ga0163162_100324813	348
305	3300013307	Ga0157372_10021280	Ga0157372_100212804	348
306	3300013308	Ga0157375_10007867	Ga0157375_100078673	348
307	3300014326	Ga0157380_10007954	Ga0157380_100079542	348
308	3300014745	Ga0157377_10073276	Ga0157377_100732762	348
309	3300014968	Ga0157379_10037011	Ga0157379_100370111	348
310	3300025898	Ga0207692_10017422	Ga0207692_100174222	348
311	3300025900	Ga0207710_10002553	Ga0207710_100025533	348
312	3300025901	Ga0207688_10000416	Ga0207688_100004164	348
313	3300025903	Ga0207680_10153528	Ga0207680_101535282	348
314	3300025905	Ga0207685_10010518	Ga0207685_100105182	348
315	3300025907	Ga0207645_10011321	Ga0207645_100113213	348
316	3300025911	Ga0207654_10049334	Ga0207654_100493342	348
317	3300025914	Ga0207671_10061437	Ga0207671_100614372	348
318	3300025915	Ga0207693_10000816	Ga0207693_100008164	348
319	3300025921	Ga0207652_10106566	Ga0207652_101065662	348
320	3300025923	Ga0207681_10012104	Ga0207681_100121043	348
321	3300025927	Ga0207687_10018224	Ga0207687_100182242	348
322	3300025932	Ga0207690_10120219	Ga0207690_101202192	348
323	3300025934	Ga0207686_10039603	Ga0207686_100396032	348
324	3300025937	Ga0207669_10004231	Ga0207669_100042313	348
325	3300025938	Ga0207704_10002242	Ga0207704_100022422	348
326	3300025941	Ga0207711_10027575	Ga0207711_100275754	348
327	3300025961	Ga0207712_10019125	Ga0207712_100191253	348
328	3300025972	Ga0207668_10033537	Ga0207668_100335372	348
329	3300025986	Ga0207658_10025566	Ga0207658_100255664	348
330	3300026035	Ga0207703_10011694	Ga0207703_100116944	348
331	3300026041	Ga0207639_10051201	Ga0207639_100512012	348
332	3300026075	Ga0207708_10010638	Ga0207708_100106383	348
333	3300026089	Ga0207648_10001409	Ga0207648_100014094	348
334	3300026118	Ga0207675_100007311	Ga0207675_1000073112	348
335	3300026121	Ga0207683_10001091	Ga0207683_1000109123	348
336	3300026142	Ga0207698_10042433	Ga0207698_100424333	348
337	3300028380	Ga0268265_10078383	Ga0268265_100783832	348
338	3300028381	Ga0268264_10004594	Ga0268264_100045948	348
339	3300028794	Ga0307515_10116691	Ga0307515_101166912	348
340	3300031251	Ga0265327_10000336	Ga0265327_1000033674	348
341	3300031456	Ga0307513_10074389	Ga0307513_100743893	348
342	3300031456	Ga0307513_10151923	Ga0307513_101519232	348
343	3300031649	Ga0307514_10010214	Ga0307514_100102144	348
344	3300031730	Ga0307516_10009403	Ga0307516_100094036	348
345	3300035118	Ga0373954_0061275	Ga0373954_0061275_362_1411	348
346	3300035724	Ga0373933_0043324	Ga0373933_0043324_1317_2366	348
347	3300037068	Ga0373925_0002117	Ga0373925_0002117_5335_6381	348
348	3300037068	Ga0373925_0040477	Ga0373925_0040477_1652_2701	348
349	3300044658	Ga0466972_0030271	Ga0466972_0030271_1214_2260	348
350	3300044683	Ga0466965_0003465	Ga0466965_0003465_5326_6372	348
351	3300044683	Ga0466965_0008269	Ga0466965_0008269_1782_2828	348
352	3300044735	Ga0466968_0002311	Ga0466968_0002311_2988_4034	348
353	3300044842	Ga0466957_0006527	Ga0466957_0006527_156_1202	348
354	3300044901	Ga0466960_0007340	Ga0466960_0007340_2214_3260	348
355	3300044901	Ga0466960_0008407	Ga0466960_0008407_714_1760	348
356	3300045049	Ga0466959_0083232	Ga0466959_0083232_709_1755	348
357	3300045976	Ga0466967_0054873	Ga0466967_0054873_1418_2464	348
