F457041

General Info

Members Datasets Scaffolds Average Seq Length
509 274 1018 224

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0309465|Ga0495676_0309465_120_794
Length 212
Sequence VVLAAACVLLGLTAALWPGGADGAKPKAVVLGVTSTTPAPACPGSPCEAVGSVSGFQTVAGTTKKPFEAPFDGRVVAWSLTMSSPDSPPEARVGIVKQTNVGKSPPRYKLLRESPVVVLTPFLGTTVTFTLDSPLTVRQGNEIILTIPTWAPAFSVGLSDQSSWRASRQTGKCTSTNDIKASHPQQKVGSEKQYGCFYKTARLLYTATLIKG

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
155 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
272 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 11
Rhizosphere 84.28
Stem 0
Stem Tuber 0
Unclassified 8.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0309465 3300047321 Bacteria 1063
2 CNAas_1003358 3300000532 Unclassified 1066
3 JGI24746J21847_1000055 3300001977 Bacteria 11340
4 JGI24740J21852_10001321 3300001979 Bacteria 11267
5 JGI24034J26672_10000207 3300002239 Bacteria 7761
6 JGI24742J22300_10009033 3300002244 Bacteria 1644
7 rootH2_10156820 3300003320 Bacteria 1383
8 JGI25404J52841_10003786 3300003659 Bacteria 3018
9 Ga0070658_10308148 3300005327 Bacteria 1351
10 Ga0070683_100009175 3300005329 Bacteria 8445
11 Ga0070683_100020190 3300005329 Bacteria 5927
12 Ga0070683_100236556 3300005329 Bacteria 1737
13 Ga0070683_100496789 3300005329 Bacteria 1165
14 Ga0070677_10000004 3300005333 Bacteria 81101
15 Ga0068869_100285565 3300005334 Bacteria 1328
16 Ga0070680_100092076 3300005336 Bacteria 2510
17 Ga0070682_100000117 3300005337 Bacteria 69662
18 Ga0068868_100000878 3300005338 Bacteria 20396
19 Ga0068868_100002616 3300005338 Bacteria 12489
20 Ga0070689_100046763 3300005340 Bacteria 3335
21 Ga0070691_10000114 3300005341 Bacteria 24224
22 Ga0070691_10008513 3300005341 Bacteria 4697
23 Ga0070661_100000023 3300005344 Bacteria 123104
24 Ga0070668_100034077 3300005347 Bacteria 3880
25 Ga0070668_100055354 3300005347 Bacteria 3061
26 Ga0070668_100893226 3300005347 Unclassified 794
27 Ga0070675_100000111 3300005354 Bacteria 47699
28 Ga0070674_100000064 3300005356 Bacteria 47689
29 Ga0070674_100000088 3300005356 Bacteria 42730
30 Ga0070673_100011064 3300005364 Bacteria 6148
31 Ga0070688_100001862 3300005365 Bacteria 10574
32 Ga0070688_100002739 3300005365 Bacteria 8952
33 Ga0070659_100056745 3300005366 Bacteria 3088
34 Ga0070667_100015704 3300005367 Bacteria 6261
35 Ga0070667_100089494 3300005367 Bacteria 2644
36 Ga0070714_100041949 3300005435 Bacteria 3863
37 Ga0070713_100006276 3300005436 Bacteria 8229
38 Ga0070713_100238926 3300005436 Bacteria 1654
39 Ga0070701_10084723 3300005438 Unclassified 1724
40 Ga0070700_100027741 3300005441 Bacteria 3361
41 Ga0070700_100119119 3300005441 Unclassified 1766
42 Ga0070663_100012768 3300005455 Bacteria 5327
43 Ga0070678_100010114 3300005456 Bacteria 5744
44 Ga0070678_100045907 3300005456 Bacteria 3129
45 Ga0070662_100000004 3300005457 Bacteria 195534
46 Ga0070681_10060396 3300005458 Bacteria 3768
47 Ga0070681_10191341 3300005458 Bacteria 1965
48 Ga0068867_100007033 3300005459 Bacteria 7948
49 Ga0070685_10000189 3300005466 Bacteria 41176
50 Ga0070685_10002457 3300005466 Bacteria 9510
51 Ga0070685_10021760 3300005466 Bacteria 3488
52 Ga0070685_10396414 3300005466 Bacteria 955
53 Ga0070679_100000068 3300005530 Bacteria 77184
54 Ga0070679_100004640 3300005530 Bacteria 12683
55 Ga0070684_100020221 3300005535 Bacteria 5523
56 Ga0070684_100037113 3300005535 Bacteria 4177
57 Ga0070684_100099139 3300005535 Bacteria 2600
58 Ga0070684_100113629 3300005535 Bacteria 2430
59 Ga0070684_100174172 3300005535 Bacteria 1955
60 Ga0070684_100381581 3300005535 Bacteria 1298
61 Ga0068853_100004641 3300005539 Bacteria 10652
62 Ga0070672_100000015 3300005543 Bacteria 72591
63 Ga0070695_100213603 3300005545 Unclassified 1386
64 Ga0070693_100018982 3300005547 Bacteria 3598
65 Ga0070693_100415341 3300005547 Bacteria 936
66 Ga0070665_100000106 3300005548 Bacteria 157315
67 Ga0070665_100096537 3300005548 Bacteria 2960
68 Ga0070665_100124078 3300005548 Bacteria 2584
69 Ga0068855_100199249 3300005563 Bacteria 2255
70 Ga0070664_100082712 3300005564 Bacteria 2769
71 Ga0068854_100000183 3300005578 Bacteria 42525
72 Ga0068854_100026557 3300005578 Bacteria 3981
73 Ga0068856_100000757 3300005614 Bacteria 35080
74 Ga0068856_100065218 3300005614 Bacteria 3598
75 Ga0068856_100208015 3300005614 Bacteria 1971
76 Ga0068856_100257319 3300005614 Bacteria 1761
77 Ga0070702_100105177 3300005615 Unclassified 1739
78 Ga0068852_100000093 3300005616 Bacteria 60834
79 Ga0068852_100000184 3300005616 Bacteria 42515
80 Ga0068852_100473610 3300005616 Bacteria 1243
81 Ga0068864_100000053 3300005618 Bacteria 133049
82 Ga0068866_10000001 3300005718 Bacteria 519680
83 Ga0068866_10002045 3300005718 Bacteria 8401
84 Ga0068866_10118277 3300005718 Bacteria 1489
85 Ga0068851_10014831 3300005834 Bacteria 3706
