F456989

General Info

Members Datasets Scaffolds Average Seq Length
509 289 1018 123

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_11169739|Ga0207705_111697391
Length 119
Sequence VEASEVQFFKDLLLKQRAEILNKTLALRNEAAIEATGQGDEGDLAVSEQSLAMTLRLQERDAHHLQKIDRTLGKIEEGSFGLCEQCEEPLQKNRLIARPVANLCVACKEEQESRERVFA

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
212 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
213 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
216 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
217 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
218 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 4.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 3.73
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 15.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_11169739 3300025909 Unclassified 591
2 Ga0006763J43179_107734 3300002870 Unclassified 500
3 Ga0006759J45824_1006064 3300003163 Unclassified 834
4 Ga0006758J48902_1019475 3300003300 Unclassified 559
5 rootH1_10077254 3300003323 Bacteria 4251
6 rootH1_10288592 3300003323 Bacteria 1631
7 Ga0032354_1031084 3300003693 Unclassified 851
8 Ga0058858_1379739 3300004785 Bacteria 603
9 Ga0058859_11551521 3300004798 Bacteria 544
10 Ga0058860_11846079 3300004801 Unclassified 724
11 Ga0058860_12057947 3300004801 Bacteria 549
12 Ga0058860_12102671 3300004801 Bacteria 610
13 Ga0058862_10075690 3300004803 Bacteria 1176
14 Ga0065715_10577474 3300005293 Unclassified 722
15 Ga0070658_10044642 3300005327 Bacteria 3582
16 Ga0070658_11121144 3300005327 Bacteria 684
17 Ga0070676_10010085 3300005328 Bacteria 5117
18 Ga0070683_100227111 3300005329 Bacteria 1774
19 Ga0070683_100291078 3300005329 Bacteria 1553
20 Ga0070683_101126882 3300005329 Bacteria 754
21 Ga0070690_100001442 3300005330 Bacteria 12422
22 Ga0070690_100003920 3300005330 Bacteria 8208
23 Ga0070670_100522217 3300005331 Bacteria 1057
24 Ga0068869_101225414 3300005334 Bacteria 660
25 Ga0070666_10087814 3300005335 Bacteria 2132
26 Ga0070666_10135707 3300005335 Bacteria 1712
27 Ga0070666_11350574 3300005335 Bacteria 532
28 Ga0070680_100040653 3300005336 Unclassified 3767
29 Ga0070680_100385429 3300005336 Unclassified 1194
30 Ga0068868_100213350 3300005338 Unclassified 1614
31 Ga0068868_100240580 3300005338 Bacteria 1521
32 Ga0070660_100334669 3300005339 Archaea 1245
33 Ga0070660_100840306 3300005339 Bacteria 773
34 Ga0070689_100003803 3300005340 Bacteria 10112
35 Ga0070689_100067538 3300005340 Bacteria 2787
36 Ga0070687_100029373 3300005343 Bacteria 2677
37 Ga0070661_100776923 3300005344 Unclassified 785
38 Ga0070692_10009790 3300005345 Bacteria 4338
39 Ga0070692_10752199 3300005345 Unclassified 661
40 Ga0070692_11240206 3300005345 Bacteria 532
41 Ga0070668_100552362 3300005347 Bacteria 1002
42 Ga0070668_102018855 3300005347 Bacteria 532
43 Ga0070675_101169073 3300005354 Bacteria 708
44 Ga0070671_100180443 3300005355 Bacteria 1787
45 Ga0070674_101822217 3300005356 Bacteria 552
46 Ga0070673_100100750 3300005364 Unclassified 2378
47 Ga0070673_100490822 3300005364 Bacteria 1110
48 Ga0070673_101822636 3300005364 Unclassified 576
49 Ga0070688_100018368 3300005365 Bacteria 4034
50 Ga0070659_100645682 3300005366 Bacteria 912
51 Ga0070667_100191068 3300005367 Bacteria 1814
52 Ga0070667_100661505 3300005367 Bacteria 965
53 Ga0070709_10101459 3300005434 Bacteria 1918
54 Ga0070714_100037927 3300005435 Bacteria 4052
55 Ga0070713_100557502 3300005436 Bacteria 1085
56 Ga0070710_10017455 3300005437 Bacteria 3673
57 Ga0070701_10019365 3300005438 Bacteria 3214
58 Ga0070711_100148595 3300005439 Bacteria 1765
59 Ga0070705_100065309 3300005440 Bacteria 2178
60 Ga0070705_100425298 3300005440 Bacteria 990
61 Ga0070700_100002550 3300005441 Bacteria 9294
62 Ga0070694_100037883 3300005444 Bacteria 3200
63 Ga0070694_100243565 3300005444 Bacteria 1357
64 Ga0070708_101450074 3300005445 Bacteria 640
65 Ga0070663_100784630 3300005455 Bacteria 816
66 Ga0070678_100011023 3300005456 Bacteria 5553
67 Ga0070662_100032461 3300005457 Bacteria 3670
68 Ga0070681_10070703 3300005458 Unclassified 3455
69 Ga0070681_11716214 3300005458 Bacteria 554
70 Ga0068867_100007894 3300005459 Bacteria 7522
71 Ga0068867_100058006 3300005459 Bacteria 2868
72 Ga0068867_101476219 3300005459 Bacteria 632
73 Ga0070685_10021579 3300005466 Bacteria 3501
74 Ga0070685_10358398 3300005466 Bacteria 999
75 Ga0070685_10385932 3300005466 Bacteria 966
76 Ga0070706_100039098 3300005467 Bacteria 4380
77 Ga0070707_100038749 3300005468 Bacteria 4553
78 Ga0070707_100281829 3300005468 Bacteria 1615
79 Ga0070707_101846261 3300005468 Unclassified 572
80 Ga0070679_100004235 3300005530 Bacteria 13240
81 Ga0070679_100188629 3300005530 Unclassified 2031
82 Ga0070684_100081070 3300005535 Bacteria 2871
83 Ga0070684_100115190 3300005535 Bacteria 2414