358	3300046455	Ga0495603_0056108	Ga0495603_0056108_861_1907	348
359	3300046460	Ga0495638_0063692	Ga0495638_0063692_687_1736	348
360	3300046463	Ga0495653_0051441	Ga0495653_0051441_815_1864	348
361	3300046473	Ga0495582_0068800	Ga0495582_0068800_106_1155	348
362	3300046474	Ga0495605_0019446	Ga0495605_0019446_80_1129	348
363	3300046499	Ga0495594_0140435	Ga0495594_0140435_194_1240	348
364	3300046506	Ga0495583_0084503	Ga0495583_0084503_234_1283	348
365	3300046514	Ga0495618_0096229	Ga0495618_0096229_818_1867	348
366	3300046524	Ga0495648_0001445	Ga0495648_0001445_5878_6927	348
367	3300046526	Ga0495666_0017621	Ga0495666_0017621_222_1271	348
368	3300046533	Ga0495640_0124739	Ga0495640_0124739_600_1646	348
369	3300046543	Ga0495645_0017744	Ga0495645_0017744_872_1921	348
370	3300046559	Ga0495667_0033152	Ga0495667_0033152_231_1280	348
371	3300046616	Ga0495668_0007445	Ga0495668_0007445_4215_5264	348
372	3300046663	Ga0495635_0048554	Ga0495635_0048554_1241_2290	348
373	3300046675	Ga0495657_0151110	Ga0495657_0151110_350_1399	348
374	3300046678	Ga0495599_0031697	Ga0495599_0031697_172_1221	348
375	3300046680	Ga0495646_0054789	Ga0495646_0054789_476_1525	348
376	3300046690	Ga0495624_0001032	Ga0495624_0001032_13679_14728	348
377	3300046690	Ga0495624_0096022	Ga0495624_0096022_58_1104	348
378	3300046809	Ga0495600_0047001	Ga0495600_0047001_982_2031	348
379	3300047315	Ga0495581_0010777	Ga0495581_0010777_301_1350	348
380	3300047319	Ga0495674_0014851	Ga0495674_0014851_315_1361	348
381	3300047320	Ga0495672_0001553	Ga0495672_0001553_14936_15985	348
382	3300047320	Ga0495672_0011774	Ga0495672_0011774_2851_3900	348
383	3300047323	Ga0495683_0001317	Ga0495683_0001317_9162_10211	348
384	3300047443	Ga0495687_038337	Ga0495687_038337_1047_2096	348
385	3300047444	Ga0495675_0031391	Ga0495675_0031391_2314_3363	348
386	3300047469	Ga0495673_0000583	Ga0495673_0000583_21137_22186	348
387	3300047472	Ga0495686_0012504	Ga0495686_0012504_2975_4024	348
388	3300048088	Ga0495602_0275140	Ga0495602_0275140_187_1233	348
389	3300048091	Ga0495626_0101629	Ga0495626_0101629_155_1204	348
390	3300048903	Ga0496100_0002228	Ga0496100_0002228_2621_3667	348
391	3300048903	Ga0496100_0037640	Ga0496100_0037640_25_1071	348
392	3300048904	Ga0496101_0003636	Ga0496101_0003636_2402_3448	348
393	3300048904	Ga0496101_0008960	Ga0496101_0008960_305_1351	348
394	3300048904	Ga0496101_0030480	Ga0496101_0030480_708_1754	348
395	3300048905	Ga0496102_0014598	Ga0496102_0014598_552_1598	348
396	3300048906	Ga0496103_0004664	Ga0496103_0004664_2673_3719	348
397	3300048907	Ga0496104_0045779	Ga0496104_0045779_1652_2698	348
398	3300048908	Ga0496105_0037845	Ga0496105_0037845_693_1739	348
399	3300048909	Ga0496106_0001315	Ga0496106_0001315_16194_17240	348
400	3300048909	Ga0496106_0015142	Ga0496106_0015142_52_1098	348
401	3300048910	Ga0496107_0001292	Ga0496107_0001292_9815_10861	348
402	3300048910	Ga0496107_0021368	Ga0496107_0021368_2360_3406	348
403	3300048915	Ga0496112_0040465	Ga0496112_0040465_1687_2733	348
404	3300048916	Ga0496113_0015764	Ga0496113_0015764_1676_2722	348
405	3300048917	Ga0496114_0006899	Ga0496114_0006899_3715_4761	348
406	3300048917	Ga0496114_0034770	Ga0496114_0034770_424_1470	348
