F457013

General Info

Members Datasets Scaffolds Average Seq Length
509 256 1018 136

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0652304|Ga0395905_0652304_87_497
Length 129
Sequence MSEAAKKSRPQYSNIHVTQIIQYRMPLAAWVSILHRISGVLMFLLLPFVLYLLEQSLTSEVSFAYLHDIVAHPIAKLVILAHFCAGIRHLFMDMHMGLSKDGSRHSAFSVLAISLFLTLLVALKLFGAY

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
92 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
112 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
113 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
218 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
221 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
222 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
223 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
234 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
235 2643221638 Duganella sp. Root336D2 Isolate Unclassified
236 2643221645 Massilia sp. Root351 Isolate Unclassified
237 2643221664 Massilia sp. Root418 Isolate Unclassified
238 2738541280 Massilia sp. GV090 Isolate Unclassified
239 2738541297 Duganella sp. GV083 Isolate Unclassified
240 2738541300 Massilia sp. GV016 Isolate Unclassified
241 2738541357 Duganella sp. GV053 Isolate Unclassified
242 2738543003 Duganella sp. GV066 Isolate Unclassified
243 2738543018 Massilia sp. GV045 Isolate Unclassified
244 2738543026 Duganella sp. GV089 Isolate Unclassified
245 2738543029 Duganella sp. GV039 Isolate Unclassified
246 2738543030 Massilia sp. GV097 Isolate Unclassified
247 2821131069 Duganella sp. 1224 Isolate Unclassified
248 2842711865 Duganella sp. R-73148 Isolate Unclassified
249 2857553236 Duganella sp. R-74557 Isolate Unclassified
250 2857558681 Duganella sp. R-74565 Isolate Unclassified
251 2857564685 Duganella sp. R-74599 Isolate Unclassified
252 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
253 2904424332 Duganella sp. 1411 Isolate Rhizosphere
254 2919476304 Duganella sp. 3397 Isolate Unclassified
255 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
256 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.68
Metatranscriptomes 10.61
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.06
Nodule 0.79
Rhizoplane 4.13
Rhizosphere 66.4
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0652304 3300037471 Bacteria 954
2 JGI25154J39366_1000130 3300002738 Bacteria 59127
3 JGI25154J39366_1000747 3300002738 Bacteria 14585
4 JGI25158J39367_1008480 3300002739 Bacteria 1428
5 JGI25158J39367_1018755 3300002739 Bacteria 855
6 JGI25157J39369_1012983 3300002741 Bacteria 1054
7 JGI25152J39213_1002923 3300002773 Bacteria 6090
8 JGI25159J45721_1006004 3300002987 Bacteria 3711
9 JGI25159J45721_1007311 3300002987 Bacteria 3177
10 JGI25159J45721_1015535 3300002987 Bacteria 1663
11 JGI25153J46596_10031865 3300003215 Bacteria 1767
12 JGI25153J46596_10077179 3300003215 Bacteria 842
13 rootH2_10250728 3300003320 Bacteria 1318
14 rootL2_10125826 3300003322 Bacteria 1263
15 rootH1_10044980 3300003323 Bacteria 1441
16 rootH1_10210929 3300003323 Bacteria 1265
17 JGI25160J50197_1003901 3300003354 Bacteria 6536
18 JGI25161J50226_1004022 3300003374 Bacteria 3177
19 JGI25161J50226_1008087 3300003374 Bacteria 1663
20 JGI25161J50226_1010565 3300003374 Bacteria 1223
21 Ga0007417J51691_1038992 3300003544 Bacteria 1952
22 Ga0007410J51695_1028218 3300003574 Bacteria 3639
23 Ga0007410J51695_1042549 3300003574 Bacteria 4440
24 Ga0007410J51695_1066032 3300003574 Bacteria 1219
25 Ga0007409J51694_1012205 3300003575 Bacteria 6710
26 Ga0007416J51690_1016785 3300003577 Bacteria 6700
27 Ga0007416J51690_1031673 3300003577 Bacteria 509
28 Ga0007411J51799_116327 3300003611 Bacteria 763
29 Ga0007415J51800_118395 3300003613 Unclassified 609
30 Ga0032354_1025073 3300003693 Bacteria 6712
31 Ga0055538_1004527 3300003751 Bacteria 1564
32 Ga0055539_1009001 3300003752 Bacteria 1243
33 Ga0055533_1008336 3300003756 Bacteria 1324
34 Ga0055542_1001575 3300003762 Bacteria 10628
35 Ga0055529_1000095 3300003763 Bacteria 134030
36 Ga0055526_1000066 3300003771 Bacteria 101329
37 Ga0055526_1000158 3300003771 Bacteria 60304
38 Ga0055526_1004314 3300003771 Bacteria 8592
39 Ga0055526_1007455 3300003771 Bacteria 5679
40 Ga0055526_1032179 3300003771 Bacteria 1486
41 Ga0055537_1001124 3300003773 Bacteria 11528
42 Ga0055537_1004930 3300003773 Bacteria 3690
43 Ga0055537_1012068 3300003773 Bacteria 1707
44 Ga0055524_1001075 3300003775 Bacteria 16780
45 Ga0055524_1010843 3300003775 Bacteria 3603
46 Ga0055524_1024564 3300003775 Bacteria 1908
47 Ga0055534_1001481 3300003784 Bacteria 9319
48 Ga0055534_1001729 3300003784 Bacteria 8261
49 Ga0055534_1009940 3300003784 Bacteria 2026
50 Ga0055534_1020126 3300003784 Bacteria 1133
51 Ga0055528_1000089 3300003790 Bacteria 72690
52 Ga0055528_1004116 3300003790 Bacteria 7090
53 Ga0055530_10020486 3300003791 Bacteria 1974
54 Ga0055531_10027502 3300003794 Bacteria 1993