84 Ga0070684_100157933 3300005535 Bacteria 2056
85 Ga0070684_100377089 3300005535 Bacteria 1306
86 Ga0068853_100185938 3300005539 Bacteria 1886
87 Ga0070686_100081212 3300005544 Bacteria 2147
88 Ga0070686_100148529 3300005544 Bacteria 1639
89 Ga0070693_100176087 3300005547 Bacteria 1374
90 Ga0070693_101505718 3300005547 Bacteria 526
91 Ga0070665_100011455 3300005548 Bacteria 8966
92 Ga0070665_101282270 3300005548 Unclassified 743
93 Ga0068855_100715795 3300005563 Bacteria 1070
94 Ga0068855_100816784 3300005563 Bacteria 990
95 Ga0068855_100840382 3300005563 Unclassified 974
96 Ga0068855_101151804 3300005563 Bacteria 808
97 Ga0068856_100327104 3300005614 Bacteria 1550
98 Ga0068856_100497442 3300005614 Bacteria 1240
99 Ga0068856_100892951 3300005614 Bacteria 907
100 Ga0070702_100084202 3300005615 Bacteria 1912
101 Ga0070702_101354951 3300005615 Unclassified 580
102 Ga0068852_100438475 3300005616 Bacteria 1291
103 Ga0068852_100631811 3300005616 Bacteria 1077
104 Ga0068864_102652601 3300005618 Bacteria 507
105 Ga0068866_10018223 3300005718 Bacteria 3171
106 Ga0068870_11400583 3300005840 Bacteria 512
107 Ga0068858_100043685 3300005842 Bacteria 4155
108 Ga0068858_100614717 3300005842 Bacteria 1055
109 Ga0068858_101391736 3300005842 Bacteria 691
110 Ga0068860_100087028 3300005843 Bacteria 2974
111 Ga0068862_100027130 3300005844 Bacteria 4819
112 Ga0081455_10059695 3300005937 Bacteria 3219
113 Ga0081455_10086608 3300005937 Unclassified 2551
114 Ga0081455_10373793 3300005937 Bacteria 998
115 Ga0081539_10158146 3300005985 Bacteria 1083
116 Ga0075366_10093602 3300006195 Bacteria 1801
117 Ga0075366_10249370 3300006195 Unclassified 1083
118 Ga0097621_100025326 3300006237 Bacteria 4640
119 Ga0097621_101112139 3300006237 Bacteria 742
120 Ga0068871_100354553 3300006358 Bacteria 1298
121 Ga0068871_100637441 3300006358 Unclassified 972
122 Ga0075428_100220688 3300006844 Bacteria 2047
123 Ga0075428_100343224 3300006844 Unclassified 1603
124 Ga0075428_102255542 3300006844 Bacteria 561
125 Ga0075431_100208346 3300006847 Bacteria 1998
126 Ga0075433_11727421 3300006852 Bacteria 539
127 Ga0075434_102664736 3300006871 Unclassified 500
128 Ga0068865_100002478 3300006881 Bacteria 10926
129 Ga0068865_100846249 3300006881 Bacteria 792
130 Ga0097620_100570252 3300006931 Bacteria 1226
131 Ga0111539_11087121 3300009094 Bacteria 929
132 Ga0111539_13307297 3300009094 Bacteria 519
133 Ga0105245_10014640 3300009098 Bacteria 6831
134 Ga0105247_10016328 3300009101 Bacteria 4448
135 Ga0114129_11243017 3300009147 Bacteria 926
136 Ga0105243_10495624 3300009148 Bacteria 1156
137 Ga0105242_10244171 3300009176 Bacteria 1615
138 Ga0105242_10261693 3300009176 Bacteria 1563
139 Ga0105242_10591994 3300009176 Bacteria 1070
140 Ga0105242_12106602 3300009176 Bacteria 608
141 Ga0105248_10699752 3300009177 Bacteria 1143
142 Ga0105238_10004950 3300009551 Bacteria 13177
143 Ga0105249_10410380 3300009553 Bacteria 1386
144 Ga0105249_11260238 3300009553 Bacteria 811
145 Ga0105239_10045590 3300010375 Bacteria 4805
146 Ga0105239_10951505 3300010375 Bacteria 987
147 Ga0105239_12550292 3300010375 Bacteria 596
148 Ga0105239_13632833 3300010375 Bacteria 501
149 Ga0105246_11401716 3300011119 Bacteria 652
150 Ga0157369_11109805 3300013105 Bacteria 808
151 Ga0157374_10311366 3300013296 Bacteria 1559
152 Ga0157374_10468081 3300013296 Bacteria 1263
153 Ga0157374_10480169 3300013296 Bacteria 1246
154 Ga0157374_11140605 3300013296 Bacteria 800
155 Ga0157378_10119939 3300013297 Bacteria 2423
156 Ga0157378_10312361 3300013297 Bacteria 1525
157 Ga0157378_11655001 3300013297 Bacteria 686
158 Ga0157372_10644332 3300013307 Bacteria 1234
159 Ga0157372_13030803 3300013307 Bacteria 537
160 Ga0163163_12038350 3300014325 Bacteria 633
161 Ga0163163_12277819 3300014325 Bacteria 601
162 Ga0163163_12616284 3300014325 Bacteria 562
163 Ga0157380_10455745 3300014326 Bacteria 1230
164 Ga0157380_11043242 3300014326 Bacteria 853
165 Ga0157377_10454452 3300014745 Bacteria 885
166 Ga0157379_10875605 3300014968 Bacteria 851
167 Ga0157376_10118980 3300014969 Bacteria 2338
168 Ga0157376_10556063 3300014969 Bacteria 1136
169 Ga0157376_10951898 3300014969 Bacteria 879
170 Ga0157376_11058619 3300014969 Bacteria 836
171 Ga0163161_10878933 3300017792 Unclassified 758
172 Ga0206356_10649809 3300020070 Bacteria 1751
173 Ga0206349_1888834 3300020075 Unclassified 573
174 Ga0207697_10021953 3300025315 Bacteria 2615
175 Ga0207692_10013102 3300025898 Bacteria 3588
176 Ga0207692_10944029 3300025898 Unclassified 568
177 Ga0207642_10015467 3300025899 Bacteria 2844
178 Ga0207710_10008087 3300025900 Bacteria 4442
179 Ga0207688_10390850 3300025901 Bacteria 861
180 Ga0207680_10331156 3300025903 Bacteria 1066
181 Ga0207680_10499703 3300025903 Unclassified 866
182 Ga0207680_10556681 3300025903 Bacteria 819
