F457048

General Info

Members Datasets Scaffolds Average Seq Length
509 273 475 416

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0047050|Ga0501043_0047050_688_2070
Length 460
Sequence VAAACHRDSRDEPGSRHAPRCRSWPGTGLHASIRRLHRMNRFRMIVALALIYMVFAILLNSVGTVILQSIYSFGVGKPEASLLELFKDLPIAITSFLVASFLPLLGYRRAMMIALAIVAGACVLMPLFPGFHTTELLFTCIGVSFALVKVAVYSSIGLLTDDKTEHGRLTNTIEGLFMVGVLIAGWLFSAFIDPHAPGNHAWLNVYWLLAVTCMLVIVLLAGSRMDESAARSDEGKSVRGSLLEMVHLFVRPLVYVFLASAFLYVLIEQSFGTWLPTFNNEVLKLPNAMSIQMASILAAATAVGRIAAGQVLRRVRWYTLLNLCVLGMGVLVLVVLPLARGITARPGVGWLDAPAAAYLIPLIGLLMAPIYPVINSVALSSLPKPSHAAMTGLIVIFSALGGTLGSRITAIVFSRFNGIDAFYFSLVPMTLILVTLYFFKRETDRHGMATPAPAVRLAAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221559 Lysobacter sp. Root559 Isolate Unclassified
3 2643221573 Lysobacter sp. Root604 Isolate Unclassified
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
8 2643221612 Lysobacter sp. Root76 Isolate Unclassified
9 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
10 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
15 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
16 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
17 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
18 2739367700 Dyella sp. YR388 Isolate Unclassified
19 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
20 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
21 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
22 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
23 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
24 2884411467 Dyella sp. AD56 Isolate Rhizosphere
25 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
26 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
27 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
28 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
29 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
30 2928963466 Dyella japonica 1073 Isolate Unclassified
31 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
32 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
33 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
34 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
38 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
39 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
40 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
41 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
42 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
46 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
47 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
48 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
49 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
106 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
120 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
123 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
261 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
269 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.14
Metatranscriptomes 1.18
Isolates 6.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.83
Nodule 0
Rhizoplane 2.16
Rhizosphere 58.94
Stem 0
Stem Tuber 0
Unclassified 18.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1943480 2162886007 Bacteria 4784
2 JGI24739J22299_10001186 3300001989 Bacteria 9759
3 JGI24735J21928_10001527 3300002067 Bacteria 8204
4 JGI24735J21928_10005092 3300002067 Bacteria 4375
5 JGI24735J21928_10013237 3300002067 Bacteria 2597
6 JGI25156J39149_1001356 3300002705 Bacteria 10502
7 JGI25156J39149_1003613 3300002705 Bacteria 4983
8 JGI25156J39149_1016476 3300002705 Bacteria 1435
9 JGI25162J39368_1000781 3300002737 Bacteria 21361
10 JGI25162J39368_1001100 3300002737 Bacteria 16411
11 JGI25162J39368_1001302 3300002737 Bacteria 14095
12 JGI25162J39368_1002170 3300002737 Bacteria 8165
13 JGI25157J39369_1000433 3300002741 Bacteria 27238
14 JGI25157J39369_1000830 3300002741 Bacteria 15326
15 JGI25157J39369_1001288 3300002741 Bacteria 10042
16 JGI25157J39369_1001902 3300002741 Bacteria 6363
17 JGI25163J39215_1000233 3300002771 Bacteria 20699
18 JGI25164J39214_1000030 3300002772 Bacteria 145974
19 JGI25164J39214_1000317 3300002772 Bacteria 31376
20 JGI25164J39214_1000478 3300002772 Bacteria 19726
21 JGI25165J46597_1000057 3300003214 Bacteria 217135
22 JGI25165J46597_1000109 3300003214 Bacteria 149484
23 JGI25165J46597_1000601 3300003214 Bacteria 30833
24 JGI25165J46597_1000955 3300003214 Bacteria 19726
25 rootH1_10020971 3300003316 Bacteria 3474
26 rootH2_10007042 3300003320 Bacteria 38280
27 rootH2_10077280 3300003320 Bacteria 2649
28 Ga0006562J51391_1005457 3300003578 Bacteria 12571
29 Ga0006562J51391_1005461 3300003578 Bacteria 3040
30 Ga0055538_1000742 3300003751 Bacteria 9457
31 Ga0055533_1001004 3300003756 Bacteria 8191
32 Ga0055525_1000124 3300003759 Bacteria 116698
33 Ga0055527_1000111 3300003760 Bacteria 58194
34 Ga0055527_1001516 3300003760 Bacteria 4775
35 Ga0055535_1000204 3300003761 Bacteria 62769
36 Ga0055535_1000238 3300003761 Bacteria 58182
37 Ga0055535_1000885 3300003761 Bacteria 20792
38 Ga0055535_1001125 3300003761 Bacteria 16058
39 Ga0055535_1001135 3300003761 Bacteria 15841
40 Ga0055542_1000243 3300003762 Bacteria 62769
41 Ga0055542_1000272 3300003762 Bacteria 58181
42 Ga0055542_1000278 3300003762 Bacteria 57321
43 Ga0055542_1000359 3300003762 Bacteria 47683
44 Ga0055542_1000432 3300003762 Bacteria 40265
45 Ga0055542_1000599 3300003762 Bacteria 30833
46 Ga0055529_1000137 3300003763 Bacteria 103695
47 Ga0055529_1000299 3300003763 Bacteria 57321
48 Ga0055529_1000446 3300003763 Bacteria 41042
49 Ga0055529_1000915 3300003763 Bacteria 16058
50 Ga0055526_1000032 3300003771 Bacteria 143118
51 Ga0055537_1000283 3300003773 Bacteria 36181
52 Ga0055524_1000054 3300003775 Bacteria 143118
53 Ga0055536_1005078 3300003781 Bacteria 6532
54 Ga0055534_1000041 3300003784 Bacteria 101875
55 Ga0055528_1000021 3300003790 Bacteria 143118
56 Ga0055531_10005938 3300003794 Bacteria 7022
57 Ga0065165_1003868 3300005262 Bacteria 9936
58 Ga0065704_10073684 3300005289 Bacteria 6891
59 Ga0070658_10002406 3300005327 Bacteria 15657
60 Ga0070658_10045831 3300005327 Bacteria 3536
61 Ga0070658_10094239 3300005327 Bacteria 2470
62 Ga0070658_10169483 3300005327 Bacteria 1834
63 Ga0070670_100022258 3300005331 Bacteria 5456
64 Ga0070666_10000058 3300005335 Bacteria 89886
65 Ga0070666_10049267 3300005335 Bacteria 2830
66 Ga0070682_100029783 3300005337 Bacteria 3290
67 Ga0070682_100075861 3300005337 Bacteria 2163
68 Ga0070682_100138702 3300005337 Bacteria 1655
69 Ga0068868_100077627 3300005338 Bacteria 2657
70 Ga0070660_100021842 3300005339 Bacteria 4725
71 Ga0070660_100092619 3300005339 Bacteria 2385
72 Ga0070689_100002971 3300005340 Bacteria 11141
73 Ga0070661_100017224 3300005344 Bacteria 5123
74 Ga0070692_10024870 3300005345 Bacteria 2947
75 Ga0070659_100242388 3300005366 Bacteria 1492
76 Ga0070667_100000012 3300005367 Bacteria 258575
77 Ga0070713_100000361 3300005436 Bacteria 29277
78 Ga0070663_100000168 3300005455 Bacteria 33013
79 Ga0070663_100042525 3300005455 Bacteria 3193
80 Ga0070662_100028407 3300005457 Bacteria 3891
81 Ga0070681_10046411 3300005458 Bacteria 4343
82 Ga0070681_10144443 3300005458 Bacteria 2309
83 Ga0068867_100003427 3300005459 Bacteria 11150