86 Ga0068851_10261609 3300005834 Bacteria 984
87 Ga0068863_100003824 3300005841 Bacteria 14883
88 Ga0068863_100041919 3300005841 Bacteria 4350
89 Ga0068863_100200649 3300005841 Bacteria 1919
90 Ga0068858_100000091 3300005842 Bacteria 93802
91 Ga0068858_100000216 3300005842 Bacteria 62188
92 Ga0068860_100009408 3300005843 Bacteria 9711
93 Ga0068860_100100466 3300005843 Bacteria 2760
94 Ga0068860_100203003 3300005843 Bacteria 1921
95 Ga0068862_100064035 3300005844 Bacteria 3164
96 Ga0081455_10016180 3300005937 Bacteria 7211
97 Ga0081455_10020586 3300005937 Bacteria 6208
98 Ga0081540_1000049 3300005983 Bacteria 127322
99 Ga0081539_10000791 3300005985 Bacteria 61600
100 Ga0070715_10000001 3300006163 Bacteria 693690
101 Ga0070715_10042222 3300006163 Bacteria 1916
102 Ga0070712_100009103 3300006175 Bacteria 6251
103 Ga0068871_100346630 3300006358 Unclassified 1313
104 Ga0068871_100357903 3300006358 Unclassified 1292
105 Ga0075430_100118679 3300006846 Bacteria 2205
106 Ga0075430_100590663 3300006846 Bacteria 916
107 Ga0075433_10000041 3300006852 Bacteria 52354
108 Ga0075433_10283226 3300006852 Bacteria 1468
109 Ga0068865_100001277 3300006881 Bacteria 14651
110 Ga0105240_10393293 3300009093 Bacteria 1563
111 Ga0105245_10001831 3300009098 Bacteria 19354
112 Ga0105245_10014091 3300009098 Bacteria 6966
113 Ga0105245_10049211 3300009098 Bacteria 3774
114 Ga0105245_10057318 3300009098 Bacteria 3504
115 Ga0105245_10506295 3300009098 Unclassified 1224
116 Ga0105247_10000242 3300009101 Bacteria 51204
117 Ga0105243_10064297 3300009148 Bacteria 2944
118 Ga0105243_10212980 3300009148 Bacteria 1703
119 Ga0105241_10075574 3300009174 Bacteria 2625
120 Ga0105242_10004263 3300009176 Bacteria 11148
121 Ga0105242_10006049 3300009176 Bacteria 9326
122 Ga0105242_10040881 3300009176 Bacteria 3736
123 Ga0105242_10046516 3300009176 Bacteria 3520
124 Ga0105248_10000008 3300009177 Bacteria 403910
125 Ga0105237_10140426 3300009545 Bacteria 2410
126 Ga0105249_10007533 3300009553 Bacteria 9496
127 Ga0105249_10214149 3300009553 Unclassified 1892
128 Ga0105239_10086142 3300010375 Bacteria 3462
129 Ga0105239_11408742 3300010375 Unclassified 805
130 Ga0157371_10005310 3300013102 Bacteria 10906
131 Ga0157370_10011805 3300013104 Bacteria 9116
132 Ga0157370_10065492 3300013104 Bacteria 3438
133 Ga0157370_10213701 3300013104 Bacteria 1787
134 Ga0157369_10000110 3300013105 Bacteria 115514
135 Ga0157369_10541824 3300013105 Unclassified 1203
136 Ga0157369_10617400 3300013105 Bacteria 1119
137 Ga0157374_10025432 3300013296 Bacteria 5316
138 Ga0157374_10080363 3300013296 Bacteria 3092
139 Ga0157374_10099651 3300013296 Bacteria 2784
140 Ga0157378_10009271 3300013297 Bacteria 8574
141 Ga0157378_10013004 3300013297 Bacteria 7281
142 Ga0157372_10000129 3300013307 Bacteria 82491
143 Ga0157375_10000477 3300013308 Bacteria 36502
144 Ga0157375_10015827 3300013308 Bacteria 6759
145 Ga0157375_10636891 3300013308 Bacteria 1223
146 Ga0163163_10463891 3300014325 Unclassified 1327
147 Ga0157380_10000281 3300014326 Bacteria 30636
148 Ga0157380_10000843 3300014326 Bacteria 19177
149 Ga0157380_10152215 3300014326 Bacteria 2001
150 Ga0157379_10022281 3300014968 Bacteria 5611
151 Ga0157379_10053684 3300014968 Bacteria 3600
152 Ga0157379_10099202 3300014968 Bacteria 2615
153 Ga0157379_10164376 3300014968 Bacteria 2003
154 Ga0157376_10074861 3300014969 Bacteria 2888
155 Ga0163161_10000035 3300017792 Bacteria 155979
156 Ga0206356_10071296 3300020070 Bacteria 1771
157 Ga0206352_10696586 3300020078 Bacteria 864
158 Ga0206350_11173658 3300020080 Bacteria 1673
159 Ga0224712_10057272 3300022467 Bacteria 1540
160 Ga0207656_10001601 3300025321 Bacteria 7532
161 Ga0207656_10169880 3300025321 Bacteria 1042
162 Ga0207682_10000274 3300025893 Bacteria 23379
163 Ga0207642_10000002 3300025899 Bacteria 658166
164 Ga0207642_10000447 3300025899 Bacteria 12522
165 Ga0207710_10000531 3300025900 Bacteria 23383
166 Ga0207685_10000027 3300025905 Bacteria 102101
167 Ga0207685_10019416 3300025905 Bacteria 2240
168 Ga0207707_10023876 3300025912 Bacteria 5347
169 Ga0207693_10004716 3300025915 Bacteria 11470
170 Ga0207649_10000523 3300025920 Bacteria 26930
171 Ga0207649_10175589 3300025920 Bacteria 1496
172 Ga0207652_10000044 3300025921 Bacteria 127779
173 Ga0207652_10008706 3300025921 Bacteria 8168
174 Ga0207694_10608575 3300025924 Bacteria 919
175 Ga0207650_10055049 3300025925 Bacteria 2952
176 Ga0207659_10000010 3300025926 Bacteria 286639
177 Ga0207687_10000007 3300025927 Bacteria 604185
178 Ga0207687_10000018 3300025927 Bacteria 236159
179 Ga0207687_10002454 3300025927 Bacteria 12584
180 Ga0207687_10002457 3300025927 Bacteria 12576
181 Ga0207687_10389648 3300025927 Unclassified 1143
182 Ga0207700_10000027 3300025928 Bacteria 137708
183 Ga0207664_10015668 3300025929 Bacteria 5510