183 Ga0207699_10075790 3300025906 Bacteria 2070
184 Ga0207645_10004684 3300025907 Bacteria 10067
185 Ga0207705_10010661 3300025909 Bacteria 6674
186 Ga0207705_10648561 3300025909 Bacteria 821
187 Ga0207684_11105136 3300025910 Bacteria 660
188 Ga0207707_10080641 3300025912 Bacteria 2842
189 Ga0207707_10167405 3300025912 Bacteria 1921
190 Ga0207695_10327237 3300025913 Bacteria 1421
191 Ga0207660_10108734 3300025917 Unclassified 2083
192 Ga0207662_10030660 3300025918 Unclassified 3122
193 Ga0207662_10030935 3300025918 Bacteria 3110
194 Ga0207657_10270251 3300025919 Unclassified 1351
195 Ga0207649_11580619 3300025920 Unclassified 519
196 Ga0207652_10000360 3300025921 Bacteria 47230
197 Ga0207652_10001885 3300025921 Bacteria 18172
198 Ga0207652_10264839 3300025921 Bacteria 1550
199 Ga0207646_10039380 3300025922 Bacteria 4255
200 Ga0207646_11300229 3300025922 Bacteria 635
201 Ga0207646_11553617 3300025922 Unclassified 572
202 Ga0207681_10002930 3300025923 Bacteria 10773
203 Ga0207694_10066993 3300025924 Bacteria 2802
204 Ga0207650_10035631 3300025925 Bacteria 3616
205 Ga0207659_10681264 3300025926 Bacteria 880
206 Ga0207687_10101637 3300025927 Bacteria 2116
207 Ga0207644_10103741 3300025931 Bacteria 2140
208 Ga0207644_11130521 3300025931 Unclassified 658
209 Ga0207690_10630654 3300025932 Bacteria 877
210 Ga0207706_10038448 3300025933 Bacteria 4245
211 Ga0207686_10294824 3300025934 Bacteria 1202
212 Ga0207686_11428406 3300025934 Bacteria 570
213 Ga0207709_10129544 3300025935 Bacteria 1717
214 Ga0207670_10003609 3300025936 Bacteria 8208
215 Ga0207670_10014878 3300025936 Bacteria 4633
216 Ga0207670_10035113 3300025936 Bacteria 3248
217 Ga0207669_10038520 3300025937 Bacteria 2753
218 Ga0207669_10171750 3300025937 Bacteria 1544
219 Ga0207669_10353674 3300025937 Bacteria 1136
220 Ga0207704_10001642 3300025938 Bacteria 10037
221 Ga0207691_10257872 3300025940 Bacteria 1503
222 Ga0207711_10471689 3300025941 Bacteria 1169
223 Ga0207711_10490680 3300025941 Bacteria 1144
224 Ga0207689_10051614 3300025942 Bacteria 3390
225 Ga0207661_10176867 3300025944 Bacteria 1861
226 Ga0207661_10294990 3300025944 Unclassified 1452
227 Ga0207661_10486092 3300025944 Bacteria 1127
228 Ga0207667_10195523 3300025949 Bacteria 2075
229 Ga0207667_10273233 3300025949 Unclassified 1727
230 Ga0207667_11571339 3300025949 Bacteria 627
231 Ga0207651_10000484 3300025960 Bacteria 16760
232 Ga0207651_10205110 3300025960 Bacteria 1583
233 Ga0207712_10342196 3300025961 Bacteria 1241
234 Ga0207712_11858410 3300025961 Bacteria 539
235 Ga0207668_10042568 3300025972 Bacteria 3076
236 Ga0207668_10252978 3300025972 Bacteria 1432
237 Ga0207640_11634366 3300025981 Unclassified 581
238 Ga0207658_11743986 3300025986 Unclassified 568
239 Ga0207677_10211661 3300026023 Bacteria 1549
240 Ga0207677_10214821 3300026023 Bacteria 1539
241 Ga0207703_10115620 3300026035 Bacteria 2296
242 Ga0207703_12419472 3300026035 Bacteria 501
243 Ga0207678_11020010 3300026067 Unclassified 732
244 Ga0207708_10004142 3300026075 Bacteria 10667
245 Ga0207708_10833998 3300026075 Bacteria 795
246 Ga0207708_11585125 3300026075 Bacteria 575
247 Ga0207702_10187036 3300026078 Bacteria 1911
248 Ga0207702_10454185 3300026078 Bacteria 1244
249 Ga0207641_10265597 3300026088 Bacteria 1608
250 Ga0207648_10028413 3300026089 Bacteria 4959
251 Ga0207648_11810319 3300026089 Bacteria 572
252 Ga0207676_11045386 3300026095 Unclassified 806
253 Ga0207676_11106155 3300026095 Bacteria 783
254 Ga0207674_10833672 3300026116 Bacteria 889
255 Ga0207683_10452113 3300026121 Bacteria 1184
256 Ga0207698_10604720 3300026142 Bacteria 1081
257 Ga0207698_11751924 3300026142 Bacteria 636
258 Ga0207698_12601875 3300026142 Unclassified 515
259 Ga0210002_1040030 3300027617 Unclassified 795
260 Ga0268266_10001935 3300028379 Bacteria 23297
261 Ga0268265_10947935 3300028380 Bacteria 848
262 Ga0268264_10150138 3300028381 Bacteria 2088
263 Ga0265326_10187299 3300028558 Unclassified 593
264 Ga0265319_1057625 3300028563 Unclassified 1267
265 Ga0265319_1140138 3300028563 Unclassified 750
266 Ga0265334_10031817 3300028573 Bacteria 2106
267 Ga0265336_10147315 3300028666 Unclassified 700
268 Ga0307515_10836213 3300028794 Bacteria 546
269 Ga0265338_10009440 3300028800 Bacteria 11627
270 Ga0265338_10086106 3300028800 Bacteria 2617
271 Ga0265338_10118251 3300028800 Bacteria 2118
272 Ga0265338_10467473 3300028800 Bacteria 891
273 Ga0307511_10003700 3300030521 Bacteria 15635
274 Ga0265762_1171881 3300030760 Bacteria 528
275 Ga0265766_1024722 3300030863 Bacteria 512
276 Ga0265332_10005390 3300031238 Bacteria 5903
277 Ga0265328_10000547 3300031239 Bacteria 17495
278 Ga0265320_10060216 3300031240 Bacteria 1813
279 Ga0265329_10096248 3300031242 Unclassified 941
280 Ga0265339_10000814 3300031249 Bacteria 24088
281 Ga0265339_10005010 3300031249 Bacteria 8912