84 Ga0070685_10026162 3300005466 Bacteria 3214
85 Ga0070679_100002897 3300005530 Bacteria 15586
86 Ga0070679_100097916 3300005530 Bacteria 2921
87 Ga0068853_100025464 3300005539 Bacteria 4964
88 Ga0068853_100256220 3300005539 Bacteria 1607
89 Ga0070696_100001669 3300005546 Bacteria 14552
90 Ga0070693_100021313 3300005547 Bacteria 3431
91 Ga0070665_100000525 3300005548 Bacteria 54632
92 Ga0070665_100120986 3300005548 Bacteria 2619
93 Ga0068855_100024543 3300005563 Bacteria 7214
94 Ga0068855_100028009 3300005563 Bacteria 6740
95 Ga0068855_100115344 3300005563 Bacteria 3079
96 Ga0068855_100159584 3300005563 Bacteria 2560
97 Ga0068857_100002638 3300005577 Bacteria 14726
98 Ga0068857_100006038 3300005577 Bacteria 10344
99 Ga0068857_100081412 3300005577 Unclassified 2891
100 Ga0068854_100002988 3300005578 Bacteria 10488
101 Ga0068854_100019288 3300005578 Bacteria 4594
102 Ga0068856_100000074 3300005614 Bacteria 94656
103 Ga0068856_100004734 3300005614 Bacteria 13510
104 Ga0068856_100021187 3300005614 Bacteria 6313
105 Ga0068856_100028390 3300005614 Bacteria 5463
106 Ga0068852_100010032 3300005616 Bacteria 7048
107 Ga0068852_100093436 3300005616 Bacteria 2696
108 Ga0068861_100010971 3300005719 Bacteria 6297
109 Ga0068851_10008638 3300005834 Bacteria 4717
110 Ga0068858_100006871 3300005842 Bacteria 11058
111 Ga0068858_100099751 3300005842 Bacteria 2708
112 Ga0068860_100018687 3300005843 Bacteria 6740
113 Ga0097621_100045831 3300006237 Bacteria 3534
114 Ga0068871_100001578 3300006358 Bacteria 15322
115 Ga0068871_100077597 3300006358 Bacteria 2745
116 Ga0068865_100002526 3300006881 Bacteria 10832
117 Ga0068865_100095731 3300006881 Bacteria 2164
118 Ga0105244_10000162 3300009036 Bacteria 69050
119 Ga0105244_10105112 3300009036 Bacteria 1378
120 Ga0105240_10000668 3300009093 Bacteria 62941
121 Ga0105240_10005042 3300009093 Bacteria 19810
122 Ga0105240_10005178 3300009093 Bacteria 19502
123 Ga0105240_10007396 3300009093 Bacteria 15967
124 Ga0105240_10025529 3300009093 Bacteria 7763
125 Ga0105240_10310627 3300009093 Bacteria 1800
126 Ga0105241_10001296 3300009174 Bacteria 19031
127 Ga0105242_10000796 3300009176 Bacteria 24434
128 Ga0105248_10000775 3300009177 Bacteria 35867
129 Ga0105237_10000084 3300009545 Bacteria 125742
130 Ga0105237_10001831 3300009545 Bacteria 27394
131 Ga0105237_10002103 3300009545 Bacteria 25148
132 Ga0105237_10008487 3300009545 Bacteria 11118
133 Ga0105237_10027440 3300009545 Bacteria 5813
134 Ga0105237_10051826 3300009545 Bacteria 4122
135 Ga0105237_10277448 3300009545 Bacteria 1678
136 Ga0105238_10000290 3300009551 Bacteria 55810
137 Ga0105238_10004377 3300009551 Bacteria 14013
138 Ga0105238_10012215 3300009551 Bacteria 8658
139 Ga0105238_10023698 3300009551 Bacteria 6255
140 Ga0105238_10032333 3300009551 Bacteria 5323
141 Ga0105238_10165062 3300009551 Bacteria 2190
142 Ga0105249_10000700 3300009553 Bacteria 30410
143 Ga0105249_10001525 3300009553 Bacteria 20309
144 Ga0105249_10067072 3300009553 Bacteria 3305
145 Ga0105239_10000174 3300010375 Bacteria 92922
146 Ga0105239_10010755 3300010375 Bacteria 10222
147 Ga0105239_10019573 3300010375 Bacteria 7472
148 Ga0105239_10022221 3300010375 Bacteria 6991
149 Ga0105239_10346184 3300010375 Bacteria 1678
150 Ga0157314_1000262 3300012500 Bacteria 5642
151 Ga0157347_1000298 3300012502 Bacteria 2999
152 Ga0157373_10117196 3300013100 Bacteria 1872
153 Ga0157371_10005860 3300013102 Bacteria 10268
154 Ga0157371_10005862 3300013102 Bacteria 10266
155 Ga0157371_10028629 3300013102 Bacteria 4032
156 Ga0157370_10000645 3300013104 Bacteria 43455
157 Ga0157370_10001577 3300013104 Bacteria 28199
158 Ga0157370_10001864 3300013104 Bacteria 25997
159 Ga0157370_10002428 3300013104 Bacteria 22462
160 Ga0157370_10276821 3300013104 Bacteria 1551
161 Ga0157369_10000001 3300013105 Bacteria 554908
162 Ga0157369_10000684 3300013105 Bacteria 43870
163 Ga0157369_10209627 3300013105 Bacteria 2043
164 Ga0157369_10333953 3300013105 Bacteria 1574
165 Ga0157369_10339510 3300013105 Unclassified 1560
166 Ga0157369_10387357 3300013105 Bacteria 1451
167 Ga0157378_10011360 3300013297 Bacteria 7794
168 Ga0163162_10001587 3300013306 Bacteria 21250
169 Ga0157372_10030852 3300013307 Bacteria 5865
170 Ga0157372_10037682 3300013307 Bacteria 5335
171 Ga0157375_10010460 3300013308 Bacteria 8165
172 Ga0157375_10064817 3300013308 Bacteria 3639
173 Ga0157379_10151387 3300014968 Bacteria 2093
174 Ga0157376_10007645 3300014969 Bacteria 7738
175 Ga0157376_10048542 3300014969 Bacteria 3511
176 Ga0182006_1014868 3300015261 Bacteria 3348
177 Ga0182007_10010019 3300015262 Bacteria 3773
178 Ga0183369_1013 3300015685 Bacteria 222738
179 Ga0183368_1003 3300015687 Bacteria 1276390
180 Ga0163161_10000033 3300017792 Bacteria 163809
181 Ga0209435_104107 3300025206 Bacteria 1651
182 Ga0209760_100778 3300025207 Bacteria 4492
183 Ga0209784_100011 3300025224 Bacteria 546770
184 Ga0209566_102188 3300025225 Bacteria 3897
185 Ga0209674_100012 3300025226 Bacteria 950162
186 Ga0209674_100309 3300025226 Bacteria 32721
187 Ga0209674_100575 3300025226 Bacteria 14302
188 Ga0209672_100005 3300025228 Bacteria 1069303
189 Ga0209672_100055 3300025228 Bacteria 221655
190 Ga0209672_100227 3300025228 Bacteria 43114
191 Ga0209672_100706 3300025228 Bacteria 16637
192 Ga0209672_101056 3300025228 Bacteria 11790
193 Ga0209672_106181 3300025228 Bacteria 1974
194 Ga0209563_100045 3300025230 Bacteria 377102
195 Ga0207427_100026 3300025231 Bacteria 412764
196 Ga0207427_100053 3300025231 Bacteria 217191
197 Ga0207427_100150 3300025231 Bacteria 78685
198 Ga0207427_101499 3300025231 Bacteria 8302
199 Ga0209437_100108 3300025233 Bacteria 217191
200 Ga0209437_100200 3300025233 Bacteria 119306
201 Ga0209437_100403 3300025233 Bacteria 40042
202 Ga0209437_100470 3300025233 Bacteria 30896
203 Ga0209437_104869 3300025233 Bacteria 2331
204 Ga0209258_100006 3300025242 Bacteria 1069303
205 Ga0209258_100012 3300025242 Bacteria 825544
206 Ga0209258_100027 3300025242 Bacteria 518449
207 Ga0209258_100055 3300025242 Bacteria 337291
208 Ga0209258_100255 3300025242 Bacteria 94924
209 Ga0209258_101030 3300025242 Bacteria 12488
210 Ga0209646_1001028 3300025246 Bacteria 8438
211 Ga0209646_1001184 3300025246 Bacteria 7562
212 Ga0209646_1001510 3300025246 Bacteria 6176
213 Ga0209026_1000017 3300025250 Bacteria 385214
214 Ga0209026_1000055 3300025250 Bacteria 237197
215 Ga0209026_1000084 3300025250 Bacteria 186997
216 Ga0209026_1000460 3300025250 Bacteria 31536
217 Ga0209026_1000548 3300025250 Bacteria 25899
218 Ga0209026_1004536 3300025250 Bacteria 4087
219 Ga0209677_100818 3300025253 Bacteria 15538
220 Ga0209148_1000001 3300025254 Bacteria 2545271
221 Ga0209148_1000002 3300025254 Bacteria 2399500
222 Ga0209148_1000012 3300025254 Bacteria 1069303
223 Ga0209148_1000014 3300025254 Bacteria 925277
224 Ga0209148_1000058 3300025254 Bacteria 357482
225 Ga0209148_1000221 3300025254 Bacteria 94627
226 Ga0209148_1004024 3300025254 Bacteria 3757
227 Ga0209759_1000191 3300025256 Bacteria 97876
228 Ga0209759_1000679 3300025256 Bacteria 30848
229 Ga0209759_1016813 3300025256 Bacteria 1830
230 Ga0209129_1001530 3300025258 Bacteria 12766
231 Ga0209233_1000002 3300025261 Bacteria 2501366
232 Ga0209233_1000125 3300025261 Bacteria 217190