184 Ga0207706_10000012 3300025933 Bacteria 195475
185 Ga0207686_10000033 3300025934 Bacteria 143602
186 Ga0207686_10001975 3300025934 Bacteria 11300
187 Ga0207686_10030930 3300025934 Bacteria 3175
188 Ga0207686_10032253 3300025934 Bacteria 3117
189 Ga0207709_10033039 3300025935 Bacteria 3034
190 Ga0207709_10234121 3300025935 Unclassified 1332
191 Ga0207670_10075101 3300025936 Bacteria 2348
192 Ga0207669_10000018 3300025937 Bacteria 114254
193 Ga0207669_10000560 3300025937 Bacteria 16246
194 Ga0207704_10000093 3300025938 Bacteria 52224
195 Ga0207665_10531296 3300025939 Unclassified 912
196 Ga0207691_10000044 3300025940 Bacteria 100027
197 Ga0207711_10000006 3300025941 Bacteria 792692
198 Ga0207689_10328562 3300025942 Unclassified 1270
199 Ga0207661_10000262 3300025944 Bacteria 33960
200 Ga0207661_10004696 3300025944 Bacteria 9570
201 Ga0207661_10017394 3300025944 Bacteria 5319
202 Ga0207661_10129624 3300025944 Bacteria 2158
203 Ga0207661_10574521 3300025944 Bacteria 1034
204 Ga0207679_10066507 3300025945 Bacteria 2701
205 Ga0207667_10096326 3300025949 Bacteria 3054
206 Ga0207651_10003318 3300025960 Bacteria 7892
207 Ga0207712_10000007 3300025961 Bacteria 539589
208 Ga0207712_10028557 3300025961 Bacteria 3733
209 Ga0207712_10185531 3300025961 Unclassified 1637
210 Ga0207712_10301722 3300025961 Bacteria 1315
211 Ga0207668_10024588 3300025972 Bacteria 3890
212 Ga0207640_10000200 3300025981 Bacteria 42738
213 Ga0207658_10003306 3300025986 Bacteria 11441
214 Ga0207658_10060423 3300025986 Bacteria 2828
215 Ga0207677_10002133 3300026023 Bacteria 10392
216 Ga0207677_10002836 3300026023 Bacteria 9133
217 Ga0207703_10000023 3300026035 Bacteria 222018
218 Ga0207703_10000152 3300026035 Bacteria 79658
219 Ga0207639_10002934 3300026041 Bacteria 11462
220 Ga0207708_10032385 3300026075 Bacteria 3970
221 Ga0207708_10094640 3300026075 Bacteria 2306
222 Ga0207702_10000060 3300026078 Bacteria 125473
223 Ga0207702_10003333 3300026078 Bacteria 14742
224 Ga0207702_10174007 3300026078 Bacteria 1977
225 Ga0207641_10000405 3300026088 Bacteria 50517
226 Ga0207641_10012343 3300026088 Bacteria 7009
227 Ga0207648_10002917 3300026089 Bacteria 18105
228 Ga0207676_10000094 3300026095 Bacteria 80575
229 Ga0207675_100137883 3300026118 Bacteria 2316
230 Ga0207683_10010521 3300026121 Bacteria 7895
231 Ga0207683_10052815 3300026121 Bacteria 3562
232 Ga0207698_10000440 3300026142 Bacteria 23916
233 Ga0207698_10114229 3300026142 Bacteria 2271
234 Ga0207698_11242734 3300026142 Unclassified 759
235 Ga0268266_10000047 3300028379 Bacteria 310996
236 Ga0268266_10011189 3300028379 Bacteria 7808
237 Ga0268266_10047678 3300028379 Bacteria 3672
238 Ga0268266_10430709 3300028379 Bacteria 1251
239 Ga0268265_10006440 3300028380 Bacteria 7958
240 Ga0268264_10005284 3300028381 Bacteria 10935
241 Ga0268264_10062371 3300028381 Bacteria 3130
242 Ga0265326_10000102 3300028558 Bacteria 43681
243 Ga0265319_1000122 3300028563 Bacteria 58869
244 Ga0265334_10079477 3300028573 Unclassified 1210
245 Ga0265322_10000001 3300028654 Bacteria 543854
246 Ga0265338_10000706 3300028800 Bacteria 56988
247 Ga0265338_10314739 3300028800 Bacteria 1135
248 Ga0265324_10004881 3300029957 Bacteria 5905
249 Ga0265328_10004536 3300031239 Bacteria 6023
250 Ga0265320_10000002 3300031240 Bacteria 542875
251 Ga0265329_10017040 3300031242 Bacteria 2507
252 Ga0265331_10001492 3300031250 Bacteria 17280
253 Ga0265331_10050112 3300031250 Bacteria 2003
254 Ga0265327_10000011 3300031251 Bacteria 543807
255 Ga0265327_10159981 3300031251 Bacteria 1041
256 Ga0265316_10005389 3300031344 Bacteria 12443
257 Ga0265314_10000062 3300031711 Bacteria 159496
258 Ga0307415_100021962 3300032126 Bacteria 3932
259 Ga0373937_0002885 3300036401 Bacteria 14356
260 Ga0451833_0049203 3300041491 Unclassified 986
261 Ga0451835_1207196 3300041492 Bacteria 725
262 Ga0451839_1548401 3300041496 Bacteria 2260
263 Ga0451853_1164472 3300041512 Unclassified 1222
264 Ga0451853_2489483 3300041512 Bacteria 3249
265 Ga0466963_0000001 3300044694 Bacteria 110556
266 Ga0466963_0032694 3300044694 Bacteria 3371
267 Ga0466963_0190061 3300044694 Bacteria 1434
268 Ga0466957_0007902 3300044842 Bacteria 6034
269 Ga0466957_0233193 3300044842 Unclassified 1219
270 Ga0466958_0043625 3300045836 Bacteria 2701
271 Ga0466967_0000009 3300045976 Bacteria 122610
272 Ga0466967_0339084 3300045976 Bacteria 1453
273 Ga0495592_0000141 3300046454 Bacteria 63776
274 Ga0495603_0000016 3300046455 Bacteria 67399
275 Ga0495603_0000333 3300046455 Bacteria 25490
276 Ga0495629_0003074 3300046459 Bacteria 12673
277 Ga0495629_0024075 3300046459 Bacteria 4336
278 Ga0495629_0054557 3300046459 Bacteria 2795
279 Ga0495638_0069471 3300046460 Bacteria 2159
280 Ga0495641_0000874 3300046461 Bacteria 25824
281 Ga0495651_0214944 3300046462 Unclassified 1335