282 Ga0265339_10006602 3300031249 Bacteria 7592
283 Ga0265339_10211689 3300031249 Bacteria 952
284 Ga0265331_10099275 3300031250 Bacteria 1341
285 Ga0265316_10012776 3300031344 Bacteria 7502
286 Ga0307408_101019649 3300031548 Bacteria 764
287 Ga0265313_10007288 3300031595 Bacteria 7593
288 Ga0265313_10040160 3300031595 Bacteria 2315
289 Ga0307514_10024515 3300031649 Bacteria 4884
290 Ga0265314_10000001 3300031711 Bacteria 3792860
291 Ga0265314_10009101 3300031711 Bacteria 8434
292 Ga0265314_10069043 3300031711 Bacteria 2373
293 Ga0265342_10000516 3300031712 Bacteria 41275
294 Ga0265342_10001028 3300031712 Bacteria 27405
295 Ga0316576_10623704 3300031727 Bacteria 786
296 Ga0307405_11702427 3300031731 Bacteria 559
297 Ga0307413_10798902 3300031824 Bacteria 793
298 Ga0307413_11856943 3300031824 Bacteria 540
299 Ga0307406_10009467 3300031901 Bacteria 5464
300 Ga0307406_10016753 3300031901 Bacteria 4263
301 Ga0307407_10244969 3300031903 Bacteria 1225
302 Ga0307412_10008938 3300031911 Bacteria 5738
303 Ga0316588_1146196 3300033528 Unclassified 605
304 Ga0373948_0185663 3300034817 Bacteria 536
305 Ga0373926_0430681 3300035083 Unclassified 522
306 Ga0373923_0109712 3300035111 Bacteria 1224
307 Ga0373923_0129015 3300035111 Bacteria 1135
308 Ga0373936_0421144 3300035113 Unclassified 615
309 Ga0373945_0332543 3300035116 Bacteria 656
310 Ga0373953_0199919 3300035117 Bacteria 864
311 Ga0373954_0030691 3300035118 Bacteria 2479
312 Ga0373956_0006448 3300035119 Bacteria 4704
313 Ga0373956_0027559 3300035119 Bacteria 2467
314 Ga0373956_0165220 3300035119 Bacteria 1044
315 Ga0373957_0072287 3300035120 Bacteria 1351
316 Ga0373957_0093067 3300035120 Unclassified 1200
317 Ga0373960_0270474 3300035121 Unclassified 623
318 Ga0373943_0052723 3300035170 Bacteria 2006
319 Ga0373943_0349159 3300035170 Bacteria 847
320 Ga0373955_0024942 3300035172 Bacteria 3064
321 Ga0373955_0335771 3300035172 Bacteria 914
322 Ga0373955_0404189 3300035172 Bacteria 830
323 Ga0316574_0688845 3300035398 Bacteria 627
324 Ga0373924_0486760 3300035410 Unclassified 554
325 Ga0373935_0752445 3300035692 Unclassified 718
326 Ga0373935_1172319 3300035692 Bacteria 572
327 Ga0373927_0028289 3300035695 Bacteria 3656
328 Ga0373933_0007290 3300035724 Bacteria 6031
329 Ga0373947_0119527 3300035725 Bacteria 1673
330 Ga0373937_0006468 3300036401 Bacteria 10109
331 Ga0373937_0028891 3300036401 Bacteria 5021
332 Ga0373937_0074547 3300036401 Bacteria 3132
333 Ga0373937_0526276 3300036401 Unclassified 1123
334 Ga0373925_0311518 3300037068 Bacteria 1272
335 Ga0395905_0430530 3300037471 Bacteria 1216
336 Ga0395905_0651471 3300037471 Bacteria 955
337 Ga0436360_0891124 3300039438 Bacteria 652
338 Ga0436360_1275643 3300039438 Bacteria 903
339 Ga0436361_0191127 3300039447 Bacteria 836
340 Ga0436363_0272420 3300039450 Bacteria 503
341 Ga0436362_0661266 3300039453 Bacteria 507
342 Ga0436362_1172253 3300039453 Bacteria 623
343 Ga0439465_0008321 3300041413 Bacteria 3273
344 Ga0451794_16987 3300041446 Bacteria 604
345 Ga0451797_0746618 3300041453 Bacteria 541
346 Ga0451800_0273962 3300041459 Bacteria 878
347 Ga0451800_1558869 3300041459 Bacteria 955
348 Ga0451807_2194440 3300041486 Bacteria 1188
349 Ga0451837_1678537 3300041494 Bacteria 780
350 Ga0451839_0466753 3300041496 Bacteria 507
351 Ga0451847_0667574 3300041503 Bacteria 553
352 Ga0451849_0600664 3300041505 Unclassified 2584
353 Ga0451843_0663320 3300041509 Unclassified 1120
354 Ga0451855_1201734 3300041511 Unclassified 878
355 Ga0451853_0601611 3300041512 Bacteria 816
356 Ga0451853_1759616 3300041512 Bacteria 27396
357 Ga0451853_3832943 3300041512 Bacteria 709
358 Ga0451853_3842606 3300041512 Bacteria 1529
359 Ga0439445_0030244 3300042004 Bacteria 1403
360 Ga0439434_0217437 3300042435 Bacteria 648
361 Ga0451577_0066385 3300042876 Bacteria 3218
362 Ga0451577_0117032 3300042876 Bacteria 2387
363 Ga0451577_0177995 3300042876 Bacteria 1917
364 Ga0451577_0401782 3300042876 Bacteria 1243
365 Ga0451577_0409783 3300042876 Bacteria 1230
366 Ga0451577_0566313 3300042876 Bacteria 1031
367 Ga0451577_0805048 3300042876 Bacteria 849
368 Ga0451577_1126155 3300042876 Bacteria 702
369 Ga0451577_1980054 3300042876 Unclassified 509
370 Ga0466972_0446932 3300044658 Bacteria 607
371 Ga0453683_0002373 3300044673 Bacteria 14721
372 Ga0453683_0023842 3300044673 Bacteria 3897
373 Ga0453683_0028649 3300044673 Bacteria 3525
374 Ga0453683_0036600 3300044673 Bacteria 3089
375 Ga0453683_0368847 3300044673 Bacteria 923
376 Ga0453683_0481481 3300044673 Bacteria 804
377 Ga0453684_0000082 3300044712 Bacteria 399380
378 Ga0453684_0001048 3300044712 Bacteria 88382
379 Ga0453684_0001308 3300044712 Bacteria 73691
380 Ga0453684_0002592 3300044712 Bacteria 43253
381 Ga0453684_0060439 3300044712 Bacteria 4873
382 Ga0453684_0061490 3300044712 Bacteria 4820