233 Ga0209233_1000167 3300025261 Bacteria 149536
234 Ga0209233_1000193 3300025261 Bacteria 126812
235 Ga0209233_1026281 3300025261 Bacteria 1426
236 Ga0209565_1000001 3300025263 Bacteria 2950419
237 Ga0209565_1006427 3300025263 Bacteria 3298
238 Ga0209455_1000008 3300025272 Bacteria 1069303
239 Ga0209455_1000014 3300025272 Bacteria 806601
240 Ga0209455_1000018 3300025272 Bacteria 718034
241 Ga0209455_1000019 3300025272 Bacteria 705658
242 Ga0209455_1000266 3300025272 Bacteria 59221
243 Ga0209455_1001811 3300025272 Bacteria 8979
244 Ga0209455_1003695 3300025272 Bacteria 5294
245 Ga0209673_1000001 3300025273 Bacteria 3176258
246 Ga0209675_1000001 3300025291 Bacteria 2950293
247 Ga0209676_1000063 3300025292 Bacteria 322025
248 Ga0209564_1000001 3300025295 Bacteria 3176258
249 Ga0209758_1003595 3300025297 Bacteria 13868
250 Ga0209256_1000002 3300025299 Bacteria 1906740
251 Ga0209257_1001076 3300025304 Bacteria 35902
252 Ga0207656_10011871 3300025321 Bacteria 3300
253 Ga0207655_1000003 3300025728 Bacteria 1081376
254 Ga0207680_10000006 3300025903 Bacteria 635950
255 Ga0207680_10001284 3300025903 Bacteria 11889
256 Ga0207647_10000313 3300025904 Bacteria 40307
257 Ga0207647_10003100 3300025904 Bacteria 12485
258 Ga0207647_10009984 3300025904 Bacteria 6723
259 Ga0207647_10055188 3300025904 Bacteria 2442
260 Ga0207705_10001691 3300025909 Bacteria 17551
261 Ga0207705_10007296 3300025909 Bacteria 8127
262 Ga0207705_10025028 3300025909 Bacteria 4261
263 Ga0207705_10047723 3300025909 Bacteria 3079
264 Ga0207705_10108230 3300025909 Bacteria 2051
265 Ga0207654_10004994 3300025911 Bacteria 6706
266 Ga0207707_10013800 3300025912 Bacteria 7046
267 Ga0207707_10047849 3300025912 Bacteria 3724
268 Ga0207707_10134998 3300025912 Bacteria 2157
269 Ga0207695_10000007 3300025913 Bacteria 1092551
270 Ga0207695_10000791 3300025913 Bacteria 59405
271 Ga0207695_10004123 3300025913 Bacteria 19960
272 Ga0207695_10005153 3300025913 Bacteria 17501
273 Ga0207695_10006964 3300025913 Bacteria 14514
274 Ga0207695_10007953 3300025913 Bacteria 13376
275 Ga0207695_10011180 3300025913 Bacteria 10891
276 Ga0207695_10023015 3300025913 Bacteria 7055
277 Ga0207695_10041539 3300025913 Bacteria 4922
278 Ga0207671_10000011 3300025914 Bacteria 530349
279 Ga0207671_10000507 3300025914 Bacteria 52802
280 Ga0207671_10003934 3300025914 Bacteria 14484
281 Ga0207671_10015522 3300025914 Bacteria 5958
282 Ga0207671_10125218 3300025914 Bacteria 1968
283 Ga0207660_10101504 3300025917 Bacteria 2150
284 Ga0207657_10019311 3300025919 Bacteria 6476
285 Ga0207657_10060289 3300025919 Bacteria 3257
286 Ga0207657_10076845 3300025919 Bacteria 2816
287 Ga0207652_10000768 3300025921 Bacteria 30720
288 Ga0207652_10022481 3300025921 Bacteria 5217
289 Ga0207694_10000311 3300025924 Bacteria 45796
290 Ga0207694_10000957 3300025924 Bacteria 25496
291 Ga0207694_10001044 3300025924 Bacteria 24087
292 Ga0207694_10082749 3300025924 Bacteria 2523
293 Ga0207694_10088688 3300025924 Bacteria 2438
294 Ga0207694_10099425 3300025924 Bacteria 2304
295 Ga0207700_10004771 3300025928 Bacteria 8041
296 Ga0207664_10000170 3300025929 Bacteria 51533
297 Ga0207690_10000401 3300025932 Bacteria 28598
298 Ga0207690_10039330 3300025932 Bacteria 3085
299 Ga0207706_10002456 3300025933 Bacteria 18092
300 Ga0207706_10034293 3300025933 Bacteria 4516
301 Ga0207706_10093705 3300025933 Bacteria 2641
302 Ga0207670_10002068 3300025936 Bacteria 10503
303 Ga0207711_10004949 3300025941 Bacteria 11311
304 Ga0207667_10000249 3300025949 Bacteria 75885
305 Ga0207667_10001682 3300025949 Bacteria 27862
306 Ga0207667_10114210 3300025949 Bacteria 2784
307 Ga0207667_10141026 3300025949 Bacteria 2481
308 Ga0207712_10000466 3300025961 Bacteria 34075
309 Ga0207712_10000802 3300025961 Bacteria 23175
310 Ga0207712_10037572 3300025961 Bacteria 3305
311 Ga0207640_10001067 3300025981 Bacteria 15190
312 Ga0207640_10001917 3300025981 Bacteria 11181
313 Ga0207640_10007445 3300025981 Bacteria 6043
314 Ga0207640_10055228 3300025981 Bacteria 2600
315 Ga0207640_10106807 3300025981 Unclassified 1975
316 Ga0207658_10000614 3300025986 Bacteria 31571
317 Ga0207703_10000759 3300026035 Bacteria 31818
318 Ga0207639_10000364 3300026041 Bacteria 31337
319 Ga0207639_10004137 3300026041 Bacteria 9772
320 Ga0207678_10001087 3300026067 Bacteria 24921
321 Ga0207678_10004555 3300026067 Bacteria 12468
322 Ga0207678_10007800 3300026067 Bacteria 9452
323 Ga0207678_10045552 3300026067 Bacteria 3793
324 Ga0207702_10000146 3300026078 Bacteria 82931
325 Ga0207702_10001245 3300026078 Bacteria 25719
326 Ga0207702_10011349 3300026078 Bacteria 7428
327 Ga0207648_10005953 3300026089 Bacteria 12201
328 Ga0207674_10003839 3300026116 Bacteria 18316
329 Ga0207674_10013768 3300026116 Bacteria 8950
330 Ga0207698_10118506 3300026142 Bacteria 2236
331 Ga0268266_10000006 3300028379 Bacteria 1410021
332 Ga0268266_10000043 3300028379 Bacteria 316604
333 Ga0268264_10080632 3300028381 Bacteria 2779
334 Ga0265760_10004605 3300031090 Bacteria 3951
335 Ga0307408_100009596 3300031548 Bacteria 6384
336 Ga0307408_100240958 3300031548 Bacteria 1486
337 Ga0307413_10000050 3300031824 Bacteria 30598
338 Ga0307410_10001059 3300031852 Bacteria 11970
339 Ga0307406_10000003 3300031901 Bacteria 251998
340 Ga0307406_10004775 3300031901 Bacteria 7383
341 Ga0307407_10001073 3300031903 Bacteria 9494
342 Ga0307412_10063824 3300031911 Bacteria 2486
343 Ga0307414_10000001 3300032004 Bacteria 1352954
344 Ga0307411_10000003 3300032005 Bacteria 477556
345 Ga0307411_10023635 3300032005 Bacteria 3646
346 Ga0307510_10000260 3300033180 Bacteria 48220
347 Ga0316574_0143582 3300035398 Unclassified 1538
348 Ga0373937_0146182 3300036401 Bacteria 2213
349 Ga0395899_0000076 3300037312 Bacteria 177673
350 Ga0395899_0006222 3300037312 Bacteria 9251
351 Ga0395899_0117982 3300037312 Bacteria 1903
352 Ga0395900_0000024 3300037418 Bacteria 323480
353 Ga0395898_0000044 3300037466 Bacteria 298164
354 Ga0395898_0000311 3300037466 Bacteria 112412
355 Ga0436364_0421907 3300037853 Bacteria 3517
356 Ga0395901_0159049 3300038443 Bacteria 2372
357 Ga0436365_1048154 3300039437 Bacteria 4287
358 Ga0439447_010679 3300041407 Bacteria 2714
359 Ga0439466_0002196 3300041411 Bacteria 7637
360 Ga0439465_0019453 3300041413 Bacteria 2122
361 Ga0451800_0893161 3300041459 Bacteria 2507
362 Ga0439433_0007080 3300041999 Bacteria 2422
363 Ga0466969_0001243 3300044656 Bacteria 13760
364 Ga0466969_0010581 3300044656 Bacteria 4889
365 Ga0466972_0010097 3300044658 Bacteria 4744
366 Ga0466982_0000012 3300044672 Bacteria 166823
367 Ga0466965_0024975 3300044683 Bacteria 2891
368 Ga0466966_0010153 3300044684 Bacteria 6245
369 Ga0466966_0015281 3300044684 Bacteria 5076
370 Ga0466961_0000661 3300044693 Bacteria 21708
371 Ga0466961_0001936 3300044693 Bacteria 12901
372 Ga0466961_0002899 3300044693 Bacteria 10640
373 Ga0466961_0022875 3300044693 Bacteria 4020
374 Ga0466964_0047133 3300044706 Bacteria 1758
375 Ga0453684_0160290 3300044712 Bacteria 2662
376 Ga0466971_0013041 3300044719 Bacteria 3646
377 Ga0466968_0012926 3300044735 Bacteria 3275
378 Ga0466970_0036017 3300044765 Bacteria 2621
379 Ga0466960_0076599 3300044901 Bacteria 1675
380 Ga0466959_0000112 3300045049 Bacteria 52606