55 Ga0055541_1005193 3300003841 Bacteria 2295
56 Ga0055543_1009953 3300004625 Bacteria 2016
57 Ga0055543_1009954 3300004625 Bacteria 2016
58 Ga0065165_1006735 3300005262 Bacteria 5892
59 Ga0065165_1031911 3300005262 Bacteria 1658
60 Ga0065165_1052259 3300005262 Bacteria 1155
61 Ga0065165_1064998 3300005262 Bacteria 986
62 Ga0065714_10194222 3300005288 Bacteria 917
63 Ga0065715_10012231 3300005293 Bacteria 3045
64 Ga0070670_100174958 3300005331 Bacteria 1863
65 Ga0070671_100474202 3300005355 Bacteria 1075
66 Ga0070662_101557245 3300005457 Bacteria 570
67 Ga0068867_100627626 3300005459 Bacteria 940
68 Ga0075363_100126449 3300006048 Bacteria 1431
69 Ga0075362_10021292 3300006177 Bacteria 2719
70 Ga0068865_100090909 3300006881 Bacteria 2214
71 Ga0079104_1012462 3300006946 Bacteria 2669
72 Ga0099826_10000001 3300006948 Bacteria 1155201
73 Ga0105244_10006792 3300009036 Bacteria 7359
74 Ga0105244_10079456 3300009036 Bacteria 1625
75 Ga0105243_10996842 3300009148 Bacteria 840
76 Ga0105242_10703375 3300009176 Bacteria 989
77 Ga0105246_10513418 3300011119 Bacteria 1020
78 Ga0105246_11052335 3300011119 Bacteria 740
79 Ga0163162_10591688 3300013306 Bacteria 1236
80 Ga0182008_10060071 3300014497 Bacteria 1875
81 Ga0182006_1000117 3300015261 Bacteria 85963
82 Ga0182007_10062254 3300015262 Bacteria 1223
83 Ga0182005_1000041 3300015265 Bacteria 150123
84 Ga0163161_10088163 3300017792 Bacteria 2293
85 Ga0163161_10661875 3300017792 Bacteria 866
86 Ga0163161_10698814 3300017792 Bacteria 844
87 Ga0213872_10000666 3300021361 Bacteria 26015
88 Ga0213872_10010040 3300021361 Bacteria 4517
89 Ga0213872_10235421 3300021361 Bacteria 775
90 Ga0209436_101177 3300025208 Bacteria 9625
91 Ga0209436_122671 3300025208 Bacteria 804
92 Ga0209784_101968 3300025224 Bacteria 2314
93 Ga0209566_102296 3300025225 Bacteria 3698
94 Ga0209674_100264 3300025226 Bacteria 41417
95 Ga0209563_105342 3300025230 Bacteria 2340
96 Ga0209437_102900 3300025233 Bacteria 3204
97 Ga0209437_114442 3300025233 Bacteria 1100
98 Ga0207425_1000001 3300025245 Bacteria 2525432
99 Ga0207425_1000479 3300025245 Bacteria 25399
100 Ga0207425_1001380 3300025245 Bacteria 10272
101 Ga0209646_1000010 3300025246 Bacteria 573803
102 Ga0209646_1000019 3300025246 Bacteria 475248
103 Ga0209026_1007642 3300025250 Bacteria 2387
104 Ga0209148_1000330 3300025254 Bacteria 65396
105 Ga0209759_1001938 3300025256 Bacteria 10059
106 Ga0209129_1000001 3300025258 Bacteria 1452436
107 Ga0209565_1000009 3300025263 Bacteria 751701
108 Ga0209565_1001770 3300025263 Bacteria 8775
109 Ga0209565_1003171 3300025263 Bacteria 5464
110 Ga0209565_1010035 3300025263 Bacteria 2366
111 Ga0209565_1018588 3300025263 Bacteria 1500
112 Ga0209455_1000121 3300025272 Bacteria 173350
113 Ga0209673_1000019 3300025273 Bacteria 449094
114 Ga0209673_1004672 3300025273 Bacteria 7229
115 Ga0209130_1001997 3300025284 Bacteria 11153
116 Ga0209130_1003045 3300025284 Bacteria 7558
117 Ga0209675_1000028 3300025291 Bacteria 281253
118 Ga0209675_1001513 3300025291 Bacteria 13295
119 Ga0209675_1015107 3300025291 Bacteria 2311
120 Ga0209025_1007797 3300025294 Bacteria 7874
121 Ga0209564_1000009 3300025295 Bacteria 950196
122 Ga0209564_1000033 3300025295 Bacteria 446200
123 Ga0209564_1000058 3300025295 Bacteria 332955
124 Ga0209564_1002185 3300025295 Bacteria 16412
125 Ga0209564_1005493 3300025295 Bacteria 7208
126 Ga0209564_1047971 3300025295 Bacteria 1070
127 Ga0209758_1000116 3300025297 Bacteria 198356
128 Ga0209758_1000842 3300025297 Bacteria 42797
129 Ga0209050_1006232 3300025298 Bacteria 7145
130 Ga0209256_1000005 3300025299 Bacteria 1315082
131 Ga0209256_1000052 3300025299 Bacteria 299374
132 Ga0209256_1000872 3300025299 Bacteria 37384
133 Ga0209256_1015166 3300025299 Bacteria 2715
134 Ga0207426_1002443 3300025302 Bacteria 11859
135 Ga0209257_1000107 3300025304 Bacteria 240937
136 Ga0207655_1053621 3300025728 Bacteria 1610
137 Ga0207655_1055441 3300025728 Bacteria 1569
138 Ga0207650_10571129 3300025925 Bacteria 949
139 Ga0207686_10401857 3300025934 Bacteria 1044
140 Ga0207704_10139378 3300025938 Bacteria 1694
141 Ga0207691_10291445 3300025940 Bacteria 1403
142 Ga0207689_10680875 3300025942 Bacteria 867
143 Ga0207648_10404612 3300026089 Bacteria 1237
144 Ga0209281_1009545 3300027111 Bacteria 2274
145 Ga0209282_1000001 3300027666 Bacteria 2450367
146 Ga0307515_10131442 3300028794 Bacteria 2754
147 Ga0316181_1157853 3300030744 Bacteria 2409
148 Ga0316182_1423366 3300030745 Bacteria 531
149 Ga0307513_10218082 3300031456 Bacteria 1732
150 Ga0307408_100010634 3300031548 Bacteria 6071
151 Ga0307408_100054958 3300031548 Bacteria 2880
152 Ga0307408_100178407 3300031548 Bacteria 1701
153 Ga0307518_10005417 3300031838 Bacteria 9125
154 Ga0307412_10305602 3300031911 Bacteria 1259
155 Ga0307412_10390519 3300031911 Bacteria 1130
156 Ga0307412_10835934 3300031911 Bacteria 802