383 Ga0453684_0072781 3300044712 Bacteria 4336
384 Ga0453684_0077572 3300044712 Bacteria 4162
385 Ga0453684_0183611 3300044712 Bacteria 2453
386 Ga0453684_0205913 3300044712 Bacteria 2290
387 Ga0453684_0527012 3300044712 Bacteria 1304
388 Ga0453684_0891090 3300044712 Bacteria 953
389 Ga0453684_1156846 3300044712 Bacteria 814
390 Ga0466960_0634830 3300044901 Bacteria 636
391 Ga0451576_0008790 3300045051 Bacteria 11814
392 Ga0451576_0010049 3300045051 Bacteria 10897
393 Ga0451576_0039861 3300045051 Bacteria 4973
394 Ga0451576_0253366 3300045051 Bacteria 1840
395 Ga0451576_0260354 3300045051 Bacteria 1813
396 Ga0451576_0340074 3300045051 Bacteria 1571
397 Ga0451576_0556339 3300045051 Bacteria 1205
398 Ga0451576_0684768 3300045051 Bacteria 1077
399 Ga0451576_1938125 3300045051 Bacteria 607
400 Ga0451576_2249749 3300045051 Bacteria 559
401 Ga0495651_0876107 3300046462 Unclassified 550
402 Ga0495662_0236033 3300046476 Archaea 901
403 Ga0495640_0805165 3300046533 Unclassified 560
404 Ga0495622_0105999 3300046557 Unclassified 1288
405 Ga0495667_0406792 3300046559 Unclassified 857
406 Ga0495667_0763891 3300046559 Unclassified 597
407 Ga0495668_0738243 3300046616 Bacteria 545
408 Ga0495635_0598396 3300046663 Bacteria 720
409 Ga0495657_0417208 3300046675 Bacteria 788
410 Ga0495657_0811407 3300046675 Bacteria 534
411 Ga0495658_0761998 3300046683 Unclassified 620
412 Ga0495604_0452179 3300047317 Unclassified 839
413 Ga0495680_0242390 3300047322 Bacteria 1280
414 Ga0495680_0248537 3300047322 Unclassified 1261
415 Ga0495686_0020684 3300047472 Bacteria 4386
416 Ga0496100_0671070 3300048903 Unclassified 808
417 Ga0496104_0335929 3300048907 Bacteria 1424
418 Ga0496104_1229533 3300048907 Bacteria 652
419 Ga0496104_1422235 3300048907 Bacteria 596
420 Ga0496108_0104858 3300048911 Unclassified 2413
421 Ga0496108_0548208 3300048911 Bacteria 1009
422 Ga0496109_1557934 3300048912 Bacteria 595
423 Ga0496110_0326720 3300048913 Unclassified 1397
424 Ga0496112_0027700 3300048915 Bacteria 5465
425 Ga0496112_1371944 3300048915 Unclassified 622
426 Ga0496112_1532116 3300048915 Bacteria 580
427 Ga0496113_0880416 3300048916 Bacteria 709
428 Ga0496115_0101075 3300048918 Bacteria 2364
429 Ga0496115_1419543 3300048918 Bacteria 512
430 Ga0496123_0217571 3300048926 Bacteria 966
431 Ga0501312_064241 3300049528 Bacteria 640
432 Ga0501312_081231 3300049528 Bacteria 587
433 Ga0501032_0086291 3300049569 Bacteria 2086
434 Ga0501034_0439301 3300049571 Bacteria 1224
435 Ga0501034_0865761 3300049571 Bacteria 793
436 Ga0501037_0488353 3300049573 Unclassified 836
437 Ga0501038_0235730 3300049574 Bacteria 1454
438 Ga0501043_0019752 3300049579 Bacteria 5291
439 Ga0501047_0001215 3300049581 Bacteria 25539
440 Ga0501047_0058279 3300049581 Bacteria 3731
441 Ga0501048_0137615 3300049582 Bacteria 1726
442 Ga0501067_0000389 3300049583 Bacteria 23907
443 Ga0501067_0004630 3300049583 Bacteria 7620
444 Ga0501067_0082007 3300049583 Bacteria 1788
445 Ga0501068_0000260 3300049584 Bacteria 26078
446 Ga0501068_0025539 3300049584 Bacteria 3475
447 Ga0501068_0028275 3300049584 Bacteria 3315
448 Ga0501068_0117202 3300049584 Bacteria 1659
449 Ga0501068_0942297 3300049584 Bacteria 569
450 Ga0501069_0007698 3300049585 Bacteria 5651
451 Ga0501070_0131924 3300049586 Bacteria 2063
452 Ga0501070_0904102 3300049586 Bacteria 688
453 Ga0501071_0932309 3300049587 Bacteria 670
454 Ga0501072_0000029 3300049588 Bacteria 134083
455 Ga0501072_0047336 3300049588 Unclassified 3387
456 Ga0501073_0004013 3300049589 Bacteria 11054
457 Ga0501073_0023129 3300049589 Bacteria 4467
458 Ga0501073_0195312 3300049589 Bacteria 1400
459 Ga0501073_0249108 3300049589 Bacteria 1226
460 Ga0501074_0011769 3300049590 Bacteria 6359
461 Ga0501074_0075401 3300049590 Bacteria 2421
462 Ga0501074_0115472 3300049590 Bacteria 1921
463 Ga0501074_0155340 3300049590 Unclassified 1635
464 Ga0501074_0897379 3300049590 Bacteria 624
465 Ga0501075_0935974 3300049591 Unclassified 659
466 Ga0501076_0017901 3300049592 Bacteria 5388
467 Ga0501076_0055424 3300049592 Bacteria 3144
468 Ga0501077_0055358 3300049593 Bacteria 2518
469 Ga0501079_0008659 3300049741 Bacteria 7716
470 Ga0501080_0001990 3300049742 Bacteria 17625
471 Ga0501080_0023382 3300049742 Bacteria 5729
472 Ga0501080_0277003 3300049742 Unclassified 1526
473 Ga0501080_0313098 3300049742 Bacteria 1422
474 Ga0501080_0491561 3300049742 Bacteria 1097
475 Ga0501081_0324668 3300049743 Bacteria 1132
476 Ga0501083_0001939 3300049744 Bacteria 14232
477 Ga0501083_0006810 3300049744 Bacteria 8112
478 Ga0501083_0008850 3300049744 Bacteria 7108
479 Ga0501083_0026398 3300049744 Bacteria 4014
480 Ga0501083_0071247 3300049744 Bacteria 2311
481 Ga0501083_0118798 3300049744 Archaea 1734
482 Ga0501083_0646020 3300049744 Bacteria 688
483 Ga0501263_032218 3300049760 Bacteria 744