381 Ga0466959_0026184 3300045049 Bacteria 4323
382 Ga0466959_0031102 3300045049 Bacteria 3950
383 Ga0466958_0107450 3300045836 Bacteria 1740
384 Ga0495638_0000248 3300046460 Bacteria 73332
385 Ga0495638_0001918 3300046460 Bacteria 17898
386 Ga0495650_0000027 3300046471 Bacteria 475071
387 Ga0495650_0000961 3300046471 Bacteria 33088
388 Ga0495606_0000113 3300046507 Bacteria 136805
389 Ga0495631_0008689 3300046518 Bacteria 5110
390 Ga0495665_0098760 3300046531 Bacteria 1533
391 Ga0495622_0002070 3300046557 Bacteria 9802
392 Ga0495625_0009914 3300046660 Bacteria 7921
393 Ga0495588_0065143 3300046674 Bacteria 1890
394 Ga0495657_0075518 3300046675 Bacteria 2191
395 Ga0495658_0050959 3300046683 Bacteria 2343
396 Ga0495669_0000016 3300046684 Bacteria 135096
397 Ga0495649_0000784 3300046694 Bacteria 25529
398 Ga0495660_0097730 3300046810 Bacteria 1516
399 Ga0495686_0006177 3300047472 Bacteria 9252
400 Ga0496104_0000017 3300048907 Bacteria 325877
401 Ga0496105_0000009 3300048908 Bacteria 325734
402 Ga0496105_0003298 3300048908 Bacteria 11919
403 Ga0496106_0023741 3300048909 Bacteria 4557
404 Ga0496114_0005944 3300048917 Bacteria 9594
405 Ga0496115_0000085 3300048918 Bacteria 86743
406 Ga0496115_0000247 3300048918 Bacteria 48853
407 Ga0496115_0002434 3300048918 Bacteria 13368
408 Ga0496115_0012667 3300048918 Bacteria 6355
409 Ga0496115_0013895 3300048918 Bacteria 6094
410 Ga0496116_0000002 3300048919 Bacteria 920291
411 Ga0496116_0057584 3300048919 Bacteria 2540
412 Ga0496117_0004251 3300048920 Bacteria 15984
413 Ga0496117_0025553 3300048920 Bacteria 4641
414 Ga0496117_0038958 3300048920 Bacteria 3514
415 Ga0496117_0045955 3300048920 Bacteria 3147
416 Ga0496118_0003996 3300048921 Bacteria 17971
417 Ga0496118_0020659 3300048921 Bacteria 5832
418 Ga0496118_0030804 3300048921 Bacteria 4465
419 Ga0496118_0063012 3300048921 Bacteria 2731
420 Ga0496119_0000248 3300048922 Bacteria 76311
421 Ga0496119_0021112 3300048922 Bacteria 4719
422 Ga0496120_0000143 3300048923 Bacteria 120051
423 Ga0496120_0000145 3300048923 Bacteria 119265
424 Ga0496121_0000593 3300048924 Bacteria 67965
425 Ga0496121_0009148 3300048924 Bacteria 11455
426 Ga0496121_0022679 3300048924 Bacteria 6078
427 Ga0496121_0037878 3300048924 Bacteria 4278
428 Ga0496121_0061690 3300048924 Bacteria 3075
429 Ga0496121_0073989 3300048924 Bacteria 2727
430 Ga0496121_0128404 3300048924 Bacteria 1902
431 Ga0496122_0000906 3300048925 Bacteria 54604
432 Ga0496123_0001225 3300048926 Bacteria 37380
433 Ga0496123_0007593 3300048926 Bacteria 10161
434 Ga0496123_0011182 3300048926 Bacteria 7812
435 Ga0496125_0000007 3300048928 Bacteria 715355
436 Ga0496125_0000239 3300048928 Bacteria 112926
437 Ga0496125_0051641 3300048928 Bacteria 3389
438 Ga0496125_0098516 3300048928 Bacteria 2163
439 Ga0496126_0000033 3300048929 Bacteria 368851
440 Ga0496126_0000712 3300048929 Bacteria 60417
441 Ga0496126_0006514 3300048929 Bacteria 12995
442 Ga0496126_0006533 3300048929 Bacteria 12981
443 Ga0496126_0008982 3300048929 Bacteria 10696
444 Ga0496126_0017425 3300048929 Bacteria 7157
445 Ga0496126_0050003 3300048929 Bacteria 3813
446 Ga0496126_0206503 3300048929 Bacteria 1655
447 Ga0495682_0029988 3300049460 Bacteria 2014
448 Ga0501314_000168 3300049530 Bacteria 3435
449 Ga0501323_000658 3300049539 Bacteria 2668
450 Ga0501325_002504 3300049541 Bacteria 1263
451 Ga0501033_0000902 3300049570 Bacteria 27130
452 Ga0501034_0000376 3300049571 Bacteria 75867
453 Ga0501043_0047050 3300049579 Bacteria 3391
454 Ga0501046_0015201 3300049580 Bacteria 6472
455 Ga0501046_0073699 3300049580 Bacteria 2649
456 Ga0501047_0068987 3300049581 Bacteria 3405
457 Ga0501048_0077068 3300049582 Bacteria 2353
458 Ga0501070_0088350 3300049586 Bacteria 2565
459 Ga0501238_000253 3300049671 Bacteria 7253
460 Ga0501249_001773 3300049679 Bacteria 4396
461 Ga0501080_0077703 3300049742 Bacteria 3087
462 Ga0501266_000028 3300049763 Bacteria 44542
463 Ga0501280_000996 3300049776 Bacteria 5873
464 Ga0501035_0018201 3300049822 Bacteria 6470
465 Ga0501044_0034850 3300049823 Bacteria 5275
466 Ga0500610_0100490 3300053079 Bacteria 1497
467 Ga0500643_005740 3300053087 Bacteria 5296
468 Ga0500646_0015409 3300053090 Bacteria 1989
469 Ga0500583_0025826 3300053092 Bacteria 2514
470 Ga0500641_0000004 3300053096 Bacteria 263911
471 Ga0500597_000062 3300053120 Bacteria 21780
472 Ga0500658_0000001 3300053134 Bacteria 592738
473 Ga0500584_001004 3300053726 Bacteria 9182
474 Ga0466962_0005119 3300061719 Bacteria 6307
475 Ga0466962_0008190 3300061719 Bacteria 5013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025728 Ga0207655_1000003 Ga0207655_1000003445 352
2 3300053726 Ga0500584_001004 Ga0500584_001004_3923_5143 352
3 3300049541 Ga0501325_002504 Ga0501325_002504_84_1154 355
4 3300009036 Ga0105244_10000162 Ga0105244_100001627 359
5 3300005335 Ga0070666_10000058 Ga0070666_100000589 371
6 3300005548 Ga0070665_100120986 Ga0070665_1001209862 371
7 3300009551 Ga0105238_10000290 Ga0105238_100002902 371
8 3300013306 Ga0163162_10001587 Ga0163162_100015875 371
9 3300025903 Ga0207680_10000006 Ga0207680_10000006138 371
10 3300025909 Ga0207705_10007296 Ga0207705_100072962 371
11 3300025924 Ga0207694_10000311 Ga0207694_1000031136 371
12 3300028379 Ga0268266_10000043 Ga0268266_10000043195 371
13 3300048924 Ga0496121_0061690 Ga0496121_0061690_876_2141 371
14 3300048928 Ga0496125_0051641 Ga0496125_0051641_1057_2322 371
15 3300048929 Ga0496126_0017425 Ga0496126_0017425_3738_5003 371
16 3300003794 Ga0055531_10005938 Ga0055531_100059383 374
17 3300025304 Ga0209257_1001076 Ga0209257_10010768 374
18 3300048926 Ga0496123_0007593 Ga0496123_0007593_4325_5563 380
19 3300046518 Ga0495631_0008689 Ga0495631_0008689_3755_4966 381
20 3300046660 Ga0495625_0009914 Ga0495625_0009914_6452_7663 381
21 3300046684 Ga0495669_0000016 Ga0495669_0000016_70959_72170 381
22 3300046810 Ga0495660_0097730 Ga0495660_0097730_41_1252 381
23 3300053079 Ga0500610_0100490 Ga0500610_0100490_211_1422 381
24 3300053092 Ga0500583_0025826 Ga0500583_0025826_1217_2428 381
25 3300035398 Ga0316574_0143582 Ga0316574_0143582_344_1510 382
26 3300005366 Ga0070659_100242388 Ga0070659_1002423881 386
27 3300013105 Ga0157369_10387357 Ga0157369_103873571 386
28 3300048919 Ga0496116_0000002 Ga0496116_0000002_637642_638862 387
29 3300013100 Ga0157373_10117196 Ga0157373_101171961 388
30 3300013104 Ga0157370_10001864 Ga0157370_100018642 388
31 3300013104 Ga0157370_10002428 Ga0157370_1000242814 388
32 3300013105 Ga0157369_10000684 Ga0157369_1000068411 388
33 3300048920 Ga0496117_0025553 Ga0496117_0025553_2356_3576 388
34 3300048921 Ga0496118_0030804 Ga0496118_0030804_73_1293 388
35 3300048928 Ga0496125_0000007 Ga0496125_0000007_636449_637669 388
36 3300048929 Ga0496126_0006514 Ga0496126_0006514_8442_9662 388
37 3300032005 Ga0307411_10000003 Ga0307411_1000000393 389
38 3300017792 Ga0163161_10000033 Ga0163161_1000003394 392
39 3300049679 Ga0501249_001773 Ga0501249_001773_1073_2293 392
40 3300003771 Ga0055526_1000032 Ga0055526_100003286 393
41 3300003773 Ga0055537_1000283 Ga0055537_100028329 393
42 3300003775 Ga0055524_1000054 Ga0055524_100005486 393
43 3300003784 Ga0055534_1000041 Ga0055534_100004129 393
44 3300003790 Ga0055528_1000021 Ga0055528_100002129 393