282 Ga0495653_0232745 3300046463 Unclassified 1232
283 Ga0495582_0000011 3300046473 Bacteria 113352
284 Ga0495662_0000061 3300046476 Bacteria 37295
285 Ga0495594_0000003 3300046499 Bacteria 199267
286 Ga0495606_0000565 3300046507 Bacteria 58752
287 Ga0495608_0000068 3300046511 Bacteria 79694
288 Ga0495608_0009775 3300046511 Bacteria 6694
289 Ga0495608_0112860 3300046511 Bacteria 1746
290 Ga0495610_0059515 3300046512 Bacteria 1823
291 Ga0495618_0000174 3300046514 Bacteria 45942
292 Ga0495618_0487226 3300046514 Bacteria 745
293 Ga0495620_0000144 3300046515 Bacteria 58204
294 Ga0495620_0053343 3300046515 Bacteria 1712
295 Ga0495628_0001677 3300046516 Bacteria 20220
296 Ga0495628_0035454 3300046516 Bacteria 4008
297 Ga0495628_0095389 3300046516 Bacteria 2298
298 Ga0495630_0000056 3300046517 Bacteria 91477
299 Ga0495630_0002389 3300046517 Bacteria 13049
300 Ga0495630_0125789 3300046517 Bacteria 1945
301 Ga0495630_0311217 3300046517 Bacteria 1204
302 Ga0495644_0000091 3300046523 Bacteria 45180
303 Ga0495652_0451763 3300046529 Bacteria 899
304 Ga0495640_0061096 3300046533 Bacteria 2561
305 Ga0495640_0088310 3300046533 Bacteria 2049
306 Ga0495586_0001090 3300046535 Bacteria 15336
307 Ga0495587_0002685 3300046536 Bacteria 11874
308 Ga0495587_0038513 3300046536 Bacteria 2865
309 Ga0495587_0054004 3300046536 Bacteria 2368
310 Ga0495598_0029827 3300046537 Bacteria 1523
311 Ga0495645_0359327 3300046543 Bacteria 936
312 Ga0495667_0000018 3300046559 Bacteria 188610
313 Ga0495656_0001290 3300046615 Bacteria 8149
314 Ga0495668_0119610 3300046616 Bacteria 1440
315 Ga0495634_0000247 3300046642 Bacteria 50931
316 Ga0495634_0005521 3300046642 Bacteria 9712
317 Ga0495625_0000587 3300046660 Bacteria 52838
318 Ga0495635_0000016 3300046663 Bacteria 214088
319 Ga0495635_0047417 3300046663 Bacteria 2963
320 Ga0495635_0050935 3300046663 Bacteria 2854
321 Ga0495588_0000165 3300046674 Bacteria 85841
322 Ga0495657_0000004 3300046675 Bacteria 266465
323 Ga0495657_0019232 3300046675 Bacteria 4931
324 Ga0495647_0000008 3300046681 Bacteria 101193
325 Ga0495647_0000397 3300046681 Bacteria 12436
326 Ga0495647_0000603 3300046681 Bacteria 10627
327 Ga0495647_0088673 3300046681 Bacteria 1265
328 Ga0495658_0000005 3300046683 Bacteria 149839
329 Ga0495658_0099908 3300046683 Bacteria 1730
330 Ga0495658_0130534 3300046683 Bacteria 1529
331 Ga0495669_0000308 3300046684 Bacteria 26995
332 Ga0495669_0107271 3300046684 Unclassified 1301
333 Ga0495613_0000179 3300046689 Bacteria 62109
334 Ga0495613_0000803 3300046689 Bacteria 24344
335 Ga0495613_0187413 3300046689 Bacteria 1463
336 Ga0495624_0000008 3300046690 Bacteria 145035
337 Ga0495624_0000073 3300046690 Bacteria 65582
338 Ga0495624_0143204 3300046690 Bacteria 1463
339 Ga0495649_0019907 3300046694 Bacteria 3767
340 Ga0495600_0020679 3300046809 Bacteria 4209
341 Ga0495604_0000055 3300047317 Bacteria 100430
342 Ga0495604_0000357 3300047317 Bacteria 40931
343 Ga0495674_0000607 3300047319 Bacteria 33608
344 Ga0495674_0095683 3300047319 Bacteria 2532
345 Ga0495672_0060798 3300047320 Bacteria 2180
346 Ga0495676_0032369 3300047321 Bacteria 4414
347 Ga0495676_0132389 3300047321 Bacteria 1798
348 Ga0495680_0001641 3300047322 Bacteria 23765
349 Ga0495680_0001716 3300047322 Bacteria 23253
350 Ga0495680_0008749 3300047322 Bacteria 9169
351 Ga0495680_0213359 3300047322 Unclassified 1381
352 Ga0495680_0400103 3300047322 Bacteria 948
353 Ga0495675_0000107 3300047444 Bacteria 59970
354 Ga0495673_0078027 3300047469 Bacteria 1378
355 Ga0495684_0154683 3300047471 Bacteria 1713
356 Ga0495686_0052126 3300047472 Bacteria 2566
357 Ga0495686_0249369 3300047472 Unclassified 998
358 Ga0495593_0102687 3300047673 Bacteria 1465
359 Ga0495602_0001172 3300048088 Bacteria 25703
360 Ga0495602_0007085 3300048088 Bacteria 11769
361 Ga0495602_0129621 3300048088 Unclassified 2014
362 Ga0495602_0181248 3300048088 Bacteria 1624
363 Ga0496100_0000002 3300048903 Bacteria 489057
364 Ga0496101_0000001 3300048904 Bacteria 489057
365 Ga0496101_0000062 3300048904 Bacteria 126595
366 Ga0496102_0000039 3300048905 Bacteria 198306
367 Ga0496102_0215198 3300048905 Bacteria 1811
368 Ga0496102_0373326 3300048905 Unclassified 1342
369 Ga0496103_0000008 3300048906 Bacteria 340474
370 Ga0496103_0051550 3300048906 Bacteria 2547
371 Ga0496103_0057331 3300048906 Bacteria 2418
372 Ga0496104_0000004 3300048907 Bacteria 641830
373 Ga0496104_0000650 3300048907 Bacteria 29817
374 Ga0496104_0089025 3300048907 Bacteria 2949
375 Ga0496105_0000001 3300048908 Bacteria 1328178
376 Ga0496105_0000007 3300048908 Bacteria 339658
377 Ga0496105_0000347 3300048908 Bacteria 30490
378 Ga0496106_0000061 3300048909 Bacteria 86524
379 Ga0496106_0002128 3300048909 Bacteria 14816
380 Ga0496106_0003741 3300048909 Bacteria 11350
381 Ga0496107_0000006 3300048910 Bacteria 258746