484 Ga0501044_0001690 3300049823 Bacteria 25921
485 Ga0501044_0219176 3300049823 Unclassified 1854
486 nmdc:mga06r32_460050_c1 3300050510 Bacteria 1251
487 nmdc:mga08y16_107346_c1 3300050511 Bacteria 2906
488 nmdc:mga08y16_1303628_c1 3300050511 Bacteria 693
489 Ga0495601_0204531 3300053077 Bacteria 1290
490 Ga0495601_0325757 3300053077 Bacteria 1000
491 Ga0495601_0775653 3300053077 Unclassified 609
492 Ga0500655_029481 3300053133 Bacteria 1053
493 Ga0500568_0004574 3300053139 Bacteria 7370
494 Ga0501084_0000018 3300054114 Bacteria 147013
495 Ga0501084_0001201 3300054114 Bacteria 20295
496 Ga0501084_0010255 3300054114 Bacteria 7753
497 Ga0501084_0017867 3300054114 Bacteria 5903
498 Ga0501084_0471226 3300054114 Bacteria 1061
499 Ga0590071_088801 3300059421 Bacteria 772
500 Ga0590074_053271 3300059423 Bacteria 743
501 Ga0587084_042489 3300059477 Bacteria 778
502 Ga0587085_084102 3300059506 Bacteria 646
503 Ga0587076_118675 3300059645 Bacteria 610
504 Ga0587078_067861 3300059646 Bacteria 552
505 Ga0501082_0000287 3300060353 Bacteria 44479
506 Ga0501082_0030161 3300060353 Bacteria 4674
507 Ga0501082_0056039 3300060353 Bacteria 3395
508 Ga0501082_0056351 3300060353 Bacteria 3385
509 Ga0530510_0615470 3300061734 Unclassified 826
510 Ga0207705_11169739
511 Ga0006763J43179_107734
512 Ga0006759J45824_1006064
513 Ga0006758J48902_1019475
514 rootH1_10077254
515 rootH1_10288592
516 Ga0032354_1031084
517 Ga0058858_1379739
518 Ga0058859_11551521
519 Ga0058860_11846079
520 Ga0058860_12057947
521 Ga0058860_12102671
522 Ga0058862_10075690
523 Ga0065715_10577474
524 Ga0070658_10044642
525 Ga0070658_11121144
526 Ga0070676_10010085
527 Ga0070683_100227111
528 Ga0070683_100291078
529 Ga0070683_101126882
530 Ga0070690_100001442
531 Ga0070690_100003920
532 Ga0070670_100522217
533 Ga0068869_101225414
534 Ga0070666_10087814
535 Ga0070666_10135707
536 Ga0070666_11350574
537 Ga0070680_100040653
538 Ga0070680_100385429
539 Ga0068868_100213350
540 Ga0068868_100240580
541 Ga0070660_100334669
542 Ga0070660_100840306
543 Ga0070689_100003803
544 Ga0070689_100067538
545 Ga0070687_100029373
546 Ga0070661_100776923
547 Ga0070692_10009790
548 Ga0070692_10752199
549 Ga0070692_11240206
550 Ga0070668_100552362
551 Ga0070668_102018855
552 Ga0070675_101169073
553 Ga0070671_100180443
554 Ga0070674_101822217
555 Ga0070673_100100750
556 Ga0070673_100490822
557 Ga0070673_101822636
558 Ga0070688_100018368
559 Ga0070659_100645682
560 Ga0070667_100191068
561 Ga0070667_100661505
562 Ga0070709_10101459
563 Ga0070714_100037927
564 Ga0070713_100557502
565 Ga0070710_10017455
566 Ga0070701_10019365
567 Ga0070711_100148595
568 Ga0070705_100065309
569 Ga0070705_100425298
570 Ga0070700_100002550
571 Ga0070694_100037883
572 Ga0070694_100243565
573 Ga0070708_101450074
574 Ga0070663_100784630
575 Ga0070678_100011023
576 Ga0070662_100032461
577 Ga0070681_10070703
578 Ga0070681_11716214
579 Ga0068867_100007894
580 Ga0068867_100058006
581 Ga0068867_101476219
582 Ga0070685_10021579
583 Ga0070685_10358398
584 Ga0070685_10385932
585 Ga0070706_100039098
586 Ga0070707_100038749
587 Ga0070707_100281829
588 Ga0070707_101846261
589 Ga0070679_100004235
590 Ga0070679_100188629
591 Ga0070684_100081070
592 Ga0070684_100115190
593 Ga0070684_100157933
594 Ga0070684_100377089
595 Ga0068853_100185938
596 Ga0070686_100081212
597 Ga0070686_100148529
598 Ga0070693_100176087
599 Ga0070693_101505718
600 Ga0070665_100011455
601 Ga0070665_101282270
602 Ga0068855_100715795
603 Ga0068855_100816784
604 Ga0068855_100840382
605 Ga0068855_101151804
606 Ga0068856_100327104
607 Ga0068856_100497442
608 Ga0068856_100892951
609 Ga0070702_100084202
610 Ga0070702_101354951
611 Ga0068852_100438475
612 Ga0068852_100631811
613 Ga0068864_102652601
614 Ga0068866_10018223
615 Ga0068870_11400583
616 Ga0068858_100043685
617 Ga0068858_100614717
618 Ga0068858_101391736
619 Ga0068860_100087028
620 Ga0068862_100027130
621 Ga0081455_10059695
622 Ga0081455_10086608
623 Ga0081455_10373793
624 Ga0081539_10158146
625 Ga0075366_10093602
626 Ga0075366_10249370
627 Ga0097621_100025326
628 Ga0097621_101112139
629 Ga0068871_100354553
630 Ga0068871_100637441
631 Ga0075428_100220688
632 Ga0075428_100343224
633 Ga0075428_102255542
634 Ga0075431_100208346
635 Ga0075433_11727421
636 Ga0075434_102664736
637 Ga0068865_100002478
638 Ga0068865_100846249
639 Ga0097620_100570252
640 Ga0111539_11087121
641 Ga0111539_13307297
642 Ga0105245_10014640
643 Ga0105247_10016328
644 Ga0114129_11243017
645 Ga0105243_10495624
646 Ga0105242_10244171
647 Ga0105242_10261693
648 Ga0105242_10591994
649 Ga0105242_12106602
650 Ga0105248_10699752
651 Ga0105238_10004950
652 Ga0105249_10410380
653 Ga0105249_11260238
654 Ga0105239_10045590
655 Ga0105239_10951505
656 Ga0105239_12550292
657 Ga0105239_13632833
658 Ga0105246_11401716
659 Ga0157369_11109805