157 Ga0307416_100376152 3300032002 Bacteria 1448
158 Ga0307416_101274979 3300032002 Bacteria 841
159 Ga0307414_10086664 3300032004 Bacteria 2311
160 Ga0307414_11292870 3300032004 Bacteria 677
161 Ga0395899_0210545 3300037312 Bacteria 1351
162 Ga0395900_0337831 3300037418 Bacteria 1482
163 Ga0395898_0115386 3300037466 Bacteria 2573
164 Ga0395905_0014991 3300037471 Bacteria 7391
165 Ga0395905_0176424 3300037471 Bacteria 2006
166 Ga0395901_0619568 3300038443 Bacteria 1089
167 Ga0436361_0031202 3300039447 Bacteria 17500
168 Ga0436361_0925614 3300039447 Bacteria 558
169 Ga0436361_0946946 3300039447 Bacteria 1038
170 Ga0436361_0956350 3300039447 Bacteria 1255
171 Ga0439439_0207376 3300041406 Bacteria 571
172 Ga0451833_1265465 3300041491 Bacteria 938
173 Ga0450890_011135 3300042127 Bacteria 1160
174 Ga0439434_0243173 3300042435 Bacteria 614
175 Ga0450893_0012964 3300042532 Bacteria 1387
176 Ga0466965_0138353 3300044683 Bacteria 1266
177 Ga0466970_0850588 3300044765 Bacteria 535
178 Ga0495617_000049 3300046452 Bacteria 113032
179 Ga0495617_010347 3300046452 Bacteria 3196
180 Ga0495617_010848 3300046452 Bacteria 3119
181 Ga0495617_216812 3300046452 Bacteria 595
182 Ga0495627_000055 3300046453 Bacteria 149482
183 Ga0495590_0000003 3300046457 Bacteria 478593
184 Ga0495638_0000091 3300046460 Bacteria 146548
185 Ga0495638_0027695 3300046460 Bacteria 3666
186 Ga0495638_0050470 3300046460 Bacteria 2598
187 Ga0495638_0053769 3300046460 Bacteria 2505
188 Ga0495638_0168371 3300046460 Bacteria 1259
189 Ga0495650_0000097 3300046471 Bacteria 216051
190 Ga0495650_0002039 3300046471 Bacteria 17659
191 Ga0495650_0109621 3300046471 Bacteria 1026
192 Ga0495605_0000248 3300046474 Bacteria 63725
193 Ga0495605_0005259 3300046474 Bacteria 7552
194 Ga0495605_0050304 3300046474 Bacteria 2033
195 Ga0495639_0203201 3300046475 Bacteria 970
196 Ga0495584_0000924 3300046491 Bacteria 18616
197 Ga0495584_0003900 3300046491 Bacteria 8067
198 Ga0495585_0009367 3300046492 Bacteria 5876
199 Ga0495585_0055938 3300046492 Bacteria 2180
200 Ga0495585_0160611 3300046492 Bacteria 1166
201 Ga0495596_0005327 3300046500 Bacteria 6092
202 Ga0495607_0008135 3300046501 Bacteria 7194
203 Ga0495607_0076279 3300046501 Bacteria 1855
204 Ga0495607_0216165 3300046501 Bacteria 940
205 Ga0495607_0364182 3300046501 Bacteria 664
206 Ga0495583_0000155 3300046506 Bacteria 114870
207 Ga0495583_0004737 3300046506 Bacteria 9565
208 Ga0495583_0041750 3300046506 Bacteria 2146
209 Ga0495583_0061981 3300046506 Bacteria 1666
210 Ga0495606_0000141 3300046507 Bacteria 123586
211 Ga0495606_0000152 3300046507 Bacteria 119522
212 Ga0495606_0001575 3300046507 Bacteria 29893
213 Ga0495606_0008580 3300046507 Bacteria 8842
214 Ga0495606_0015878 3300046507 Bacteria 5778
215 Ga0495606_0018064 3300046507 Bacteria 5303
216 Ga0495606_0028316 3300046507 Bacteria 3955
217 Ga0495606_0045886 3300046507 Bacteria 2892
218 Ga0495606_0046399 3300046507 Bacteria 2872
219 Ga0495606_0048380 3300046507 Bacteria 2797
220 Ga0495606_0060224 3300046507 Bacteria 2432
221 Ga0495606_0515741 3300046507 Bacteria 601
222 Ga0495610_0000003 3300046512 Bacteria 1203910
223 Ga0495610_0007317 3300046512 Bacteria 7383
224 Ga0495610_0049877 3300046512 Bacteria 2046
225 Ga0495610_0069326 3300046512 Bacteria 1650
226 Ga0495610_0095651 3300046512 Bacteria 1338
227 Ga0495616_0077399 3300046513 Bacteria 1597
228 Ga0495631_0011618 3300046518 Bacteria 4326
229 Ga0495637_0000881 3300046520 Bacteria 19418
230 Ga0495637_0024309 3300046520 Bacteria 2741
231 Ga0495643_0007039 3300046522 Bacteria 7308
232 Ga0495643_0017465 3300046522 Bacteria 4193
233 Ga0495643_0020177 3300046522 Bacteria 3848
234 Ga0495643_0026091 3300046522 Bacteria 3301
235 Ga0495643_0035832 3300046522 Bacteria 2730
236 Ga0495643_0047044 3300046522 Bacteria 2337
237 Ga0495643_0140118 3300046522 Bacteria 1207
238 Ga0495643_0142790 3300046522 Bacteria 1192
239 Ga0495644_0022520 3300046523 Bacteria 2401
240 Ga0495644_0037999 3300046523 Bacteria 1816
241 Ga0495644_0051520 3300046523 Bacteria 1545
242 Ga0495644_0083516 3300046523 Bacteria 1204
243 Ga0495648_0000058 3300046524 Bacteria 156717
244 Ga0495648_0009549 3300046524 Bacteria 7488
245 Ga0495648_0035816 3300046524 Bacteria 3212
246 Ga0495648_0046270 3300046524 Bacteria 2698
247 Ga0495648_0120179 3300046524 Bacteria 1414
248 Ga0495648_0206272 3300046524 Bacteria 980
249 Ga0495648_0349061 3300046524 Bacteria 676
250 Ga0495663_0046120 3300046525 Bacteria 1338
251 Ga0495642_0008387 3300046528 Bacteria 3955
252 Ga0495642_0046150 3300046528 Bacteria 1782
253 Ga0495642_0105089 3300046528 Bacteria 1204
254 Ga0495642_0303034 3300046528 Bacteria 700
255 Ga0495642_0463352 3300046528 Bacteria 560
256 Ga0495654_0000261 3300046530 Bacteria 47872
257 Ga0495654_0027302 3300046530 Bacteria 2928
258 Ga0495654_0044445 3300046530 Bacteria 2197
259 Ga0495654_0079765 3300046530 Bacteria 1537