382 Ga0496107_0000013 3300048910 Bacteria 178284
383 Ga0496107_0079309 3300048910 Bacteria 2393
384 Ga0496108_0000001 3300048911 Bacteria 919044
385 Ga0496108_0000062 3300048911 Bacteria 122391
386 Ga0496108_0000187 3300048911 Bacteria 57568
387 Ga0496108_0102393 3300048911 Bacteria 2443
388 Ga0496109_0000003 3300048912 Bacteria 420862
389 Ga0496109_0000007 3300048912 Bacteria 247554
390 Ga0496109_0000129 3300048912 Bacteria 77469
391 Ga0496109_0000636 3300048912 Bacteria 29254
392 Ga0496109_0157685 3300048912 Bacteria 2126
393 Ga0496109_0356647 3300048912 Bacteria 1381
394 Ga0496109_0434037 3300048912 Bacteria 1241
395 Ga0496110_0000087 3300048913 Bacteria 48905
396 Ga0496110_0016119 3300048913 Bacteria 6233
397 Ga0496110_0106752 3300048913 Bacteria 2513
398 Ga0496110_0184037 3300048913 Bacteria 1897
399 Ga0496111_0000010 3300048914 Bacteria 92600
400 Ga0496111_0064222 3300048914 Bacteria 2663
401 Ga0496111_0120142 3300048914 Bacteria 1941
402 Ga0496111_0233624 3300048914 Bacteria 1366
403 Ga0496112_0000006 3300048915 Bacteria 365227
404 Ga0496112_0053466 3300048915 Bacteria 3967
405 Ga0496112_0286713 3300048915 Bacteria 1593
406 Ga0496112_1019846 3300048915 Unclassified 747
407 Ga0496113_0011978 3300048916 Bacteria 5813
408 Ga0496113_0029942 3300048916 Bacteria 3936
409 Ga0496113_0055077 3300048916 Bacteria 2980
410 Ga0496113_0088669 3300048916 Bacteria 2380
411 Ga0496113_0253937 3300048916 Bacteria 1404
412 Ga0496114_0000014 3300048917 Bacteria 297902
413 Ga0496114_0033155 3300048917 Bacteria 4254
414 Ga0496114_0182470 3300048917 Bacteria 1833
415 Ga0496114_0247493 3300048917 Unclassified 1568
416 Ga0496115_0000003 3300048918 Bacteria 354994
417 Ga0496115_0000125 3300048918 Bacteria 69936
418 Ga0496115_0031289 3300048918 Bacteria 4192
419 Ga0496116_0001565 3300048919 Bacteria 25265
420 Ga0496117_0113649 3300048920 Bacteria 1680
421 Ga0496118_0000818 3300048921 Bacteria 49518
422 Ga0496118_0276065 3300048921 Unclassified 938
423 Ga0496119_0004406 3300048922 Bacteria 14035
424 Ga0496119_0017577 3300048922 Bacteria 5373
425 Ga0496119_0079081 3300048922 Bacteria 1900
426 Ga0496120_0047251 3300048923 Bacteria 2483
427 Ga0496121_0023382 3300048924 Bacteria 5954
428 Ga0496125_0041535 3300048928 Bacteria 3930
429 Ga0496125_0139526 3300048928 Bacteria 1688
430 Ga0496125_0195812 3300048928 Bacteria 1329
431 Ga0496126_0113103 3300048929 Bacteria 2363
432 Ga0501031_0000289 3300049568 Bacteria 28551
433 Ga0501032_0000732 3300049569 Bacteria 26642
434 Ga0501033_0000353 3300049570 Bacteria 43786
435 Ga0501034_0176473 3300049571 Unclassified 2102
436 Ga0501034_0436529 3300049571 Unclassified 1228
437 Ga0501036_0000572 3300049572 Bacteria 26492
438 Ga0501037_0001054 3300049573 Bacteria 20408
439 Ga0501038_0000820 3300049574 Bacteria 27656
440 Ga0501042_0071829 3300049578 Bacteria 2476
441 Ga0501042_0342437 3300049578 Bacteria 1081
442 Ga0501043_0000818 3300049579 Bacteria 27694
443 Ga0501046_0000799 3300049580 Bacteria 30520
444 Ga0501047_0002001 3300049581 Bacteria 19529
445 Ga0501047_0117811 3300049581 Bacteria 2537
446 Ga0501048_0000551 3300049582 Bacteria 26439
447 Ga0501067_0038705 3300049583 Bacteria 2648
448 Ga0501068_0063011 3300049584 Bacteria 2255
449 Ga0501068_0068204 3300049584 Bacteria 2168
450 Ga0501068_0279396 3300049584 Bacteria 1067
451 Ga0501069_0038582 3300049585 Bacteria 2637
452 Ga0501070_0000651 3300049586 Bacteria 31939
453 Ga0501070_0029415 3300049586 Bacteria 4606
454 Ga0501070_0120255 3300049586 Bacteria 2170
455 Ga0501070_0307165 3300049586 Bacteria 1291
456 Ga0501071_0055286 3300049587 Bacteria 2865
457 Ga0501071_0277824 3300049587 Bacteria 1267
458 Ga0501071_0290310 3300049587 Unclassified 1239
459 Ga0501072_0018276 3300049588 Bacteria 5395
460 Ga0501073_0011682 3300049589 Bacteria 6414
461 Ga0501074_0010425 3300049590 Bacteria 6744
462 Ga0501074_0132540 3300049590 Bacteria 1782
463 Ga0501076_0111071 3300049592 Bacteria 2215
464 Ga0501079_0009049 3300049741 Bacteria 7543
465 Ga0501079_0031968 3300049741 Bacteria 4044
466 Ga0501080_0021593 3300049742 Bacteria 5959
467 Ga0501080_0194096 3300049742 Bacteria 1865
468 Ga0501080_0450287 3300049742 Unclassified 1154
469 Ga0501083_0005621 3300049744 Bacteria 8876
470 Ga0501083_0134337 3300049744 Bacteria 1621
471 Ga0501035_0000495 3300049822 Bacteria 44328
472 Ga0501035_0392089 3300049822 Unclassified 1156
473 Ga0501035_0738285 3300049822 Unclassified 791
474 Ga0501044_0011736 3300049823 Bacteria 9490
475 Ga0501044_0135079 3300049823 Bacteria 2458
476 Ga0501044_0265692 3300049823 Bacteria 1653
477 Ga0501045_0056886 3300049824 Bacteria 2861
478 nmdc:mga0yw44_467161_c1 3300050492 Bacteria 855
479 nmdc:mga0qj67_19036_c1 3300050509 Bacteria 5241
480 nmdc:mga0a205_1030_c2 3300050515 Bacteria 6201
481 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