660 Ga0157374_10311366
661 Ga0157374_10468081
662 Ga0157374_10480169
663 Ga0157374_11140605
664 Ga0157378_10119939
665 Ga0157378_10312361
666 Ga0157378_11655001
667 Ga0157372_10644332
668 Ga0157372_13030803
669 Ga0163163_12038350
670 Ga0163163_12277819
671 Ga0163163_12616284
672 Ga0157380_10455745
673 Ga0157380_11043242
674 Ga0157377_10454452
675 Ga0157379_10875605
676 Ga0157376_10118980
677 Ga0157376_10556063
678 Ga0157376_10951898
679 Ga0157376_11058619
680 Ga0163161_10878933
681 Ga0206356_10649809
682 Ga0206349_1888834
683 Ga0207697_10021953
684 Ga0207692_10013102
685 Ga0207692_10944029
686 Ga0207642_10015467
687 Ga0207710_10008087
688 Ga0207688_10390850
689 Ga0207680_10331156
690 Ga0207680_10499703
691 Ga0207680_10556681
692 Ga0207699_10075790
693 Ga0207645_10004684
694 Ga0207705_10010661
695 Ga0207705_10648561
696 Ga0207684_11105136
697 Ga0207707_10080641
698 Ga0207707_10167405
699 Ga0207695_10327237
700 Ga0207660_10108734
701 Ga0207662_10030660
702 Ga0207662_10030935
703 Ga0207657_10270251
704 Ga0207649_11580619
705 Ga0207652_10000360
706 Ga0207652_10001885
707 Ga0207652_10264839
708 Ga0207646_10039380
709 Ga0207646_11300229
710 Ga0207646_11553617
711 Ga0207681_10002930
712 Ga0207694_10066993
713 Ga0207650_10035631
714 Ga0207659_10681264
715 Ga0207687_10101637
716 Ga0207644_10103741
717 Ga0207644_11130521
718 Ga0207690_10630654
719 Ga0207706_10038448
720 Ga0207686_10294824
721 Ga0207686_11428406
722 Ga0207709_10129544
723 Ga0207670_10003609
724 Ga0207670_10014878
725 Ga0207670_10035113
726 Ga0207669_10038520
727 Ga0207669_10171750
728 Ga0207669_10353674
729 Ga0207704_10001642
730 Ga0207691_10257872
731 Ga0207711_10471689
732 Ga0207711_10490680
733 Ga0207689_10051614
734 Ga0207661_10176867
735 Ga0207661_10294990
736 Ga0207661_10486092
737 Ga0207667_10195523
738 Ga0207667_10273233
739 Ga0207667_11571339
740 Ga0207651_10000484
741 Ga0207651_10205110
742 Ga0207712_10342196
743 Ga0207712_11858410
744 Ga0207668_10042568
745 Ga0207668_10252978
746 Ga0207640_11634366
747 Ga0207658_11743986
748 Ga0207677_10211661
749 Ga0207677_10214821
750 Ga0207703_10115620
751 Ga0207703_12419472
752 Ga0207678_11020010
753 Ga0207708_10004142
754 Ga0207708_10833998
755 Ga0207708_11585125
756 Ga0207702_10187036
757 Ga0207702_10454185
758 Ga0207641_10265597
759 Ga0207648_10028413
760 Ga0207648_11810319
761 Ga0207676_11045386
762 Ga0207676_11106155
763 Ga0207674_10833672
764 Ga0207683_10452113
765 Ga0207698_10604720
766 Ga0207698_11751924
767 Ga0207698_12601875
768 Ga0210002_1040030
769 Ga0268266_10001935
770 Ga0268265_10947935
771 Ga0268264_10150138
772 Ga0265326_10187299
773 Ga0265319_1057625
774 Ga0265319_1140138
775 Ga0265334_10031817
776 Ga0265336_10147315
777 Ga0307515_10836213
778 Ga0265338_10009440
779 Ga0265338_10086106
780 Ga0265338_10118251
781 Ga0265338_10467473
782 Ga0307511_10003700
783 Ga0265762_1171881
784 Ga0265766_1024722
785 Ga0265332_10005390
786 Ga0265328_10000547
787 Ga0265320_10060216
788 Ga0265329_10096248
789 Ga0265339_10000814
790 Ga0265339_10005010
791 Ga0265339_10006602
792 Ga0265339_10211689
793 Ga0265331_10099275
794 Ga0265316_10012776
795 Ga0307408_101019649
796 Ga0265313_10007288
797 Ga0265313_10040160
798 Ga0307514_10024515
799 Ga0265314_10000001
800 Ga0265314_10009101
801 Ga0265314_10069043
802 Ga0265342_10000516
803 Ga0265342_10001028
804 Ga0316576_10623704
805 Ga0307405_11702427
806 Ga0307413_10798902
807 Ga0307413_11856943
808 Ga0307406_10009467
809 Ga0307406_10016753
810 Ga0307407_10244969
811 Ga0307412_10008938
812 Ga0316588_1146196
813 Ga0373948_0185663
814 Ga0373926_0430681
815 Ga0373923_0109712
816 Ga0373923_0129015
817 Ga0373936_0421144
818 Ga0373945_0332543
819 Ga0373953_0199919
820 Ga0373954_0030691
821 Ga0373956_0006448
822 Ga0373956_0027559
823 Ga0373956_0165220
824 Ga0373957_0072287
825 Ga0373957_0093067
826 Ga0373960_0270474
827 Ga0373943_0052723
828 Ga0373943_0349159
829 Ga0373955_0024942
830 Ga0373955_0335771
831 Ga0373955_0404189
832 Ga0316574_0688845
833 Ga0373924_0486760
834 Ga0373935_0752445
835 Ga0373935_1172319
836 Ga0373927_0028289
837 Ga0373933_0007290
838 Ga0373947_0119527
839 Ga0373937_0006468
840 Ga0373937_0028891
841 Ga0373937_0074547
842 Ga0373937_0526276
843 Ga0373925_0311518
844 Ga0395905_0430530
845 Ga0395905_0651471
846 Ga0436360_0891124
847 Ga0436360_1275643
848 Ga0436361_0191127
849 Ga0436363_0272420
850 Ga0436362_0661266
851 Ga0436362_1172253
852 Ga0439465_0008321
853 Ga0451794_16987
854 Ga0451797_0746618
855 Ga0451800_0273962
856 Ga0451800_1558869
857 Ga0451807_2194440
858 Ga0451837_1678537
859 Ga0451839_0466753
860 Ga0451847_0667574
861 Ga0451849_0600664
862 Ga0451843_0663320
863 Ga0451855_1201734
864 Ga0451853_0601611
865 Ga0451853_1759616
866 Ga0451853_3832943
867 Ga0451853_3842606
868 Ga0439445_0030244
869 Ga0439434_0217437
870 Ga0451577_0066385