260 Ga0495654_0110349 3300046530 Bacteria 1256
261 Ga0495609_0000426 3300046538 Bacteria 35215
262 Ga0495609_0003109 3300046538 Bacteria 9715
263 Ga0495609_0004507 3300046538 Bacteria 7596
264 Ga0495609_0081178 3300046538 Bacteria 1417
265 Ga0495621_0228831 3300046539 Bacteria 754
266 Ga0495597_0001525 3300046542 Bacteria 16468
267 Ga0495597_0007071 3300046542 Bacteria 5745
268 Ga0495597_0012194 3300046542 Bacteria 4153
269 Ga0495597_0175511 3300046542 Bacteria 868
270 Ga0495622_0003320 3300046557 Bacteria 7599
271 Ga0495622_0011541 3300046557 Bacteria 4083
272 Ga0495622_0054625 3300046557 Bacteria 1853
273 Ga0495622_0129193 3300046557 Bacteria 1151
274 Ga0495633_0008936 3300046558 Bacteria 5584
275 Ga0495633_0017946 3300046558 Bacteria 3602
276 Ga0495633_0049603 3300046558 Bacteria 1980
277 Ga0495633_0062839 3300046558 Bacteria 1738
278 Ga0495633_0083747 3300046558 Bacteria 1484
279 Ga0495633_0105305 3300046558 Bacteria 1308
280 Ga0495633_0138280 3300046558 Bacteria 1126
281 Ga0495656_0193101 3300046615 Bacteria 1006
282 Ga0495656_0525756 3300046615 Bacteria 629
283 Ga0495668_0000063 3300046616 Bacteria 184563
284 Ga0495668_0002731 3300046616 Bacteria 14134
285 Ga0495668_0007441 3300046616 Bacteria 6995
286 Ga0495668_0007548 3300046616 Bacteria 6939
287 Ga0495668_0008482 3300046616 Bacteria 6405
288 Ga0495668_0033416 3300046616 Bacteria 2890
289 Ga0495668_0059353 3300046616 Bacteria 2111
290 Ga0495611_0035193 3300046648 Bacteria 2217
291 Ga0495611_0045571 3300046648 Bacteria 1964
292 Ga0495611_0557852 3300046648 Bacteria 518
293 Ga0495625_0017675 3300046660 Bacteria 5580
294 Ga0495625_0027829 3300046660 Bacteria 4248
295 Ga0495625_0041908 3300046660 Bacteria 3329
296 Ga0495625_0049883 3300046660 Bacteria 3006
297 Ga0495625_0064954 3300046660 Bacteria 2573
298 Ga0495625_0109698 3300046660 Bacteria 1887
299 Ga0495625_0154783 3300046660 Bacteria 1539
300 Ga0495625_0458175 3300046660 Bacteria 786
301 Ga0495659_0000073 3300046664 Bacteria 42850
302 Ga0495659_0006944 3300046664 Bacteria 3583
303 Ga0495659_0007441 3300046664 Bacteria 3474
304 Ga0495659_0119364 3300046664 Bacteria 1037
305 Ga0495661_0013094 3300046665 Bacteria 5581
306 Ga0495661_0037553 3300046665 Bacteria 3023
307 Ga0495661_0063510 3300046665 Bacteria 2182
308 Ga0495661_0102507 3300046665 Bacteria 1608
309 Ga0495588_0013666 3300046674 Bacteria 3870
310 Ga0495588_0148549 3300046674 Bacteria 1238
311 Ga0495669_0005823 3300046684 Bacteria 5141
312 Ga0495670_0297573 3300046691 Bacteria 864
313 Ga0495670_0489487 3300046691 Bacteria 668
314 Ga0495670_0492743 3300046691 Bacteria 665
315 Ga0495671_0000001 3300046692 Bacteria 1169494
316 Ga0495671_0000309 3300046692 Bacteria 41290
317 Ga0495671_0010548 3300046692 Bacteria 5111
318 Ga0495671_0085223 3300046692 Bacteria 1548
319 Ga0495649_0021357 3300046694 Bacteria 3627
320 Ga0495649_0028389 3300046694 Bacteria 3101
321 Ga0495649_0046758 3300046694 Bacteria 2356
322 Ga0495649_0100778 3300046694 Bacteria 1535
323 Ga0495649_0445263 3300046694 Bacteria 647
324 Ga0495589_0061166 3300046794 Bacteria 1849
325 Ga0495589_0164440 3300046794 Bacteria 1056
326 Ga0495660_0021513 3300046810 Bacteria 3693
327 Ga0495660_0023684 3300046810 Bacteria 3502
328 Ga0495660_0073188 3300046810 Bacteria 1813
329 Ga0495660_0126249 3300046810 Bacteria 1288
330 Ga0495636_0001622 3300047318 Bacteria 8558
331 Ga0495636_0007644 3300047318 Bacteria 4251
332 Ga0495636_0011164 3300047318 Bacteria 3553
333 Ga0495636_0021538 3300047318 Bacteria 2603
334 Ga0495636_0032135 3300047318 Bacteria 2152
335 Ga0495636_0102158 3300047318 Bacteria 1255
336 Ga0495636_0126082 3300047318 Bacteria 1136
337 Ga0495636_0379945 3300047318 Bacteria 670
338 Ga0495636_0541452 3300047318 Bacteria 566
339 Ga0495672_0000176 3300047320 Bacteria 92728
340 Ga0495672_0000263 3300047320 Bacteria 72879
341 Ga0495672_0050654 3300047320 Bacteria 2449
342 Ga0495672_0270259 3300047320 Bacteria 816
343 Ga0495676_0087321 3300047321 Bacteria 2344
344 Ga0495683_0039174 3300047323 Bacteria 2396
345 Ga0495683_0303487 3300047323 Bacteria 685
346 Ga0495687_000296 3300047443 Bacteria 65626
347 Ga0495687_005542 3300047443 Bacteria 8006
348 Ga0495687_008783 3300047443 Bacteria 5734
349 Ga0495687_020138 3300047443 Bacteria 3257
350 Ga0495687_032760 3300047443 Bacteria 2367
351 Ga0495687_106730 3300047443 Bacteria 1038
352 Ga0495677_0001373 3300047445 Bacteria 9736
353 Ga0495677_0006058 3300047445 Bacteria 4572
354 Ga0495677_0120170 3300047445 Bacteria 1002
355 Ga0495677_0135437 3300047445 Bacteria 944
356 Ga0495679_009450 3300047446 Bacteria 3902
357 Ga0495685_000250 3300047447 Bacteria 18582
358 Ga0495685_007493 3300047447 Bacteria 3604
359 Ga0495685_073871 3300047447 Bacteria 1140
360 Ga0495673_0000006 3300047469 Bacteria 908691
361 Ga0495673_0000024 3300047469 Bacteria 521349
362 Ga0495673_0000049 3300047469 Bacteria 265878