482 Ga0495601_0000013 3300053077 Bacteria 226476
483 Ga0495601_0000124 3300053077 Bacteria 43205
484 Ga0495601_0047331 3300053077 Bacteria 2707
485 Ga0495601_0098169 3300053077 Bacteria 1890
486 Ga0495601_0353973 3300053077 Unclassified 954
487 Ga0495612_0002368 3300053078 Bacteria 7768
488 Ga0495612_0010729 3300053078 Bacteria 3700
489 Ga0495612_0029758 3300053078 Bacteria 2200
490 Ga0495655_0000001 3300053083 Bacteria 419518
491 Ga0495595_0000003 3300053084 Bacteria 266465
492 Ga0495595_0000103 3300053084 Bacteria 38598
493 Ga0495595_0094380 3300053084 Bacteria 1438
494 Ga0495595_0113341 3300053084 Bacteria 1316
495 Ga0495595_0198919 3300053084 Unclassified 997
496 Ga0495619_0000025 3300053085 Bacteria 167905
497 Ga0495619_0000031 3300053085 Bacteria 145508
498 Ga0495619_0000106 3300053085 Bacteria 62413
499 Ga0495619_0000580 3300053085 Bacteria 24292
500 Ga0495619_0001003 3300053085 Bacteria 18481
501 Ga0495619_0002742 3300053085 Bacteria 11502
502 Ga0495619_0018989 3300053085 Bacteria 4366
503 Ga0495619_0355791 3300053085 Bacteria 1013
504 Ga0500566_0003325 3300053094 Bacteria 9619
505 Ga0500641_0000840 3300053096 Bacteria 11072
506 Ga0500614_001709 3300053123 Bacteria 5123
507 Ga0500628_000010 3300053129 Bacteria 122210
508 Ga0501084_0282866 3300054114 Unclassified 1401
509 Ga0501082_0022970 3300060353 Bacteria 5376
510 Ga0495676_0309465
511 CNAas_1003358
512 JGI24746J21847_1000055
513 JGI24740J21852_10001321
514 JGI24034J26672_10000207
515 JGI24742J22300_10009033
516 rootH2_10156820
517 JGI25404J52841_10003786
518 Ga0070658_10308148
519 Ga0070683_100009175
520 Ga0070683_100020190
521 Ga0070683_100236556
522 Ga0070683_100496789
523 Ga0070677_10000004
524 Ga0068869_100285565
525 Ga0070680_100092076
526 Ga0070682_100000117
527 Ga0068868_100000878
528 Ga0068868_100002616
529 Ga0070689_100046763
530 Ga0070691_10000114
531 Ga0070691_10008513
532 Ga0070661_100000023
533 Ga0070668_100034077
534 Ga0070668_100055354
535 Ga0070668_100893226
536 Ga0070675_100000111
537 Ga0070674_100000064
538 Ga0070674_100000088
539 Ga0070673_100011064
540 Ga0070688_100001862
541 Ga0070688_100002739
542 Ga0070659_100056745
543 Ga0070667_100015704
544 Ga0070667_100089494
545 Ga0070714_100041949
546 Ga0070713_100006276
547 Ga0070713_100238926
548 Ga0070701_10084723
549 Ga0070700_100027741
550 Ga0070700_100119119
551 Ga0070663_100012768
552 Ga0070678_100010114
553 Ga0070678_100045907
554 Ga0070662_100000004
555 Ga0070681_10060396
556 Ga0070681_10191341
557 Ga0068867_100007033
558 Ga0070685_10000189
559 Ga0070685_10002457
560 Ga0070685_10021760
561 Ga0070685_10396414
562 Ga0070679_100000068
563 Ga0070679_100004640
564 Ga0070684_100020221
565 Ga0070684_100037113
566 Ga0070684_100099139
567 Ga0070684_100113629
568 Ga0070684_100174172
569 Ga0070684_100381581
570 Ga0068853_100004641
571 Ga0070672_100000015
572 Ga0070695_100213603
573 Ga0070693_100018982
574 Ga0070693_100415341
575 Ga0070665_100000106
576 Ga0070665_100096537
577 Ga0070665_100124078
578 Ga0068855_100199249
579 Ga0070664_100082712
580 Ga0068854_100000183
581 Ga0068854_100026557
582 Ga0068856_100000757
583 Ga0068856_100065218
584 Ga0068856_100208015
585 Ga0068856_100257319
586 Ga0070702_100105177
587 Ga0068852_100000093
588 Ga0068852_100000184
589 Ga0068852_100473610
590 Ga0068864_100000053
591 Ga0068866_10000001
592 Ga0068866_10002045
593 Ga0068866_10118277
594 Ga0068851_10014831
595 Ga0068851_10261609
596 Ga0068863_100003824
597 Ga0068863_100041919
598 Ga0068863_100200649
599 Ga0068858_100000091
600 Ga0068858_100000216
601 Ga0068860_100009408
602 Ga0068860_100100466
603 Ga0068860_100203003
604 Ga0068862_100064035
605 Ga0081455_10016180
606 Ga0081455_10020586
607 Ga0081540_1000049
608 Ga0081539_10000791
609 Ga0070715_10000001
610 Ga0070715_10042222
611 Ga0070712_100009103
612 Ga0068871_100346630
613 Ga0068871_100357903
614 Ga0075430_100118679
615 Ga0075430_100590663
616 Ga0075433_10000041
617 Ga0075433_10283226
618 Ga0068865_100001277
619 Ga0105240_10393293
620 Ga0105245_10001831
621 Ga0105245_10014091
622 Ga0105245_10049211
623 Ga0105245_10057318
624 Ga0105245_10506295
625 Ga0105247_10000242
626 Ga0105243_10064297
627 Ga0105243_10212980
628 Ga0105241_10075574
629 Ga0105242_10004263
630 Ga0105242_10006049
631 Ga0105242_10040881
632 Ga0105242_10046516
633 Ga0105248_10000008
634 Ga0105237_10140426
635 Ga0105249_10007533
636 Ga0105249_10214149
637 Ga0105239_10086142
638 Ga0105239_11408742
639 Ga0157371_10005310
640 Ga0157370_10011805
641 Ga0157370_10065492
642 Ga0157370_10213701
643 Ga0157369_10000110
644 Ga0157369_10541824
645 Ga0157369_10617400
646 Ga0157374_10025432
647 Ga0157374_10080363
648 Ga0157374_10099651
649 Ga0157378_10009271
650 Ga0157378_10013004
651 Ga0157372_10000129
652 Ga0157375_10000477
653 Ga0157375_10015827
654 Ga0157375_10636891
655 Ga0163163_10463891