407	3300048918	Ga0496115_0001234	Ga0496115_0001234_13155_14201	348
408	3300048918	Ga0496115_0036044	Ga0496115_0036044_1078_2124	348
409	3300048925	Ga0496122_0047780	Ga0496122_0047780_725_1771	348
410	3300048928	Ga0496125_0240952	Ga0496125_0240952_16_1062	348
411	3300048929	Ga0496126_0003501	Ga0496126_0003501_1981_3027	348
412	3300050494	nmdc:mga06z11_145349_c1	nmdc:mga06z11_145349_c1_234_1280	348
413	3300050496	nmdc:mga07m45_46082_c1	nmdc:mga07m45_46082_c1_615_1664	348
414	3300053080	Ga0500635_0003651	Ga0500635_0003651_2801_3850	348
415	3300053086	Ga0500578_0118787	Ga0500578_0118787_248_1297	348
416	3300053088	Ga0500644_0003140	Ga0500644_0003140_2563_3612	348
417	3300053104	Ga0500556_0000505	Ga0500556_0000505_9891_10940	348
418	3300053104	Ga0500556_0001630	Ga0500556_0001630_62_1108	348
419	3300053108	Ga0500562_004689	Ga0500562_004689_1097_2146	348
420	3300053122	Ga0500608_040342	Ga0500608_040342_1098_2147	348
421	3300053131	Ga0500652_031228	Ga0500652_031228_497_1546	348
422	3300053136	Ga0500559_0013751	Ga0500559_0013751_2358_3407	348
423	3300053140	Ga0500573_0004371	Ga0500573_0004371_2356_3405	348
424	3300053142	Ga0500577_0001051	Ga0500577_0001051_5187_6233	348
425	3300053153	Ga0500616_0055153	Ga0500616_0055153_609_1658	348
426	3300053730	Ga0500645_000171	Ga0500645_000171_48100_49149	348
427	iso_pu_bacteria	2523533628	2524003691	348
428	3300001977	JGI24746J21847_1003839	JGI24746J21847_10038392	349
429	3300003792	Ga0055540_1016337	Ga0055540_10163372	349
430	3300005328	Ga0070676_10085332	Ga0070676_100853322	349
431	3300005334	Ga0068869_100007294	Ga0068869_1000072944	349
432	3300005337	Ga0070682_100152612	Ga0070682_1001526122	349
433	3300005345	Ga0070692_10038140	Ga0070692_100381402	349
434	3300005355	Ga0070671_100002964	Ga0070671_1000029645	349
435	3300005364	Ga0070673_100088131	Ga0070673_1000881311	349
436	3300005365	Ga0070688_100027402	Ga0070688_1000274022	349
437	3300005367	Ga0070667_100024556	Ga0070667_1000245562	349
438	3300005367	Ga0070667_100304036	Ga0070667_1003040361	349
439	3300005439	Ga0070711_100009797	Ga0070711_1000097971	349
440	3300005455	Ga0070663_100048129	Ga0070663_1000481292	349
441	3300005457	Ga0070662_100151941	Ga0070662_1001519411	349
442	3300005466	Ga0070685_10029438	Ga0070685_100294382	349
443	3300005539	Ga0068853_100038797	Ga0068853_1000387973	349
444	3300005548	Ga0070665_100002478	Ga0070665_10000247816	349
445	3300005549	Ga0070704_100019162	Ga0070704_1000191622	349
446	3300005563	Ga0068855_100067121	Ga0068855_1000671214	349
447	3300005578	Ga0068854_100109164	Ga0068854_1001091642	349
448	3300005841	Ga0068863_100002763	Ga0068863_10000276311	349
449	3300006051	Ga0075364_10138336	Ga0075364_101383362	349
450	3300006051	Ga0075364_10141757	Ga0075364_101417572	349
451	3300006173	Ga0070716_100059838	Ga0070716_1000598382	349
452	3300006186	Ga0075369_10007235	Ga0075369_100072353	349
453	3300006186	Ga0075369_10027888	Ga0075369_100278882	349
454	3300006186	Ga0075369_10066981	Ga0075369_100669812	349
455	3300009098	Ga0105245_10118800	Ga0105245_101188002	349
456	3300009098	Ga0105245_10136554	Ga0105245_101365542	349
457	3300009551	Ga0105238_10246254	Ga0105238_102462541	349
458	3300010375	Ga0105239_10124000	Ga0105239_101240002	349
459	3300010375	Ga0105239_10360976	Ga0105239_103609761	349