45 3300041407 Ga0439447_010679 Ga0439447_010679_1414_2634 393
46 3300037853 Ga0436364_0421907 Ga0436364_0421907_19_1293 394
47 3300025263 Ga0209565_1000001 Ga0209565_10000012083 395
48 3300025273 Ga0209673_1000001 Ga0209673_10000012083 395
49 3300025291 Ga0209675_1000001 Ga0209675_1000001449 395
50 3300025295 Ga0209564_1000001 Ga0209564_1000001611 395
51 3300025299 Ga0209256_1000002 Ga0209256_1000002941 395
52 3300044712 Ga0453684_0160290 Ga0453684_0160290_1123_2376 396
53 iso_pu_bacteria 2852680915 2852681962 396
54 3300049763 Ga0501266_000028 Ga0501266_000028_17373_18638 397
55 3300003316 rootH1_10020971 rootH1_100209712 398
56 3300013104 Ga0157370_10276821 Ga0157370_102768212 398
57 3300013105 Ga0157369_10339510 Ga0157369_103395102 398
58 3300033180 Ga0307510_10000260 Ga0307510_1000026022 398
59 3300046471 Ga0495650_0000027 Ga0495650_0000027_465767_467032 398
60 3300002737 JGI25162J39368_1002170 JGI25162J39368_10021703 399
61 3300003760 Ga0055527_1001516 Ga0055527_10015163 399
62 3300003761 Ga0055535_1001135 Ga0055535_10011355 399
63 3300003762 Ga0055542_1000359 Ga0055542_100035930 399
64 3300003763 Ga0055529_1000137 Ga0055529_10001376 399
65 3300010375 Ga0105239_10346184 Ga0105239_103461842 399
66 3300006358 Ga0068871_100001578 Ga0068871_1000015782 400
67 3300009036 Ga0105244_10105112 Ga0105244_101051122 400
68 3300013308 Ga0157375_10064817 Ga0157375_100648172 400
69 3300014969 Ga0157376_10048542 Ga0157376_100485422 400
70 3300025246 Ga0209646_1001184 Ga0209646_10011844 400
71 3300025250 Ga0209026_1000548 Ga0209026_100054815 400
72 3300037312 Ga0395899_0117982 Ga0395899_0117982_364_1629 400
73 3300038443 Ga0395901_0159049 Ga0395901_0159049_672_1937 400
74 3300053090 Ga0500646_0015409 Ga0500646_0015409_353_1573 400
75 3300053096 Ga0500641_0000004 Ga0500641_0000004_164877_166097 400
76 3300053134 Ga0500658_0000001 Ga0500658_0000001_487516_488736 400
77 iso_pu_bacteria 2643221600 2644011931 401
78 iso_pu_bacteria 2643221667 2644371458 401
79 iso_pu_bacteria 2643221716 2644641210 401
80 iso_pu_bacteria 2738541279 2738733715 401
81 iso_pu_bacteria 2738541285 2738766328 401
82 iso_pu_bacteria 2738543007 2739215296 401
83 iso_pu_bacteria 2739367857 2740000167 401
84 iso_pu_bacteria 2739367858 2740004983 401
85 iso_pu_bacteria 2857613821 2857614695 401
86 iso_pu_bacteria 2857618242 2857621575 401
87 iso_pu_bacteria 2904419702 2904419982 401
88 iso_pu_bacteria 2904555929 2904556816 401
89 iso_pu_bacteria 2919191525 2919192594 401
90 iso_pu_bacteria 2929150217 2929151471 401
91 iso_pu_bacteria 8054307821 8054309307 401
92 3300006358 Ga0068871_100077597 Ga0068871_1000775972 403
93 3300009551 Ga0105238_10012215 Ga0105238_100122154 403
94 3300025924 Ga0207694_10099425 Ga0207694_100994252 403
95 3300048917 Ga0496114_0005944 Ga0496114_0005944_2094_3332 404
96 3300048920 Ga0496117_0004251 Ga0496117_0004251_9801_11033 404
97 3300048924 Ga0496121_0022679 Ga0496121_0022679_1772_3004 404
98 3300048926 Ga0496123_0011182 Ga0496123_0011182_2664_3896 404
99 3300048929 Ga0496126_0008982 Ga0496126_0008982_5561_6799 404
100 3300003781 Ga0055536_1005078 Ga0055536_10050783 405
101 3300005459 Ga0068867_100003427 Ga0068867_1000034276 405
102 3300025292 Ga0209676_1000063 Ga0209676_1000063197 405
103 3300025981 Ga0207640_10106807 Ga0207640_101068071 405
104 3300026089 Ga0207648_10005953 Ga0207648_100059532 405
105 3300031548 Ga0307408_100009596 Ga0307408_1000095963 405
106 3300031824 Ga0307413_10000050 Ga0307413_1000005023 405
107 3300031852 Ga0307410_10001059 Ga0307410_100010594 405
108 3300031901 Ga0307406_10000003 Ga0307406_10000003119 405
109 3300031903 Ga0307407_10001073 Ga0307407_100010735 405
110 3300031911 Ga0307412_10063824 Ga0307412_100638241 405
111 3300032004 Ga0307414_10000001 Ga0307414_10000001936 405
112 3300032005 Ga0307411_10023635 Ga0307411_100236352 405
113 3300041411 Ga0439466_0002196 Ga0439466_0002196_1863_3083 405
114 3300049530 Ga0501314_000168 Ga0501314_000168_1601_2821 405
115 3300049539 Ga0501323_000658 Ga0501323_000658_476_1696 405
116 3300049671 Ga0501238_000253 Ga0501238_000253_3172_4392 405
117 3300049776 Ga0501280_000996 Ga0501280_000996_3603_4823 405
118 3300002772 JGI25164J39214_1000030 JGI25164J39214_100003027 406
119 3300003214 JGI25165J46597_1000057 JGI25165J46597_1000057100 406
120 3300025228 Ga0209672_100227 Ga0209672_1002276 406
121 3300025231 Ga0207427_100053 Ga0207427_10005386 406
122 3300025233 Ga0209437_100108 Ga0209437_10010897 406
123 3300025242 Ga0209258_100055 Ga0209258_10005579 406
124 3300025254 Ga0209148_1000058 Ga0209148_1000058192 406
125 3300025261 Ga0209233_1000125 Ga0209233_100012586 406
126 3300025272 Ga0209455_1000018 Ga0209455_1000018192 406
127 3300049571 Ga0501034_0000376 Ga0501034_0000376_10642_11883 406
128 3300005719 Ga0068861_100010971 Ga0068861_1000109712 407
129 3300025206 Ga0209435_104107 Ga0209435_1041072 407
130 3300025225 Ga0209566_102188 Ga0209566_1021882 407
131 3300025233 Ga0209437_104869 Ga0209437_1048692 407
132 3300013102 Ga0157371_10005860 Ga0157371_100058602 408
133 3300003214 JGI25165J46597_1000109 JGI25165J46597_100010954 409
134 3300005327 Ga0070658_10169483 Ga0070658_101694832 409
135 3300005577 Ga0068857_100006038 Ga0068857_1000060384 409
136 3300025231 Ga0207427_100150 Ga0207427_10015023 409
137 3300025233 Ga0209437_100200 Ga0209437_10020023 409
138 3300025261 Ga0209233_1000167 Ga0209233_100016782 409
139 3300025261 Ga0209233_1000193 Ga0209233_100019323 409
140 3300025912 Ga0207707_10047849 Ga0207707_100478492 409
141 3300025921 Ga0207652_10022481 Ga0207652_100224813 409
142 3300026116 Ga0207674_10013768 Ga0207674_100137683 409
143 3300044656 Ga0466969_0010581 Ga0466969_0010581_3575_4822 409
144 3300044658 Ga0466972_0010097 Ga0466972_0010097_2306_3553 409
145 3300044672 Ga0466982_0000012 Ga0466982_0000012_29224_30471 409
146 3300044684 Ga0466966_0010153 Ga0466966_0010153_808_2055 409
147 3300044706 Ga0466964_0047133 Ga0466964_0047133_460_1707 409
148 3300044719 Ga0466971_0013041 Ga0466971_0013041_1327_2574 409
149 3300044735 Ga0466968_0012926 Ga0466968_0012926_843_2090 409
150 3300044901 Ga0466960_0076599 Ga0466960_0076599_328_1575 409
151 3300048918 Ga0496115_0000247 Ga0496115_0000247_8652_9899 409
152 3300048920 Ga0496117_0045955 Ga0496117_0045955_1536_2786 409
153 3300049822 Ga0501035_0018201 Ga0501035_0018201_1235_2488 409
154 iso_pu_bacteria 2643221579 2643908296 409
155 iso_pu_bacteria 2884411467 2884412524 409
156 iso_pu_bacteria 2923516293 2923517020 409
157 3300002067 JGI24735J21928_10005092 JGI24735J21928_100050922 410
158 3300002067 JGI24735J21928_10013237 JGI24735J21928_100132372 410
159 3300003320 rootH2_10077280 rootH2_100772802 410
160 3300005327 Ga0070658_10002406 Ga0070658_100024062 410
161 3300005563 Ga0068855_100159584 Ga0068855_1001595841 410
162 3300005577 Ga0068857_100081412 Ga0068857_1000814121 410
163 3300013307 Ga0157372_10030852 Ga0157372_100308523 410
164 3300025254 Ga0209148_1004024 Ga0209148_10040242 410
165 3300025272 Ga0209455_1003695 Ga0209455_10036955 410
166 3300025904 Ga0207647_10055188 Ga0207647_100551882 410
167 3300025909 Ga0207705_10001691 Ga0207705_1000169116 410
168 3300025919 Ga0207657_10060289 Ga0207657_100602892 410
169 3300025932 Ga0207690_10039330 Ga0207690_100393302 410