656 Ga0157380_10000281
657 Ga0157380_10000843
658 Ga0157380_10152215
659 Ga0157379_10022281
660 Ga0157379_10053684
661 Ga0157379_10099202
662 Ga0157379_10164376
663 Ga0157376_10074861
664 Ga0163161_10000035
665 Ga0206356_10071296
666 Ga0206352_10696586
667 Ga0206350_11173658
668 Ga0224712_10057272
669 Ga0207656_10001601
670 Ga0207656_10169880
671 Ga0207682_10000274
672 Ga0207642_10000002
673 Ga0207642_10000447
674 Ga0207710_10000531
675 Ga0207685_10000027
676 Ga0207685_10019416
677 Ga0207707_10023876
678 Ga0207693_10004716
679 Ga0207649_10000523
680 Ga0207649_10175589
681 Ga0207652_10000044
682 Ga0207652_10008706
683 Ga0207694_10608575
684 Ga0207650_10055049
685 Ga0207659_10000010
686 Ga0207687_10000007
687 Ga0207687_10000018
688 Ga0207687_10002454
689 Ga0207687_10002457
690 Ga0207687_10389648
691 Ga0207700_10000027
692 Ga0207664_10015668
693 Ga0207706_10000012
694 Ga0207686_10000033
695 Ga0207686_10001975
696 Ga0207686_10030930
697 Ga0207686_10032253
698 Ga0207709_10033039
699 Ga0207709_10234121
700 Ga0207670_10075101
701 Ga0207669_10000018
702 Ga0207669_10000560
703 Ga0207704_10000093
704 Ga0207665_10531296
705 Ga0207691_10000044
706 Ga0207711_10000006
707 Ga0207689_10328562
708 Ga0207661_10000262
709 Ga0207661_10004696
710 Ga0207661_10017394
711 Ga0207661_10129624
712 Ga0207661_10574521
713 Ga0207679_10066507
714 Ga0207667_10096326
715 Ga0207651_10003318
716 Ga0207712_10000007
717 Ga0207712_10028557
718 Ga0207712_10185531
719 Ga0207712_10301722
720 Ga0207668_10024588
721 Ga0207640_10000200
722 Ga0207658_10003306
723 Ga0207658_10060423
724 Ga0207677_10002133
725 Ga0207677_10002836
726 Ga0207703_10000023
727 Ga0207703_10000152
728 Ga0207639_10002934
729 Ga0207708_10032385
730 Ga0207708_10094640
731 Ga0207702_10000060
732 Ga0207702_10003333
733 Ga0207702_10174007
734 Ga0207641_10000405
735 Ga0207641_10012343
736 Ga0207648_10002917
737 Ga0207676_10000094
738 Ga0207675_100137883
739 Ga0207683_10010521
740 Ga0207683_10052815
741 Ga0207698_10000440
742 Ga0207698_10114229
743 Ga0207698_11242734
744 Ga0268266_10000047
745 Ga0268266_10011189
746 Ga0268266_10047678
747 Ga0268266_10430709
748 Ga0268265_10006440
749 Ga0268264_10005284
750 Ga0268264_10062371
751 Ga0265326_10000102
752 Ga0265319_1000122
753 Ga0265334_10079477
754 Ga0265322_10000001
755 Ga0265338_10000706
756 Ga0265338_10314739
757 Ga0265324_10004881
758 Ga0265328_10004536
759 Ga0265320_10000002
760 Ga0265329_10017040
761 Ga0265331_10001492
762 Ga0265331_10050112
763 Ga0265327_10000011
764 Ga0265327_10159981
765 Ga0265316_10005389
766 Ga0265314_10000062
767 Ga0307415_100021962
768 Ga0373937_0002885
769 Ga0451833_0049203
770 Ga0451835_1207196
771 Ga0451839_1548401
772 Ga0451853_1164472
773 Ga0451853_2489483
774 Ga0466963_0000001
775 Ga0466963_0032694
776 Ga0466963_0190061
777 Ga0466957_0007902
778 Ga0466957_0233193
779 Ga0466958_0043625
780 Ga0466967_0000009
781 Ga0466967_0339084
782 Ga0495592_0000141
783 Ga0495603_0000016
784 Ga0495603_0000333
785 Ga0495629_0003074
786 Ga0495629_0024075
787 Ga0495629_0054557
788 Ga0495638_0069471
789 Ga0495641_0000874
790 Ga0495651_0214944
791 Ga0495653_0232745
792 Ga0495582_0000011
793 Ga0495662_0000061
794 Ga0495594_0000003
795 Ga0495606_0000565
796 Ga0495608_0000068
797 Ga0495608_0009775
798 Ga0495608_0112860
799 Ga0495610_0059515
800 Ga0495618_0000174
801 Ga0495618_0487226
802 Ga0495620_0000144
803 Ga0495620_0053343
804 Ga0495628_0001677
805 Ga0495628_0035454
806 Ga0495628_0095389
807 Ga0495630_0000056
808 Ga0495630_0002389
809 Ga0495630_0125789
810 Ga0495630_0311217
811 Ga0495644_0000091
812 Ga0495652_0451763
813 Ga0495640_0061096
814 Ga0495640_0088310
815 Ga0495586_0001090
816 Ga0495587_0002685
817 Ga0495587_0038513
818 Ga0495587_0054004
819 Ga0495598_0029827
820 Ga0495645_0359327
821 Ga0495667_0000018
822 Ga0495656_0001290
823 Ga0495668_0119610
824 Ga0495634_0000247
825 Ga0495634_0005521
826 Ga0495625_0000587
827 Ga0495635_0000016
828 Ga0495635_0047417
829 Ga0495635_0050935
830 Ga0495588_0000165
831 Ga0495657_0000004
832 Ga0495657_0019232
833 Ga0495647_0000008
834 Ga0495647_0000397
835 Ga0495647_0000603
836 Ga0495647_0088673
837 Ga0495658_0000005
838 Ga0495658_0099908
839 Ga0495658_0130534
840 Ga0495669_0000308
841 Ga0495669_0107271
842 Ga0495613_0000179
843 Ga0495613_0000803
844 Ga0495613_0187413
845 Ga0495624_0000008
846 Ga0495624_0000073
847 Ga0495624_0143204
848 Ga0495649_0019907
849 Ga0495600_0020679
850 Ga0495604_0000055
851 Ga0495604_0000357
852 Ga0495674_0000607
853 Ga0495674_0095683
854 Ga0495672_0060798
855 Ga0495676_0032369
856 Ga0495676_0132389
857 Ga0495680_0001641
858 Ga0495680_0001716
859 Ga0495680_0008749
860 Ga0495680_0213359
861 Ga0495680_0400103
862 Ga0495675_0000107
863 Ga0495673_0078027
864 Ga0495684_0154683
865 Ga0495686_0052126
866 Ga0495686_0249369
867 Ga0495593_0102687