871 Ga0451577_0117032
872 Ga0451577_0177995
873 Ga0451577_0401782
874 Ga0451577_0409783
875 Ga0451577_0566313
876 Ga0451577_0805048
877 Ga0451577_1126155
878 Ga0451577_1980054
879 Ga0466972_0446932
880 Ga0453683_0002373
881 Ga0453683_0023842
882 Ga0453683_0028649
883 Ga0453683_0036600
884 Ga0453683_0368847
885 Ga0453683_0481481
886 Ga0453684_0000082
887 Ga0453684_0001048
888 Ga0453684_0001308
889 Ga0453684_0002592
890 Ga0453684_0060439
891 Ga0453684_0061490
892 Ga0453684_0072781
893 Ga0453684_0077572
894 Ga0453684_0183611
895 Ga0453684_0205913
896 Ga0453684_0527012
897 Ga0453684_0891090
898 Ga0453684_1156846
899 Ga0466960_0634830
900 Ga0451576_0008790
901 Ga0451576_0010049
902 Ga0451576_0039861
903 Ga0451576_0253366
904 Ga0451576_0260354
905 Ga0451576_0340074
906 Ga0451576_0556339
907 Ga0451576_0684768
908 Ga0451576_1938125
909 Ga0451576_2249749
910 Ga0495651_0876107
911 Ga0495662_0236033
912 Ga0495640_0805165
913 Ga0495622_0105999
914 Ga0495667_0406792
915 Ga0495667_0763891
916 Ga0495668_0738243
917 Ga0495635_0598396
918 Ga0495657_0417208
919 Ga0495657_0811407
920 Ga0495658_0761998
921 Ga0495604_0452179
922 Ga0495680_0242390
923 Ga0495680_0248537
924 Ga0495686_0020684
925 Ga0496100_0671070
926 Ga0496104_0335929
927 Ga0496104_1229533
928 Ga0496104_1422235
929 Ga0496108_0104858
930 Ga0496108_0548208
931 Ga0496109_1557934
932 Ga0496110_0326720
933 Ga0496112_0027700
934 Ga0496112_1371944
935 Ga0496112_1532116
936 Ga0496113_0880416
937 Ga0496115_0101075
938 Ga0496115_1419543
939 Ga0496123_0217571
940 Ga0501312_064241
941 Ga0501312_081231
942 Ga0501032_0086291
943 Ga0501034_0439301
944 Ga0501034_0865761
945 Ga0501037_0488353
946 Ga0501038_0235730
947 Ga0501043_0019752
948 Ga0501047_0001215
949 Ga0501047_0058279
950 Ga0501048_0137615
951 Ga0501067_0000389
952 Ga0501067_0004630
953 Ga0501067_0082007
954 Ga0501068_0000260
955 Ga0501068_0025539
956 Ga0501068_0028275
957 Ga0501068_0117202
958 Ga0501068_0942297
959 Ga0501069_0007698
960 Ga0501070_0131924
961 Ga0501070_0904102
962 Ga0501071_0932309
963 Ga0501072_0000029
964 Ga0501072_0047336
965 Ga0501073_0004013
966 Ga0501073_0023129
967 Ga0501073_0195312
968 Ga0501073_0249108
969 Ga0501074_0011769
970 Ga0501074_0075401
971 Ga0501074_0115472
972 Ga0501074_0155340
973 Ga0501074_0897379
974 Ga0501075_0935974
975 Ga0501076_0017901
976 Ga0501076_0055424
977 Ga0501077_0055358
978 Ga0501079_0008659
979 Ga0501080_0001990
980 Ga0501080_0023382
981 Ga0501080_0277003
982 Ga0501080_0313098
983 Ga0501080_0491561
984 Ga0501081_0324668
985 Ga0501083_0001939
986 Ga0501083_0006810
987 Ga0501083_0008850
988 Ga0501083_0026398
989 Ga0501083_0071247
990 Ga0501083_0118798
991 Ga0501083_0646020
992 Ga0501263_032218
993 Ga0501044_0001690
994 Ga0501044_0219176
995 nmdc:mga06r32_460050_c1
996 nmdc:mga08y16_107346_c1
997 nmdc:mga08y16_1303628_c1
998 Ga0495601_0204531
999 Ga0495601_0325757
1000 Ga0495601_0775653
1001 Ga0500655_029481
1002 Ga0500568_0004574
1003 Ga0501084_0000018
1004 Ga0501084_0001201
1005 Ga0501084_0010255
1006 Ga0501084_0017867
1007 Ga0501084_0471226
1008 Ga0590071_088801
1009 Ga0590074_053271
1010 Ga0587084_042489
1011 Ga0587085_084102
1012 Ga0587076_118675
1013 Ga0587078_067861
1014 Ga0501082_0000287
1015 Ga0501082_0030161
1016 Ga0501082_0056039
1017 Ga0501082_0056351
1018 Ga0530510_0615470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

78

113

0.97

PF21157

DksA_N

DnaK suppressor protein DksA, N-terminal domain

5

75

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.9011 6 119
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.833 6 119
7khe-assembly1.cif.gz_M escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp 0.773 6 125
4ijj-assembly1.cif.gz_A structure of transcription factor dksa2 from pseudomonas aeruginosa 0.7547 8 122
4ijj-assembly3.cif.gz_C structure of transcription factor dksa2 from pseudomonas aeruginosa 0.745 1 122
ID Description Score Start End Superfamily
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.7547 8 122 1.20.120.910
1tjlB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.7175 6 125 1.20.120.910
1tjlB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6823 6 125 1.20.120.910
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6822 8 122 1.20.120.910
2kq9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6651 4 116 1.20.120.910
ID Description Score Start End GO Terms
AF-A0A1V4X305-F1-model_v4 General stress protein 16O 0.8415 6 121 GO:0008270
AF-A0A1F5V074-F1-model_v4 Zinc finger DksA/TraR C4-type domain-containing protein 0.8401 2 116 GO:0008270
AF-A0A1V4X305-F1-model_v4 General stress protein 16O 0.8279 6 121 GO:0008270
AF-A0A7C6AL52-F1-model_v4 TraR/DksA family transcriptional regulator 0.8274 6 124 GO:0008270
AF-A0A2M7H953-F1-model_v4 RNA polymerase-binding protein DksA 0.8246 4 124 GO:0005737
GO:0008270

Map