170 3300025949 Ga0207667_10141026 Ga0207667_101410262 410
171 3300041459 Ga0451800_0893161 Ga0451800_0893161_345_1586 410
172 3300049570 Ga0501033_0000902 Ga0501033_0000902_7376_8623 410
173 iso_pu_bacteria 2643221581 2643914593 410
174 iso_pu_bacteria 2687453130 2687584354 410
175 iso_pu_bacteria 2739367700 2739732458 410
176 iso_pu_bacteria 2928963466 2928965143 410
177 iso_pu_bacteria 2941489479 2941490568 410
178 3300046675 Ga0495657_0075518 Ga0495657_0075518_77_1321 411
179 3300048928 Ga0496125_0098516 Ga0496125_0098516_831_2111 411
180 3300031548 Ga0307408_100240958 Ga0307408_1002409581 412
181 3300031901 Ga0307406_10004775 Ga0307406_100047756 412
182 3300041413 Ga0439465_0019453 Ga0439465_0019453_576_1814 412
183 3300041999 Ga0439433_0007080 Ga0439433_0007080_1071_2309 412
184 iso_pu_bacteria 2895395659 2895397442 412
185 iso_pu_bacteria 2939611941 2939614911 412
186 3300002705 JGI25156J39149_1016476 JGI25156J39149_10164761 413
187 3300002737 JGI25162J39368_1001100 JGI25162J39368_10011006 413
188 3300002741 JGI25157J39369_1000830 JGI25157J39369_10008306 413
189 3300002771 JGI25163J39215_1000233 JGI25163J39215_100023310 413
190 3300002772 JGI25164J39214_1000317 JGI25164J39214_10003174 413
191 3300003214 JGI25165J46597_1000601 JGI25165J46597_100060117 413
192 3300003751 Ga0055538_1000742 Ga0055538_10007425 413
193 3300003761 Ga0055535_1001125 Ga0055535_10011256 413
194 3300003762 Ga0055542_1000599 Ga0055542_100059917 413
195 3300003763 Ga0055529_1000915 Ga0055529_10009156 413
196 3300005327 Ga0070658_10045831 Ga0070658_100458312 413
197 3300005327 Ga0070658_10094239 Ga0070658_100942392 413
198 3300005337 Ga0070682_100075861 Ga0070682_1000758612 413
199 3300005339 Ga0070660_100092619 Ga0070660_1000926192 413
200 3300005458 Ga0070681_10144443 Ga0070681_101444432 413
201 3300005530 Ga0070679_100002897 Ga0070679_1000028974 413
202 3300005614 Ga0068856_100028390 Ga0068856_1000283902 413
203 3300005616 Ga0068852_100093436 Ga0068852_1000934362 413
204 3300013102 Ga0157371_10005862 Ga0157371_100058629 413
205 3300013102 Ga0157371_10028629 Ga0157371_100286293 413
206 3300013104 Ga0157370_10001577 Ga0157370_1000157712 413
207 3300013307 Ga0157372_10037682 Ga0157372_100376821 413
208 3300025207 Ga0209760_100778 Ga0209760_1007782 413
209 3300025224 Ga0209784_100011 Ga0209784_100011458 413
210 3300025228 Ga0209672_106181 Ga0209672_1061812 413
211 3300025231 Ga0207427_100026 Ga0207427_100026346 413
212 3300025233 Ga0209437_100470 Ga0209437_10047017 413
213 3300025242 Ga0209258_100027 Ga0209258_10002789 413
214 3300025246 Ga0209646_1001510 Ga0209646_10015103 413
215 3300025250 Ga0209026_1000460 Ga0209026_10004604 413
216 3300025254 Ga0209148_1000001 Ga0209148_1000001827 413
217 3300025256 Ga0209759_1000679 Ga0209759_100067917 413
218 3300025261 Ga0209233_1000002 Ga0209233_10000021403 413
219 3300025272 Ga0209455_1000019 Ga0209455_1000019156 413
220 3300025909 Ga0207705_10025028 Ga0207705_100250282 413
221 3300025909 Ga0207705_10108230 Ga0207705_101082302 413
222 3300025912 Ga0207707_10134998 Ga0207707_101349982 413
223 3300025919 Ga0207657_10019311 Ga0207657_100193112 413
224 3300025921 Ga0207652_10000768 Ga0207652_100007688 413
225 3300026078 Ga0207702_10011349 Ga0207702_100113493 413
226 3300031090 Ga0265760_10004605 Ga0265760_100046052 413
227 3300001989 JGI24739J22299_10001186 JGI24739J22299_100011862 414
228 3300002067 JGI24735J21928_10001527 JGI24735J21928_100015272 414
229 3300002705 JGI25156J39149_1001356 JGI25156J39149_10013565 414
230 3300002705 JGI25156J39149_1003613 JGI25156J39149_10036132 414
231 3300002737 JGI25162J39368_1000781 JGI25162J39368_10007818 414
232 3300002737 JGI25162J39368_1001302 JGI25162J39368_10013023 414
233 3300002741 JGI25157J39369_1000433 JGI25157J39369_100043311 414
234 3300002741 JGI25157J39369_1001902 JGI25157J39369_10019023 414
235 3300002772 JGI25164J39214_1000478 JGI25164J39214_10004786 414
236 3300003214 JGI25165J46597_1000955 JGI25165J46597_10009556 414
237 3300003320 rootH2_10007042 rootH2_1000704221 414
238 3300003578 Ga0006562J51391_1005457 Ga0006562J51391_10054575 414
239 3300003578 Ga0006562J51391_1005461 Ga0006562J51391_10054612 414
240 3300003756 Ga0055533_1001004 Ga0055533_10010043 414
241 3300003761 Ga0055535_1000204 Ga0055535_10002046 414
242 3300003761 Ga0055535_1000885 Ga0055535_10008859 414
243 3300003762 Ga0055542_1000243 Ga0055542_100024336 414
244 3300003762 Ga0055542_1000278 Ga0055542_100027831 414
245 3300003762 Ga0055542_1000432 Ga0055542_10004327 414
246 3300003763 Ga0055529_1000299 Ga0055529_100029931 414
247 3300005262 Ga0065165_1003868 Ga0065165_10038682 414
248 3300005337 Ga0070682_100029783 Ga0070682_1000297832 414
249 3300005337 Ga0070682_100138702 Ga0070682_1001387022 414
250 3300005340 Ga0070689_100002971 Ga0070689_1000029713 414
251 3300005344 Ga0070661_100017224 Ga0070661_1000172243 414
252 3300005367 Ga0070667_100000012 Ga0070667_10000001219 414
253 3300005455 Ga0070663_100000168 Ga0070663_10000016825 414
254 3300005455 Ga0070663_100042525 Ga0070663_1000425252 414
255 3300005458 Ga0070681_10046411 Ga0070681_100464112 414
256 3300005466 Ga0070685_10026162 Ga0070685_100261622 414
257 3300005530 Ga0070679_100097916 Ga0070679_1000979162 414
258 3300005539 Ga0068853_100025464 Ga0068853_1000254642 414
259 3300005539 Ga0068853_100256220 Ga0068853_1002562201 414
260 3300005546 Ga0070696_100001669 Ga0070696_1000016698 414
261 3300005547 Ga0070693_100021313 Ga0070693_1000213132 414
262 3300005563 Ga0068855_100024543 Ga0068855_1000245432 414
263 3300005563 Ga0068855_100028009 Ga0068855_1000280093 414
264 3300005577 Ga0068857_100002638 Ga0068857_1000026382 414
265 3300005578 Ga0068854_100002988 Ga0068854_1000029885 414
266 3300005578 Ga0068854_100019288 Ga0068854_1000192882 414
267 3300005614 Ga0068856_100000074 Ga0068856_1000000747 414
268 3300005614 Ga0068856_100004734 Ga0068856_1000047342 414
269 3300005616 Ga0068852_100010032 Ga0068852_1000100322 414
270 3300005842 Ga0068858_100099751 Ga0068858_1000997512 414
271 3300009093 Ga0105240_10000668 Ga0105240_1000066828 414
272 3300009093 Ga0105240_10005178 Ga0105240_100051786 414
273 3300009093 Ga0105240_10007396 Ga0105240_100073966 414
274 3300009093 Ga0105240_10025529 Ga0105240_100255295 414
275 3300009093 Ga0105240_10310627 Ga0105240_103106272 414
276 3300009174 Ga0105241_10001296 Ga0105241_100012962 414
277 3300009177 Ga0105248_10000775 Ga0105248_1000077520 414
278 3300009545 Ga0105237_10000084 Ga0105237_100000845 414
279 3300009545 Ga0105237_10001831 Ga0105237_100018312 414
280 3300009545 Ga0105237_10008487 Ga0105237_100084873 414
281 3300009545 Ga0105237_10027440 Ga0105237_100274402 414
282 3300009551 Ga0105238_10004377 Ga0105238_100043772 414
283 3300009551 Ga0105238_10023698 Ga0105238_100236982 414
284 3300009553 Ga0105249_10000700 Ga0105249_1000070020 414
285 3300009553 Ga0105249_10067072 Ga0105249_100670723 414
286 3300010375 Ga0105239_10000174 Ga0105239_100001746 414
287 3300010375 Ga0105239_10010755 Ga0105239_100107552 414
288 3300010375 Ga0105239_10022221 Ga0105239_100222212 414
289 3300012500 Ga0157314_1000262 Ga0157314_10002622 414
290 3300013105 Ga0157369_10000001 Ga0157369_10000001190 414
291 3300013105 Ga0157369_10209627 Ga0157369_102096272 414