868 Ga0495602_0001172
869 Ga0495602_0007085
870 Ga0495602_0129621
871 Ga0495602_0181248
872 Ga0496100_0000002
873 Ga0496101_0000001
874 Ga0496101_0000062
875 Ga0496102_0000039
876 Ga0496102_0215198
877 Ga0496102_0373326
878 Ga0496103_0000008
879 Ga0496103_0051550
880 Ga0496103_0057331
881 Ga0496104_0000004
882 Ga0496104_0000650
883 Ga0496104_0089025
884 Ga0496105_0000001
885 Ga0496105_0000007
886 Ga0496105_0000347
887 Ga0496106_0000061
888 Ga0496106_0002128
889 Ga0496106_0003741
890 Ga0496107_0000006
891 Ga0496107_0000013
892 Ga0496107_0079309
893 Ga0496108_0000001
894 Ga0496108_0000062
895 Ga0496108_0000187
896 Ga0496108_0102393
897 Ga0496109_0000003
898 Ga0496109_0000007
899 Ga0496109_0000129
900 Ga0496109_0000636
901 Ga0496109_0157685
902 Ga0496109_0356647
903 Ga0496109_0434037
904 Ga0496110_0000087
905 Ga0496110_0016119
906 Ga0496110_0106752
907 Ga0496110_0184037
908 Ga0496111_0000010
909 Ga0496111_0064222
910 Ga0496111_0120142
911 Ga0496111_0233624
912 Ga0496112_0000006
913 Ga0496112_0053466
914 Ga0496112_0286713
915 Ga0496112_1019846
916 Ga0496113_0011978
917 Ga0496113_0029942
918 Ga0496113_0055077
919 Ga0496113_0088669
920 Ga0496113_0253937
921 Ga0496114_0000014
922 Ga0496114_0033155
923 Ga0496114_0182470
924 Ga0496114_0247493
925 Ga0496115_0000003
926 Ga0496115_0000125
927 Ga0496115_0031289
928 Ga0496116_0001565
929 Ga0496117_0113649
930 Ga0496118_0000818
931 Ga0496118_0276065
932 Ga0496119_0004406
933 Ga0496119_0017577
934 Ga0496119_0079081
935 Ga0496120_0047251
936 Ga0496121_0023382
937 Ga0496125_0041535
938 Ga0496125_0139526
939 Ga0496125_0195812
940 Ga0496126_0113103
941 Ga0501031_0000289
942 Ga0501032_0000732
943 Ga0501033_0000353
944 Ga0501034_0176473
945 Ga0501034_0436529
946 Ga0501036_0000572
947 Ga0501037_0001054
948 Ga0501038_0000820
949 Ga0501042_0071829
950 Ga0501042_0342437
951 Ga0501043_0000818
952 Ga0501046_0000799
953 Ga0501047_0002001
954 Ga0501047_0117811
955 Ga0501048_0000551
956 Ga0501067_0038705
957 Ga0501068_0063011
958 Ga0501068_0068204
959 Ga0501068_0279396
960 Ga0501069_0038582
961 Ga0501070_0000651
962 Ga0501070_0029415
963 Ga0501070_0120255
964 Ga0501070_0307165
965 Ga0501071_0055286
966 Ga0501071_0277824
967 Ga0501071_0290310
968 Ga0501072_0018276
969 Ga0501073_0011682
970 Ga0501074_0010425
971 Ga0501074_0132540
972 Ga0501076_0111071
973 Ga0501079_0009049
974 Ga0501079_0031968
975 Ga0501080_0021593
976 Ga0501080_0194096
977 Ga0501080_0450287
978 Ga0501083_0005621
979 Ga0501083_0134337
980 Ga0501035_0000495
981 Ga0501035_0392089
982 Ga0501035_0738285
983 Ga0501044_0011736
984 Ga0501044_0135079
985 Ga0501044_0265692
986 Ga0501045_0056886
987 nmdc:mga0yw44_467161_c1
988 nmdc:mga0qj67_19036_c1
989 nmdc:mga0a205_1030_c2
990 nmdc:mga0a205_24_c2
991 Ga0495601_0000013
992 Ga0495601_0000124
993 Ga0495601_0047331
994 Ga0495601_0098169
995 Ga0495601_0353973
996 Ga0495612_0002368
997 Ga0495612_0010729
998 Ga0495612_0029758
999 Ga0495655_0000001
1000 Ga0495595_0000003
1001 Ga0495595_0000103
1002 Ga0495595_0094380
1003 Ga0495595_0113341
1004 Ga0495595_0198919
1005 Ga0495619_0000025
1006 Ga0495619_0000031
1007 Ga0495619_0000106
1008 Ga0495619_0000580
1009 Ga0495619_0001003
1010 Ga0495619_0002742
1011 Ga0495619_0018989
1012 Ga0495619_0355791
1013 Ga0500566_0003325
1014 Ga0500641_0000840
1015 Ga0500614_001709
1016 Ga0500628_000010
1017 Ga0501084_0282866
1018 Ga0501082_0022970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vzr-assembly1.cif.gz_A c-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with glucuronic acid 0.5755 81 174
8ivw-assembly4.cif.gz_J crystal structure of nrp2 in complex with anrp2-10 fab fragment 0.5718 84 233
6tdb-assembly2.cif.gz_B neuropilin2-b1 domain in a complex with the c-terminal vegfb167 peptide 0.5198 77 234
4qds-assembly1.cif.gz_B physical basis for nrp2 ligand binding 0.5131 77 172
2wz8-assembly1.cif.gz_A family 35 carbohydrate binding module from clostridium thermocellum 0.5079 64 174
ID Description Score Start End Superfamily
af_Q9U3K3_110_268_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.568 81 171 2.60.120.200
af_Q8N436_120_295_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5563 84 234 2.60.120.260
2vzqA00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5489 81 174 2.60.120.260
af_Q18163_11_183_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5212 79 235 2.60.120.260
4qdsB00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5131 77 172 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A838V794-F1-model_v4 DUF1326 domain-containing protein 0.9265 23 235
AF-A0A1M3BH89-F1-model_v4 Uncharacterized protein 0.9259 28 235
AF-A0A524JIX7-F1-model_v4 Uncharacterized protein 0.9197 41 235
AF-A0A7W0S1W3-F1-model_v4 Uncharacterized protein 0.9047 32 235
AF-A0A6J5ZYB9-F1-model_v4 Unannotated protein 0.9029 35 235

Map