460	3300011119	Ga0105246_10217789	Ga0105246_102177892	349
461	3300013296	Ga0157374_10011714	Ga0157374_100117146	349
462	3300013306	Ga0163162_10116209	Ga0163162_101162093	349
463	3300014325	Ga0163163_10025143	Ga0163163_100251434	349
464	3300025303	Ga0209051_1000404	Ga0209051_100040445	349
465	3300025303	Ga0209051_1014595	Ga0209051_10145952	349
466	3300025303	Ga0209051_1014614	Ga0209051_10146144	349
467	3300025893	Ga0207682_10080170	Ga0207682_100801701	349
468	3300025901	Ga0207688_10009651	Ga0207688_100096512	349
469	3300025901	Ga0207688_10023928	Ga0207688_100239283	349
470	3300025904	Ga0207647_10014956	Ga0207647_100149563	349
471	3300025915	Ga0207693_10008551	Ga0207693_100085513	349
472	3300025927	Ga0207687_10074937	Ga0207687_100749372	349
473	3300025931	Ga0207644_10001907	Ga0207644_100019072	349
474	3300025932	Ga0207690_10083960	Ga0207690_100839602	349
475	3300025939	Ga0207665_10021473	Ga0207665_100214733	349
476	3300025942	Ga0207689_10015678	Ga0207689_100156783	349
477	3300025986	Ga0207658_10013742	Ga0207658_100137423	349
478	3300026067	Ga0207678_10012320	Ga0207678_100123202	349
479	3300026088	Ga0207641_10002894	Ga0207641_1000289410	349
480	3300026089	Ga0207648_10029726	Ga0207648_100297264	349
481	3300026118	Ga0207675_100013271	Ga0207675_1000132712	349
482	3300026121	Ga0207683_10002701	Ga0207683_100027014	349
483	3300035112	Ga0373932_0052652	Ga0373932_0052652_136_1185	349
484	3300035691	Ga0373931_0004239	Ga0373931_0004239_4825_5874	349
485	3300044658	Ga0466972_0006601	Ga0466972_0006601_2434_3483	349
486	3300046460	Ga0495638_0029041	Ga0495638_0029041_911_1963	349
487	3300048905	Ga0496102_0030778	Ga0496102_0030778_274_1323	349
488	3300048905	Ga0496102_0061153	Ga0496102_0061153_1336_2397	349
489	3300048906	Ga0496103_0014985	Ga0496103_0014985_2484_3533	349
490	3300048908	Ga0496105_0029809	Ga0496105_0029809_2130_3224	349
491	3300048910	Ga0496107_0032854	Ga0496107_0032854_2485_3534	349
492	3300048911	Ga0496108_0003110	Ga0496108_0003110_1728_2777	349
493	3300048912	Ga0496109_0006313	Ga0496109_0006313_4597_5646	349
494	3300048914	Ga0496111_0084434	Ga0496111_0084434_980_2074	349
495	3300048915	Ga0496112_0461646	Ga0496112_0461646_65_1114	349
496	3300048916	Ga0496113_0035869	Ga0496113_0035869_117_1166	349
497	3300048917	Ga0496114_0100006	Ga0496114_0100006_124_1173	349
498	3300048920	Ga0496117_0023504	Ga0496117_0023504_302_1363	349
499	3300048921	Ga0496118_0000710	Ga0496118_0000710_27149_28210	349
500	3300049571	Ga0501034_0007588	Ga0501034_0007588_5206_6261	349
501	3300049572	Ga0501036_0009855	Ga0501036_0009855_724_1779	349
502	3300049573	Ga0501037_0001229	Ga0501037_0001229_8092_9147	349
503	3300049574	Ga0501038_0007157	Ga0501038_0007157_4934_5989	349
504	3300049575	Ga0501039_0008401	Ga0501039_0008401_3007_4062	349
505	3300049579	Ga0501043_0000937	Ga0501043_0000937_13560_14615	349
506	3300049586	Ga0501070_0000839	Ga0501070_0000839_15752_16807	349
507	3300050491	nmdc:mga00v17_153301_c1	nmdc:mga00v17_153301_c1_58_1110	349
508	3300050511	nmdc:mga08y16_82496_c1	nmdc:mga08y16_82496_c1_65_1129	349
509	3300050516	nmdc:mga0sz30_1634_c1	nmdc:mga0sz30_1634_c1_4119_5168	349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