292 3300015685 Ga0183369_1013 Ga0183369_101325 414
293 3300015687 Ga0183368_1003 Ga0183368_1003376 414
294 3300025226 Ga0209674_100012 Ga0209674_100012116 414
295 3300025226 Ga0209674_100309 Ga0209674_1003097 414
296 3300025226 Ga0209674_100575 Ga0209674_1005754 414
297 3300025228 Ga0209672_100055 Ga0209672_100055101 414
298 3300025228 Ga0209672_100706 Ga0209672_1007069 414
299 3300025228 Ga0209672_101056 Ga0209672_1010562 414
300 3300025231 Ga0207427_101499 Ga0207427_1014994 414
301 3300025233 Ga0209437_100403 Ga0209437_10040312 414
302 3300025242 Ga0209258_100012 Ga0209258_10001248 414
303 3300025242 Ga0209258_100255 Ga0209258_10025539 414
304 3300025242 Ga0209258_101030 Ga0209258_1010302 414
305 3300025246 Ga0209646_1001028 Ga0209646_10010282 414
306 3300025250 Ga0209026_1000055 Ga0209026_1000055163 414
307 3300025250 Ga0209026_1000084 Ga0209026_100008493 414
308 3300025250 Ga0209026_1004536 Ga0209026_10045362 414
309 3300025253 Ga0209677_100818 Ga0209677_1008188 414
310 3300025254 Ga0209148_1000002 Ga0209148_1000002935 414
311 3300025254 Ga0209148_1000014 Ga0209148_1000014607 414
312 3300025254 Ga0209148_1000221 Ga0209148_100022139 414
313 3300025256 Ga0209759_1000191 Ga0209759_10001916 414
314 3300025258 Ga0209129_1001530 Ga0209129_10015305 414
315 3300025261 Ga0209233_1026281 Ga0209233_10262811 414
316 3300025272 Ga0209455_1000014 Ga0209455_1000014495 414
317 3300025272 Ga0209455_1000266 Ga0209455_100026645 414
318 3300025272 Ga0209455_1001811 Ga0209455_10018112 414
319 3300025297 Ga0209758_1003595 Ga0209758_10035953 414
320 3300025321 Ga0207656_10011871 Ga0207656_100118712 414
321 3300025904 Ga0207647_10009984 Ga0207647_100099843 414
322 3300025911 Ga0207654_10004994 Ga0207654_100049943 414
323 3300025913 Ga0207695_10000007 Ga0207695_10000007823 414
324 3300025913 Ga0207695_10004123 Ga0207695_100041235 414
325 3300025913 Ga0207695_10005153 Ga0207695_100051535 414
326 3300025913 Ga0207695_10006964 Ga0207695_100069645 414
327 3300025913 Ga0207695_10007953 Ga0207695_100079535 414
328 3300025913 Ga0207695_10011180 Ga0207695_100111803 414
329 3300025913 Ga0207695_10041539 Ga0207695_100415392 414
330 3300025914 Ga0207671_10000011 Ga0207671_10000011301 414
331 3300025914 Ga0207671_10000507 Ga0207671_1000050725 414
332 3300025914 Ga0207671_10003934 Ga0207671_100039345 414
333 3300025914 Ga0207671_10015522 Ga0207671_100155222 414
334 3300025924 Ga0207694_10000957 Ga0207694_100009576 414
335 3300025924 Ga0207694_10001044 Ga0207694_100010444 414
336 3300025924 Ga0207694_10082749 Ga0207694_100827492 414
337 3300025933 Ga0207706_10093705 Ga0207706_100937052 414
338 3300025936 Ga0207670_10002068 Ga0207670_100020687 414
339 3300025941 Ga0207711_10004949 Ga0207711_100049492 414
340 3300025949 Ga0207667_10000249 Ga0207667_1000024952 414
341 3300025949 Ga0207667_10001682 Ga0207667_1000168211 414
342 3300025961 Ga0207712_10000802 Ga0207712_100008025 414
343 3300025961 Ga0207712_10037572 Ga0207712_100375723 414
344 3300025981 Ga0207640_10001067 Ga0207640_100010675 414
345 3300025981 Ga0207640_10001917 Ga0207640_100019173 414
346 3300025981 Ga0207640_10007445 Ga0207640_100074452 414
347 3300025986 Ga0207658_10000614 Ga0207658_100006145 414
348 3300026041 Ga0207639_10004137 Ga0207639_100041373 414
349 3300026067 Ga0207678_10001087 Ga0207678_1000108713 414
350 3300026067 Ga0207678_10004555 Ga0207678_100045552 414
351 3300026067 Ga0207678_10045552 Ga0207678_100455522 414
352 3300026078 Ga0207702_10000146 Ga0207702_1000014629 414
353 3300026078 Ga0207702_10001245 Ga0207702_100012455 414
354 3300026116 Ga0207674_10003839 Ga0207674_100038395 414
355 3300026142 Ga0207698_10118506 Ga0207698_101185062 414
356 3300037312 Ga0395899_0000076 Ga0395899_0000076_39972_41234 414
357 3300037418 Ga0395900_0000024 Ga0395900_0000024_235320_236582 414
358 3300037466 Ga0395898_0000044 Ga0395898_0000044_53378_54640 414
359 3300044656 Ga0466969_0001243 Ga0466969_0001243_9935_11197 414
360 3300044684 Ga0466966_0015281 Ga0466966_0015281_2514_3776 414
361 3300044693 Ga0466961_0002899 Ga0466961_0002899_6916_8178 414
362 3300044693 Ga0466961_0022875 Ga0466961_0022875_2278_3540 414
363 3300044765 Ga0466970_0036017 Ga0466970_0036017_1329_2591 414
364 3300045049 Ga0466959_0000112 Ga0466959_0000112_37273_38535 414
365 3300045049 Ga0466959_0026184 Ga0466959_0026184_968_2230 414
366 3300045836 Ga0466958_0107450 Ga0466958_0107450_244_1506 414
367 3300046460 Ga0495638_0000248 Ga0495638_0000248_7215_8477 414
368 3300046460 Ga0495638_0001918 Ga0495638_0001918_8414_9676 414
369 3300046471 Ga0495650_0000961 Ga0495650_0000961_23390_24652 414
370 3300046507 Ga0495606_0000113 Ga0495606_0000113_8175_9437 414
371 3300046557 Ga0495622_0002070 Ga0495622_0002070_470_1732 414
372 3300046694 Ga0495649_0000784 Ga0495649_0000784_16108_17370 414
373 3300047472 Ga0495686_0006177 Ga0495686_0006177_5489_6754 414
374 3300048908 Ga0496105_0003298 Ga0496105_0003298_4077_5339 414
375 3300048909 Ga0496106_0023741 Ga0496106_0023741_1957_3219 414
376 3300048918 Ga0496115_0002434 Ga0496115_0002434_3968_5230 414
377 3300048918 Ga0496115_0012667 Ga0496115_0012667_4128_5390 414
378 3300048919 Ga0496116_0057584 Ga0496116_0057584_1015_2277 414
379 3300048920 Ga0496117_0038958 Ga0496117_0038958_791_2053 414
380 3300048921 Ga0496118_0003996 Ga0496118_0003996_8249_9511 414
381 3300048921 Ga0496118_0020659 Ga0496118_0020659_1947_3212 414
382 3300048922 Ga0496119_0000248 Ga0496119_0000248_67289_68551 414
383 3300048923 Ga0496120_0000143 Ga0496120_0000143_111029_112291 414
384 3300048924 Ga0496121_0000593 Ga0496121_0000593_55527_56789 414
385 3300048924 Ga0496121_0009148 Ga0496121_0009148_8948_10195 414
386 3300048924 Ga0496121_0128404 Ga0496121_0128404_559_1821 414
387 3300048925 Ga0496122_0000906 Ga0496122_0000906_26329_27594 414
388 3300048926 Ga0496123_0001225 Ga0496123_0001225_16835_18100 414
389 3300048928 Ga0496125_0000239 Ga0496125_0000239_34519_35781 414
390 3300048929 Ga0496126_0050003 Ga0496126_0050003_1119_2384 414
391 3300048929 Ga0496126_0206503 Ga0496126_0206503_61_1323 414
392 3300049460 Ga0495682_0029988 Ga0495682_0029988_371_1633 414
393 3300049582 Ga0501048_0077068 Ga0501048_0077068_497_1762 414
394 3300053087 Ga0500643_005740 Ga0500643_005740_3586_4851 414
395 3300053120 Ga0500597_000062 Ga0500597_000062_17577_18842 414
396 3300061719 Ga0466962_0005119 Ga0466962_0005119_4818_6080 414
397 iso_pu_bacteria 2995948881 2995951475 414
398 3300005331 Ga0070670_100022258 Ga0070670_1000222582 415
399 3300005335 Ga0070666_10049267 Ga0070666_100492672 415
400 3300005338 Ga0068868_100077627 Ga0068868_1000776272 415
401 3300005339 Ga0070660_100021842 Ga0070660_1000218422 415
402 3300005457 Ga0070662_100028407 Ga0070662_1000284072 415
403 3300005548 Ga0070665_100000525 Ga0070665_1000005257 415
404 3300005563 Ga0068855_100115344 Ga0068855_1001153442 415
405 3300005834 Ga0068851_10008638 Ga0068851_100086382 415
406 3300005842 Ga0068858_100006871 Ga0068858_1000068713 415
407 3300006237 Ga0097621_100045831 Ga0097621_1000458312 415
408 3300006881 Ga0068865_100095731 Ga0068865_1000957312 415
409 3300009093 Ga0105240_10005042 Ga0105240_100050427 415
410 3300009545 Ga0105237_10277448 Ga0105237_102774482 415
411 3300009551 Ga0105238_10032333 Ga0105238_100323333 415