363 Ga0495673_0007809 3300047469 Bacteria 6092
364 Ga0495673_0015916 3300047469 Bacteria 3859
365 Ga0495681_0025094 3300047470 Bacteria 3124
366 Ga0495681_0027938 3300047470 Bacteria 2911
367 Ga0495686_0022789 3300047472 Bacteria 4139
368 Ga0495686_0025509 3300047472 Bacteria 3874
369 Ga0495686_0041667 3300047472 Bacteria 2922
370 Ga0495686_0062331 3300047472 Bacteria 2313
371 Ga0495686_0227016 3300047472 Bacteria 1059
372 Ga0495615_0005881 3300048090 Bacteria 2237
373 Ga0495626_0091381 3300048091 Bacteria 1338
374 Ga0496100_0262825 3300048903 Bacteria 1280
375 Ga0496101_0253033 3300048904 Bacteria 1373
376 Ga0496102_0034285 3300048905 Bacteria 4564
377 Ga0496102_0037864 3300048905 Bacteria 4351
378 Ga0496102_0097127 3300048905 Bacteria 2732
379 Ga0496102_0708473 3300048905 Bacteria 929
380 Ga0496103_0002220 3300048906 Bacteria 12303
381 Ga0496103_0043004 3300048906 Bacteria 2781
382 Ga0496103_0152808 3300048906 Bacteria 1479
383 Ga0496104_0092571 3300048907 Bacteria 2890
384 Ga0496104_0212720 3300048907 Bacteria 1845
385 Ga0496105_0399390 3300048908 Bacteria 1091
386 Ga0496106_0105061 3300048909 Bacteria 2194
387 Ga0496109_0070983 3300048912 Bacteria 3196
388 Ga0496110_0186126 3300048913 Bacteria 1885
389 Ga0496111_0012600 3300048914 Bacteria 5730
390 Ga0496111_0236740 3300048914 Bacteria 1356
391 Ga0496114_0171677 3300048917 Bacteria 1890
392 Ga0496114_0269231 3300048917 Bacteria 1501
393 Ga0496115_0472227 3300048918 Bacteria 1011
394 Ga0496116_0037867 3300048919 Bacteria 3357
395 Ga0496117_0000001 3300048920 Bacteria 2526244
396 Ga0496118_0000078 3300048921 Bacteria 190946
397 Ga0496119_0114008 3300048922 Bacteria 1496
398 Ga0496121_0008619 3300048924 Bacteria 11936
399 Ga0496121_0195051 3300048924 Bacteria 1448
400 Ga0496121_0398881 3300048924 Bacteria 902
401 Ga0496122_0054686 3300048925 Bacteria 2995
402 Ga0496123_0014321 3300048926 Bacteria 6582
403 Ga0496123_0050713 3300048926 Bacteria 2770
404 Ga0496124_0056704 3300048927 Bacteria 3303
405 Ga0496125_0003517 3300048928 Bacteria 18904
406 Ga0496125_0033319 3300048928 Bacteria 4559
407 Ga0496126_0020682 3300048929 Bacteria 6446
408 Ga0496126_0445502 3300048929 Bacteria 1043
409 Ga0501306_010745 3300049127 Bacteria 1157
410 Ga0501308_005670 3300049128 Bacteria 1253
411 Ga0501308_025541 3300049128 Bacteria 766
412 Ga0501309_007823 3300049129 Bacteria 1332
413 Ga0501310_004803 3300049130 Bacteria 1369
414 Ga0501310_045874 3300049130 Bacteria 621
415 Ga0501344_01815 3300049133 Bacteria 1062
416 Ga0501304_003517 3300049160 Bacteria 1152
417 Ga0501305_009614 3300049161 Bacteria 1275
418 Ga0501305_100798 3300049161 Bacteria 537
419 Ga0501307_005000 3300049162 Bacteria 1380
420 Ga0501307_013506 3300049162 Bacteria 987
421 Ga0501307_037243 3300049162 Bacteria 696
422 Ga0495678_000155 3300049459 Bacteria 81324
423 Ga0495678_010317 3300049459 Bacteria 4548
424 Ga0495678_018497 3300049459 Bacteria 3131
425 Ga0495678_031280 3300049459 Bacteria 2220
426 Ga0495678_062484 3300049459 Bacteria 1394
427 Ga0495678_086229 3300049459 Bacteria 1116
428 Ga0495678_144091 3300049459 Bacteria 776
429 Ga0495678_167940 3300049459 Bacteria 696
430 Ga0495682_0040194 3300049460 Bacteria 1715
431 Ga0495682_0042543 3300049460 Bacteria 1664
432 Ga0495682_0083346 3300049460 Bacteria 1149
433 Ga0501311_004873 3300049527 Bacteria 1446
434 Ga0501311_010471 3300049527 Bacteria 1126
435 Ga0501312_021418 3300049528 Bacteria 962
436 Ga0501312_077136 3300049528 Bacteria 598
437 Ga0501313_037848 3300049529 Bacteria 642
438 Ga0501313_047452 3300049529 Bacteria 588
439 Ga0501314_008454 3300049530 Bacteria 931
440 Ga0501315_009567 3300049531 Bacteria 1149
441 Ga0501315_009856 3300049531 Bacteria 1137
442 Ga0501315_022636 3300049531 Bacteria 858
443 Ga0501315_053271 3300049531 Bacteria 640
444 Ga0501315_059210 3300049531 Bacteria 616
445 Ga0501315_059427 3300049531 Bacteria 616
446 Ga0501316_002775 3300049532 Bacteria 1648
447 Ga0501316_031771 3300049532 Bacteria 709
448 Ga0501316_033058 3300049532 Bacteria 699
449 Ga0501316_069332 3300049532 Bacteria 532
450 Ga0501318_006362 3300049534 Bacteria 1204
451 Ga0501319_021966 3300049535 Bacteria 577
452 Ga0501319_022711 3300049535 Bacteria 570
453 Ga0501321_041631 3300049537 Bacteria 648
454 Ga0501323_009474 3300049539 Bacteria 1148
455 Ga0501323_054396 3300049539 Bacteria 614
456 Ga0501325_022604 3300049541 Bacteria 673
457 Ga0501326_14042 3300049542 Bacteria 503
458 Ga0501328_00978 3300049544 Bacteria 1072
459 Ga0501329_07090 3300049545 Bacteria 651
460 Ga0501335_007630 3300049551 Bacteria 1004
461 Ga0501335_028288 3300049551 Bacteria 625
462 Ga0501336_019311 3300049552 Bacteria 610
463 Ga0501211_009179 3300049658 Bacteria 968
464 Ga0501227_058541 3300049665 Bacteria 983
465 Ga0501230_013692 3300049667 Bacteria 1319
466 Ga0501235_036607 3300049669 Bacteria 1116
467 Ga0501238_004582 3300049671 Bacteria 1732