228

356

0.95 PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

70

190

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6ie0-assembly2.cif.gz_B	x-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis	0.9425	2	343
6ie0-assembly2.cif.gz_B	x-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis	0.9292	2	343
2dq4-assembly1.cif.gz_A	crystal structure of threonine 3-dehydrogenase	0.9246	1	345
2dq4-assembly1.cif.gz_A	crystal structure of threonine 3-dehydrogenase	0.922	1	345
1rjw-assembly1.cif.gz_C	crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r	0.9206	1	346

ID	Description	Score	Start	End	Superfamily
af_A0A1D8PSZ0_55_239_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9623	1	158	3.90.180.10
af_A0A1D8PDC5_1_179_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9605	1	150	3.90.180.10
af_Q2G2C7_146_286_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9521	151	288	3.40.50.720
af_P39714_10_176_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9395	13	153	3.90.180.10
af_P39714_182_315_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9327	161	289	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A3S3BUA8-F1-model_v4	2,3-butanediol dehydrogenase	0.9852	1	345	GO:0000721 GO:0005737 GO:0008270 GO:0034079
AF-A0A3S3BUA8-F1-model_v4	2,3-butanediol dehydrogenase	0.9796	1	345	GO:0000721 GO:0005737 GO:0008270 GO:0034079
AF-A0A1E3Q5D6-F1-model_v4	Enoyl reductase (ER) domain-containing protein	0.9728	1	343	GO:0000721 GO:0005737 GO:0008270 GO:0034079
AF-A0A7W9MFP9-F1-model_v4	(R,R)-butanediol dehydrogenase/meso-butanediol dehydrogenase/diacetyl reductase (EC 1.1.1.-, EC 1.1.1.303, EC 1.1.1.4)	0.9705	1	343	GO:0000721 GO:0008270 GO:0052587
AF-A0A5N6E017-F1-model_v4	Chaperonin 10-like protein	0.9695	1	311	GO:0000721 GO:0005737 GO:0008270 GO:0016020 GO:0034079

Feature Viewer

pLDDT	pTM	Quality
95.79	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F456978

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

228

356

0.95

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

70

190

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map