412 3300009553 Ga0105249_10001525 Ga0105249_1000152510 415
413 3300014968 Ga0157379_10151387 Ga0157379_101513872 415
414 3300025903 Ga0207680_10001284 Ga0207680_100012843 415
415 3300025904 Ga0207647_10000313 Ga0207647_1000031311 415
416 3300025912 Ga0207707_10013800 Ga0207707_100138002 415
417 3300025913 Ga0207695_10000791 Ga0207695_100007917 415
418 3300025913 Ga0207695_10023015 Ga0207695_100230152 415
419 3300025914 Ga0207671_10125218 Ga0207671_101252181 415
420 3300025917 Ga0207660_10101504 Ga0207660_101015042 415
421 3300025933 Ga0207706_10002456 Ga0207706_100024565 415
422 3300025949 Ga0207667_10114210 Ga0207667_101142102 415
423 3300025961 Ga0207712_10000466 Ga0207712_100004669 415
424 3300025981 Ga0207640_10055228 Ga0207640_100552282 415
425 3300026035 Ga0207703_10000759 Ga0207703_100007596 415
426 3300026041 Ga0207639_10000364 Ga0207639_100003646 415
427 3300026067 Ga0207678_10007800 Ga0207678_100078005 415
428 3300028379 Ga0268266_10000006 Ga0268266_10000006925 415
429 3300048922 Ga0496119_0021112 Ga0496119_0021112_3262_4542 415
430 3300048923 Ga0496120_0000145 Ga0496120_0000145_52040_53320 415
431 3300048924 Ga0496121_0037878 Ga0496121_0037878_121_1401 415
432 3300048929 Ga0496126_0006533 Ga0496126_0006533_8683_9963 415
433 3300049580 Ga0501046_0015201 Ga0501046_0015201_387_1649 415
434 3300002741 JGI25157J39369_1001288 JGI25157J39369_10012883 416
435 3300005289 Ga0065704_10073684 Ga0065704_100736843 416
436 3300005345 Ga0070692_10024870 Ga0070692_100248702 416
437 3300005436 Ga0070713_100000361 Ga0070713_1000003615 416
438 3300005614 Ga0068856_100021187 Ga0068856_1000211872 416
439 3300005843 Ga0068860_100018687 Ga0068860_1000186874 416
440 3300006881 Ga0068865_100002526 Ga0068865_1000025263 416
441 3300009176 Ga0105242_10000796 Ga0105242_1000079617 416
442 3300009545 Ga0105237_10002103 Ga0105237_100021037 416
443 3300009545 Ga0105237_10051826 Ga0105237_100518262 416
444 3300013105 Ga0157369_10333953 Ga0157369_103339532 416
445 3300013297 Ga0157378_10011360 Ga0157378_100113602 416
446 3300013308 Ga0157375_10010460 Ga0157375_100104603 416
447 3300014969 Ga0157376_10007645 Ga0157376_100076454 416
448 3300015261 Ga0182006_1014868 Ga0182006_10148683 416
449 3300015262 Ga0182007_10010019 Ga0182007_100100193 416
450 3300025250 Ga0209026_1000017 Ga0209026_1000017287 416
451 3300025256 Ga0209759_1016813 Ga0209759_10168131 416
452 3300025263 Ga0209565_1006427 Ga0209565_10064272 416
453 3300025904 Ga0207647_10003100 Ga0207647_100031008 416
454 3300025909 Ga0207705_10047723 Ga0207705_100477232 416
455 3300025919 Ga0207657_10076845 Ga0207657_100768452 416
456 3300025924 Ga0207694_10088688 Ga0207694_100886882 416
457 3300025928 Ga0207700_10004771 Ga0207700_100047714 416
458 3300025929 Ga0207664_10000170 Ga0207664_100001703 416
459 3300025932 Ga0207690_10000401 Ga0207690_100004015 416
460 3300025933 Ga0207706_10034293 Ga0207706_100342932 416
461 3300028381 Ga0268264_10080632 Ga0268264_100806322 416
462 3300036401 Ga0373937_0146182 Ga0373937_0146182_873_2144 416
463 3300046531 Ga0495665_0098760 Ga0495665_0098760_88_1359 416
464 3300046674 Ga0495588_0065143 Ga0495588_0065143_249_1514 416
465 3300046683 Ga0495658_0050959 Ga0495658_0050959_596_1867 416
466 3300048907 Ga0496104_0000017 Ga0496104_0000017_94348_95619 416
467 3300048908 Ga0496105_0000009 Ga0496105_0000009_220984_222255 416
468 iso_pu_bacteria 2643221559 2643817624 416
469 iso_pu_bacteria 2643221573 2643878843 416
470 iso_pu_bacteria 2643221586 2643940336 416
471 iso_pu_bacteria 2643221612 2644079407 416
472 iso_pu_bacteria 2643221720 2644660159 416
473 iso_pu_bacteria 2643221727 2644694851 416
474 iso_pu_bacteria 2643221728 2644697460 416
475 3300012502 Ga0157347_1000298 Ga0157347_10002981 417
476 3300048924 Ga0496121_0073989 Ga0496121_0073989_128_1420 417
477 3300049586 Ga0501070_0088350 Ga0501070_0088350_985_2259 418
478 3300049742 Ga0501080_0077703 Ga0501080_0077703_1053_2327 418
479 3300048918 Ga0496115_0000085 Ga0496115_0000085_25242_26519 419
480 3300048929 Ga0496126_0000033 Ga0496126_0000033_149511_150788 419
481 3300010375 Ga0105239_10019573 Ga0105239_100195733 420
482 3300048921 Ga0496118_0063012 Ga0496118_0063012_1363_2643 420
483 3300003759 Ga0055525_1000124 Ga0055525_100012480 421
484 3300003760 Ga0055527_1000111 Ga0055527_100011136 421
485 3300003761 Ga0055535_1000238 Ga0055535_100023836 421
486 3300003762 Ga0055542_1000272 Ga0055542_10002728 421
487 3300003763 Ga0055529_1000446 Ga0055529_10004466 421
488 3300009551 Ga0105238_10165062 Ga0105238_101650621 421
489 3300013104 Ga0157370_10000645 Ga0157370_100006459 421
490 3300025228 Ga0209672_100005 Ga0209672_100005176 421
491 3300025230 Ga0209563_100045 Ga0209563_100045132 421
492 3300025242 Ga0209258_100006 Ga0209258_100006176 421
493 3300025254 Ga0209148_1000012 Ga0209148_1000012176 421
494 3300025272 Ga0209455_1000008 Ga0209455_1000008176 421
495 3300037312 Ga0395899_0006222 Ga0395899_0006222_403_1692 421
496 3300037466 Ga0395898_0000311 Ga0395898_0000311_77908_79230 421
497 3300039437 Ga0436365_1048154 Ga0436365_1048154_2251_3534 421
498 3300044683 Ga0466965_0024975 Ga0466965_0024975_923_2215 421
499 3300044693 Ga0466961_0000661 Ga0466961_0000661_10132_11424 421
500 3300044693 Ga0466961_0001936 Ga0466961_0001936_3181_4515 421
501 3300045049 Ga0466959_0031102 Ga0466959_0031102_228_1562 421
502 3300048918 Ga0496115_0013895 Ga0496115_0013895_1632_2948 421
503 3300048929 Ga0496126_0000712 Ga0496126_0000712_26297_27613 421
504 3300049579 Ga0501043_0047050 Ga0501043_0047050_688_2070 421
505 3300049580 Ga0501046_0073699 Ga0501046_0073699_445_1827 421
506 3300049581 Ga0501047_0068987 Ga0501047_0068987_1480_2862 421
507 3300049823 Ga0501044_0034850 Ga0501044_0034850_2817_4199 421
508 3300061719 Ga0466962_0008190 Ga0466962_0008190_3673_4965 421
509 2162886007 SwRhRL2b_contig_1943480 SwRhRL2b_0888.00004360 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

44

406

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8625 10 408
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8454 10 408
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8428 9 408
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.839 9 410
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.8338 9 410
ID Description Score Start End Superfamily
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9084 12 190 1.20.1250.20
af_Q8R090_126_283_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8988 52 189 1.20.1250.20
af_A0A1D6FKK2_52_340_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8972 8 191 1.20.1250.20
af_P31122_11_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8953 14 408 1.20.1250.20
af_P0AA78_1_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8951 10 194 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A357BBK4-F1-model_v4 deleted 0.9903 12 410
AF-A0A853VYM9-F1-model_v4 deleted 0.9886 12 412
AF-A0A101VGA2-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9867 8 408 GO:0005886
GO:0022857
AF-A0A1H1DLM7-F1-model_v4 Fucose permease 0.9854 9 413 GO:0016020
GO:0022857
AF-A0A3D4JUQ6-F1-model_v4 MFS transporter 0.9853 12 413 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
88.9 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map