468 Ga0501248_025484 3300049678 Bacteria 643
469 Ga0501249_002398 3300049679 Bacteria 3787
470 Ga0501219_002983 3300049703 Bacteria 1251
471 Ga0501263_063025 3300049760 Bacteria 585
472 Ga0501269_000168 3300049766 Bacteria 20001
473 Ga0501279_001743 3300049775 Bacteria 2863
474 Ga0501279_005098 3300049775 Bacteria 1723
475 nmdc:mga03683_13644_c1 3300050489 Bacteria 2995
476 nmdc:mga03n38_54782_c1 3300050490 Bacteria 1794
477 nmdc:mga0k408_286418_c1 3300050493 Bacteria 983
478 Ga0500594_0171728 3300053118 Bacteria 704
479 Ga0500618_000786 3300053125 Bacteria 17782
480 Ga0500618_031806 3300053125 Bacteria 1236
481 Ga0500618_104668 3300053125 Bacteria 638
482 Ga0500559_0271076 3300053136 Bacteria 799
483 Ga0500586_009115 3300053145 Bacteria 2737
484 Ga0500622_0103027 3300053156 Bacteria 1403
485 Ga0587083_0269298 3300059505 Bacteria 514
486 2601667358 2600255292 Bacteria 6300551
487 2643787381 2643221554 Bacteria 6603920
488 2644214104 2643221638 Bacteria 6579467
489 2644252404 2643221645 Bacteria 7207331
490 2644357096 2643221664 Bacteria 7272945
491 2738741563 2738541280 Bacteria 6630198
492 2738829596 2738541297 Bacteria 6549566
493 2738843818 2738541300 Bacteria 6675882
494 2739153392 2738541357 Bacteria 6549408
495 2739195312 2738543003 Bacteria 6549560
496 2739277643 2738543018 Bacteria 6718814
497 2739321788 2738543026 Bacteria 6549408
498 2739339656 2738543029 Bacteria 6549249
499 2739346672 2738543030 Bacteria 6719714
500 2821131234 2821131069 Bacteria 6108407
501 2842714427 2842711865 Bacteria 7155354
502 2857554126 2857553236 Bacteria 6166726
503 2857561541 2857558681 Bacteria 6617694
504 2857565093 2857564685 Bacteria 6290584
505 2885083652 2885080285 Bacteria 6355622
506 2904426413 2904424332 Bacteria 7633521
507 2919478743 2919476304 Bacteria 5888696
508 2932410976 2932410948 Bacteria 6312192
509 2932419457 2932416698 Bacteria 6315112
510 Ga0395905_0652304
511 JGI25154J39366_1000130
512 JGI25154J39366_1000747
513 JGI25158J39367_1008480
514 JGI25158J39367_1018755
515 JGI25157J39369_1012983
516 JGI25152J39213_1002923
517 JGI25159J45721_1006004
518 JGI25159J45721_1007311
519 JGI25159J45721_1015535
520 JGI25153J46596_10031865
521 JGI25153J46596_10077179
522 rootH2_10250728
523 rootL2_10125826
524 rootH1_10044980
525 rootH1_10210929
526 JGI25160J50197_1003901
527 JGI25161J50226_1004022
528 JGI25161J50226_1008087
529 JGI25161J50226_1010565
530 Ga0007417J51691_1038992
531 Ga0007410J51695_1028218
532 Ga0007410J51695_1042549
533 Ga0007410J51695_1066032
534 Ga0007409J51694_1012205
535 Ga0007416J51690_1016785
536 Ga0007416J51690_1031673
537 Ga0007411J51799_116327
538 Ga0007415J51800_118395
539 Ga0032354_1025073
540 Ga0055538_1004527
541 Ga0055539_1009001
542 Ga0055533_1008336
543 Ga0055542_1001575
544 Ga0055529_1000095
545 Ga0055526_1000066
546 Ga0055526_1000158
547 Ga0055526_1004314
548 Ga0055526_1007455
549 Ga0055526_1032179
550 Ga0055537_1001124
551 Ga0055537_1004930
552 Ga0055537_1012068
553 Ga0055524_1001075
554 Ga0055524_1010843
555 Ga0055524_1024564
556 Ga0055534_1001481
557 Ga0055534_1001729
558 Ga0055534_1009940
559 Ga0055534_1020126
560 Ga0055528_1000089
561 Ga0055528_1004116
562 Ga0055530_10020486
563 Ga0055531_10027502
564 Ga0055541_1005193
565 Ga0055543_1009953
566 Ga0055543_1009954
567 Ga0065165_1006735
568 Ga0065165_1031911
569 Ga0065165_1052259
570 Ga0065165_1064998
571 Ga0065714_10194222
572 Ga0065715_10012231
573 Ga0070670_100174958
574 Ga0070671_100474202
575 Ga0070662_101557245
576 Ga0068867_100627626
577 Ga0075363_100126449
578 Ga0075362_10021292
579 Ga0068865_100090909
580 Ga0079104_1012462
581 Ga0099826_10000001
582 Ga0105244_10006792
583 Ga0105244_10079456
584 Ga0105243_10996842
585 Ga0105242_10703375
586 Ga0105246_10513418
587 Ga0105246_11052335
588 Ga0163162_10591688
589 Ga0182008_10060071
590 Ga0182006_1000117
591 Ga0182007_10062254
592 Ga0182005_1000041
593 Ga0163161_10088163
594 Ga0163161_10661875
595 Ga0163161_10698814
596 Ga0213872_10000666
597 Ga0213872_10010040
598 Ga0213872_10235421
599 Ga0209436_101177
600 Ga0209436_122671
601 Ga0209784_101968
602 Ga0209566_102296
603 Ga0209674_100264
604 Ga0209563_105342
605 Ga0209437_102900
606 Ga0209437_114442
607 Ga0207425_1000001
608 Ga0207425_1000479
609 Ga0207425_1001380
610 Ga0209646_1000010
611 Ga0209646_1000019
612 Ga0209026_1007642
613 Ga0209148_1000330
614 Ga0209759_1001938
615 Ga0209129_1000001
616 Ga0209565_1000009
617 Ga0209565_1001770
618 Ga0209565_1003171
619 Ga0209565_1010035
620 Ga0209565_1018588
621 Ga0209455_1000121
622 Ga0209673_1000019
623 Ga0209673_1004672
624 Ga0209130_1001997
625 Ga0209130_1003045
626 Ga0209675_1000028
627 Ga0209675_1001513
628 Ga0209675_1015107
629 Ga0209025_1007797
630 Ga0209564_1000009
631 Ga0209564_1000033
632 Ga0209564_1000058
633 Ga0209564_1002185
634 Ga0209564_1005493
635 Ga0209564_1047971
636 Ga0209758_1000116
637 Ga0209758_1000842
638 Ga0209050_1006232
639 Ga0209256_1000005
640 Ga0209256_1000052
641 Ga0209256_1000872
642 Ga0209256_1015166
643 Ga0207426_1002443
644 Ga0209257_1000107
645 Ga0207655_1053621
646 Ga0207655_1055441
647 Ga0207650_10571129
648 Ga0207686_10401857
649 Ga0207704_10139378
650 Ga0207691_10291445
651 Ga0207689_10680875
652 Ga0207648_10404612
653 Ga0209281_1009545
654 Ga0209282_1000001
655 Ga0307515_10131442
656 Ga0316181_1157853
657 Ga0316182_1423366
658 Ga0307513_10218082
659 Ga0307408_100010634
660 Ga0307408_100054958
661 Ga0307408_100178407
662 Ga0307518_10005417
663 Ga0307412_10305602
664 Ga0307412_10390519
665 Ga0307412_10835934
666 Ga0307416_100376152
667 Ga0307416_101274979
668 Ga0307414_10086664
669 Ga0307414_11292870
670 Ga0395899_0210545
671 Ga0395900_0337831
672 Ga0395898_0115386
673 Ga0395905_0014991
674 Ga0395905_0176424
675 Ga0395901_0619568
676 Ga0436361_0031202
677 Ga0436361_0925614
678 Ga0436361_0946946
679 Ga0436361_0956350
680 Ga0439439_0207376
681 Ga0451833_1265465
682 Ga0450890_011135
683 Ga0439434_0243173
684 Ga0450893_0012964
685 Ga0466965_0138353
686 Ga0466970_0850588
687 Ga0495617_000049
688 Ga0495617_010347
689 Ga0495617_010848
690 Ga0495617_216812
691 Ga0495627_000055
692 Ga0495590_0000003
693 Ga0495638_0000091
694 Ga0495638_0027695
695 Ga0495638_0050470
696 Ga0495638_0053769
697 Ga0495638_0168371
698 Ga0495650_0000097
699 Ga0495650_0002039
700 Ga0495650_0109621
701 Ga0495605_0000248
702 Ga0495605_0005259
703 Ga0495605_0050304
704 Ga0495639_0203201
705 Ga0495584_0000924
706 Ga0495584_0003900
707 Ga0495585_0009367
708 Ga0495585_0055938
709 Ga0495585_0160611
710 Ga0495596_0005327
711 Ga0495607_0008135
712 Ga0495607_0076279
713 Ga0495607_0216165
714 Ga0495607_0364182
715 Ga0495583_0000155
716 Ga0495583_0004737
717 Ga0495583_0041750
718 Ga0495583_0061981
719 Ga0495606_0000141
720 Ga0495606_0000152
721 Ga0495606_0001575
722 Ga0495606_0008580
723 Ga0495606_0015878
724 Ga0495606_0018064
725 Ga0495606_0028316
726 Ga0495606_0045886
727 Ga0495606_0046399
728 Ga0495606_0048380
729 Ga0495606_0060224
730 Ga0495606_0515741
731 Ga0495610_0000003
732 Ga0495610_0007317
733 Ga0495610_0049877
734 Ga0495610_0069326
735 Ga0495610_0095651
736 Ga0495616_0077399
737 Ga0495631_0011618
738 Ga0495637_0000881
739 Ga0495637_0024309
740 Ga0495643_0007039
741 Ga0495643_0017465
742 Ga0495643_0020177
743 Ga0495643_0026091
744 Ga0495643_0035832
745 Ga0495643_0047044
746 Ga0495643_0140118
747 Ga0495643_0142790
748 Ga0495644_0022520
749 Ga0495644_0037999
750 Ga0495644_0051520
751 Ga0495644_0083516
752 Ga0495648_0000058
753 Ga0495648_0009549
754 Ga0495648_0035816
755 Ga0495648_0046270
756 Ga0495648_0120179
757 Ga0495648_0206272
758 Ga0495648_0349061
759 Ga0495663_0046120
760 Ga0495642_0008387
761 Ga0495642_0046150
762 Ga0495642_0105089
763 Ga0495642_0303034
764 Ga0495642_0463352
765 Ga0495654_0000261
766 Ga0495654_0027302
767 Ga0495654_0044445
768 Ga0495654_0079765
769 Ga0495654_0110349
770 Ga0495609_0000426
771 Ga0495609_0003109
772 Ga0495609_0004507
773 Ga0495609_0081178
774 Ga0495621_0228831
775 Ga0495597_0001525
776 Ga0495597_0007071
777 Ga0495597_0012194
778 Ga0495597_0175511
779 Ga0495622_0003320
780 Ga0495622_0011541
781 Ga0495622_0054625
782 Ga0495622_0129193
783 Ga0495633_0008936
784 Ga0495633_0017946
785 Ga0495633_0049603
786 Ga0495633_0062839
787 Ga0495633_0083747
788 Ga0495633_0105305
789 Ga0495633_0138280
790 Ga0495656_0193101
791 Ga0495656_0525756
792 Ga0495668_0000063
793 Ga0495668_0002731
794 Ga0495668_0007441
795 Ga0495668_0007548
796 Ga0495668_0008482
797 Ga0495668_0033416
798 Ga0495668_0059353
799 Ga0495611_0035193
800 Ga0495611_0045571
801 Ga0495611_0557852
802 Ga0495625_0017675
803 Ga0495625_0027829
804 Ga0495625_0041908
805 Ga0495625_0049883
806 Ga0495625_0064954
807 Ga0495625_0109698
808 Ga0495625_0154783
809 Ga0495625_0458175
810 Ga0495659_0000073
811 Ga0495659_0006944
812 Ga0495659_0007441
813 Ga0495659_0119364
814 Ga0495661_0013094
815 Ga0495661_0037553
816 Ga0495661_0063510
817 Ga0495661_0102507
818 Ga0495588_0013666
819 Ga0495588_0148549
820 Ga0495669_0005823
821 Ga0495670_0297573
822 Ga0495670_0489487
823 Ga0495670_0492743
824 Ga0495671_0000001
825 Ga0495671_0000309
826 Ga0495671_0010548
827 Ga0495671_0085223
828 Ga0495649_0021357
829 Ga0495649_0028389
830 Ga0495649_0046758
831 Ga0495649_0100778
832 Ga0495649_0445263
833 Ga0495589_0061166
834 Ga0495589_0164440
835 Ga0495660_0021513
836 Ga0495660_0023684
837 Ga0495660_0073188
838 Ga0495660_0126249
839 Ga0495636_0001622
840 Ga0495636_0007644
841 Ga0495636_0011164
842 Ga0495636_0021538
843 Ga0495636_0032135
844 Ga0495636_0102158
845 Ga0495636_0126082
846 Ga0495636_0379945
847 Ga0495636_0541452
848 Ga0495672_0000176
849 Ga0495672_0000263
850 Ga0495672_0050654
851 Ga0495672_0270259
852 Ga0495676_0087321
853 Ga0495683_0039174
854 Ga0495683_0303487
855 Ga0495687_000296
856 Ga0495687_005542
857 Ga0495687_008783
858 Ga0495687_020138
859 Ga0495687_032760
860 Ga0495687_106730
861 Ga0495677_0001373
862 Ga0495677_0006058
863 Ga0495677_0120170
864 Ga0495677_0135437
865 Ga0495679_009450
866 Ga0495685_000250
867 Ga0495685_007493
868 Ga0495685_073871
869 Ga0495673_0000006
870 Ga0495673_0000024
871 Ga0495673_0000049
872 Ga0495673_0007809
873 Ga0495673_0015916
874 Ga0495681_0025094
875 Ga0495681_0027938
876 Ga0495686_0022789
877 Ga0495686_0025509
878 Ga0495686_0041667
879 Ga0495686_0062331
880 Ga0495686_0227016
881 Ga0495615_0005881
882 Ga0495626_0091381
883 Ga0496100_0262825
884 Ga0496101_0253033
885 Ga0496102_0034285
886 Ga0496102_0037864
887 Ga0496102_0097127
888 Ga0496102_0708473
889 Ga0496103_0002220
890 Ga0496103_0043004
891 Ga0496103_0152808
892 Ga0496104_0092571
893 Ga0496104_0212720
894 Ga0496105_0399390
895 Ga0496106_0105061
896 Ga0496109_0070983
897 Ga0496110_0186126
898 Ga0496111_0012600
899 Ga0496111_0236740
900 Ga0496114_0171677
901 Ga0496114_0269231
902 Ga0496115_0472227
903 Ga0496116_0037867
904 Ga0496117_0000001
905 Ga0496118_0000078
906 Ga0496119_0114008
907 Ga0496121_0008619
908 Ga0496121_0195051
909 Ga0496121_0398881
910 Ga0496122_0054686
911 Ga0496123_0014321
912 Ga0496123_0050713
913 Ga0496124_0056704
914 Ga0496125_0003517
915 Ga0496125_0033319
916 Ga0496126_0020682
917 Ga0496126_0445502
918 Ga0501306_010745
919 Ga0501308_005670
920 Ga0501308_025541
921 Ga0501309_007823
922 Ga0501310_004803
923 Ga0501310_045874
924 Ga0501344_01815
925 Ga0501304_003517
926 Ga0501305_009614
927 Ga0501305_100798
928 Ga0501307_005000
929 Ga0501307_013506
930 Ga0501307_037243
931 Ga0495678_000155
932 Ga0495678_010317
933 Ga0495678_018497
934 Ga0495678_031280
935 Ga0495678_062484
936 Ga0495678_086229
937 Ga0495678_144091
938 Ga0495678_167940
939 Ga0495682_0040194
940 Ga0495682_0042543
941 Ga0495682_0083346
942 Ga0501311_004873
943 Ga0501311_010471
944 Ga0501312_021418
945 Ga0501312_077136
946 Ga0501313_037848
947 Ga0501313_047452
948 Ga0501314_008454
949 Ga0501315_009567
950 Ga0501315_009856
951 Ga0501315_022636
952 Ga0501315_053271
953 Ga0501315_059210
954 Ga0501315_059427
955 Ga0501316_002775
956 Ga0501316_031771
957 Ga0501316_033058
958 Ga0501316_069332
959 Ga0501318_006362
960 Ga0501319_021966
961 Ga0501319_022711
962 Ga0501321_041631
963 Ga0501323_009474
964 Ga0501323_054396
965 Ga0501325_022604
966 Ga0501326_14042
967 Ga0501328_00978
968 Ga0501329_07090
969 Ga0501335_007630
970 Ga0501335_028288
971 Ga0501336_019311
972 Ga0501211_009179
973 Ga0501227_058541
974 Ga0501230_013692
975 Ga0501235_036607
976 Ga0501238_004582
977 Ga0501248_025484
978 Ga0501249_002398
979 Ga0501219_002983
980 Ga0501263_063025
981 Ga0501269_000168
982 Ga0501279_001743
983 Ga0501279_005098
984 nmdc:mga03683_13644_c1
985 nmdc:mga03n38_54782_c1
986 nmdc:mga0k408_286418_c1
987 Ga0500594_0171728
988 Ga0500618_000786
989 Ga0500618_031806
990 Ga0500618_104668
991 Ga0500559_0271076
992 Ga0500586_009115
993 Ga0500622_0103027
994 Ga0587083_0269298
995 2601667358
996 2643787381
997 2644214104
998 2644252404
999 2644357096
1000 2738741563
1001 2738829596
1002 2738843818
1003 2739153392
1004 2739195312
1005 2739277643
1006 2739321788
1007 2739339656
1008 2739346672
1009 2821131234
1010 2842714427
1011 2857554126
1012 2857561541
1013 2857565093
1014 2885083652
1015 2904426413
1016 2919478743
1017 2932410976
1018 2932419457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

7

121

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.858 23 132
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.8573 13 131
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.8534 13 132
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.8382 13 131
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.8344 13 132
ID Description Score Start End Superfamily
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.854 13 132 1.20.1300.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8504 13 131 1.20.1300.10
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8349 13 132 1.20.1300.10
af_Q2FZC9_1_204_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8325 29 133 1.20.1300.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8313 13 131 1.20.1300.10
ID Description Score Start End GO Terms
AF-K2BWE5-F1-model_v4 Succinate dehydrogenase, cytochrome b556 subunit 0.9449 23 132 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-K2BWE5-F1-model_v4 Succinate dehydrogenase, cytochrome b556 subunit 0.9286 23 132 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A0Q9Z0L3-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9246 13 134 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A510X4K9-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9227 25 132 GO:0005886
GO:0006099
GO:0009055
GO:0046872
AF-A0A316FQE6-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9225 23 132 GO:0005886
GO:0006099
GO:0009055
GO:0046872

Map