F457065

General Info

Members Datasets Scaffolds Average Seq Length
509 279 352 637

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919497567|2919500755
Length 692
Sequence IAEKPSLGRAIADVLPKPHKKGDGFIEAANGDCVSWCVGHLLEQAEPDAYNPEFKAWKFEHLPIVPDKWQLTPKAATRSQLTVLKRLVKQASMLVNAGDPDREGQLLVDEVIAYLGVTGDKLHQTQRLLISDLNPQAVKRALTQLRSNREFIPLSTSALARSRADWLYGMNMTRAYTIQGKKVGYQGVLSVGRVQTPLLGLVVRRDKEIANFQSKPFYEVLAHLATDKQETFSAKWQPSEACQPYMDEEGRVLARGLAQNVVSRISDKPALVTQLVAKDKKQHPPLPYSLSALQIDAAKRFGMSAKDVLDTCQSLYERHKLITYPRSDSRYLPVEQHNLAPSVLKAISDGAAELLQGADAPDPRLKSKAWDDKKVDAHHAIVPTEKTANLSSLSQRERQLYLHIARQYLAQFYPDYCYSETTVQVTIEGGLFNTKARQDKSLGWKQLFARQAPNSSKASGNTSTEESAGKDDEENDEFIGQLPPLKLGQVLHCTRGELLEKNTQPPKAFTDATLLSAMTGISRYVTDPEIRKILKETDGLGTEATRAGIIELLFKRGFLQRLGKSIVSTDVGKGLINSLPLSATTPDMTALWEASLNGICHKETSYQGFMQPLLGTLSTLIQNAGAQLPTALNGLKGQGYRKTTGSKFAYRQKSSTTKRSGKGVSTKKPTTNATSGTRSNTRRRAGKAALEI

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
7 2547132181 Kosakonia sacchari SP1 Isolate Stem
8 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
9 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
10 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
11 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
12 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
13 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
14 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
15 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
16 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
17 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
18 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
19 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
20 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
21 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
22 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
23 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
24 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
25 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
26 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
27 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
28 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
29 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
30 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
31 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
32 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
33 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
34 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
35 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
36 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
37 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
38 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
39 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
40 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
41 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
42 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
43 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
44 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
45 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
46 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
47 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
48 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
49 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
50 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
51 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
52 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
53 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
54 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
55 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
56 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
57 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
58 2636415599 Klebsiella variicola DX120E Isolate Unclassified
59 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
60 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
61 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
62 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
63 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
64 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
65 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
66 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
67 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
68 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
69 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
70 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
71 2751185917 Enterobacter sp. HK169 Isolate Unclassified
72 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
73 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
74 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
75 2775507074 Klebsiella sp. D5A Isolate Unclassified
76 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
77 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
78 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
79 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
80 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
81 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
82 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
83 2821118458 Enterobacter asburiae 609 Isolate Unclassified
84 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
85 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
86 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
87 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
88 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
89 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
90 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
91 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
92 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
93 2865014394 Pantoea sp. R-71966 Isolate Unclassified
94 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
95 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
96 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
97 2876601092 Pantoea endophytica 596 Isolate Unclassified
98 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
99 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
100 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
101 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
102 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
103 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
104 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
105 2904504865 Serratia marcescens 1822 Isolate Unclassified
106 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
107 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
108 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
109 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
110 2919150387 Rahnella aceris 1817 Isolate Unclassified
111 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
112 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
113 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
114 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
115 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
116 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
117 2927143783 Rahnella sp. 2050 Isolate Unclassified
118 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
119 2932406140 Serratia sp. 2723 Isolate Rhizosphere
120 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
121 2937539931 Pantoea sp. LS15 Isolate Unclassified
122 2937967321 Serratia sp. YC16 Isolate Unclassified
123 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
124 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
125 2939577877 Serratia sp. 509 Isolate Rhizosphere
126 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
127 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
128 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
129 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
130 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
131 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
132 2952252522 Salinicola sp. DM10 Isolate Unclassified
133 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
134 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
135 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
136 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
137 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
138 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
139 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
140 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
141 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
142 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
143 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
144 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
145 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
146 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
147 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
148 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
149 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
150 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
151 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
152 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
153 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
154 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
155 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
156 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
157 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
158 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
159 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
160 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
170 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
171 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
172 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
209 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
213 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
214 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 640753048 Serratia proteamaculans 568 Isolate Endosphere
265 8004592986 Serratia sp. S119 Isolate Unclassified
266 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
267 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
268 8018221730 Enterobacter sp. CM29 Isolate Unclassified
269 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
270 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
271 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
272 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
273 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
274 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
275 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
276 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
277 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
278 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
279 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.16
Metatranscriptomes 0
Isolates 30.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 4.32
Nodule 3.14
Rhizoplane 11.59
Rhizosphere 50.69
Stem 0.2
Stem Tuber 1.38
Unclassified 28.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25163J39215_1000032 3300002771 Bacteria 64778
2 JGI25164J39214_1000002 3300002772 Bacteria 406570
3 JGI25152J39213_1000562 3300002773 Bacteria 20379
4 Ga0055538_1000015 3300003751 Bacteria 311166
5 Ga0055539_1000009 3300003752 Bacteria 406566
6 Ga0055533_1000012 3300003756 Bacteria 406566
7 Ga0055525_1000014 3300003759 Bacteria 406566
8 Ga0055541_1000006 3300003841 Bacteria 406566
9 Ga0058692_1000639 3300003856 Bacteria 14448
10 Ga0058692_1000796 3300003856 Bacteria 12621
11 Ga0058692_1001239 3300003856 Bacteria 9769
12 Ga0058692_1003345 3300003856 Bacteria 4972
13 Ga0058692_1003397 3300003856 Bacteria 4925
14 Ga0058692_1003964 3300003856 Bacteria 4474
15 Ga0058692_1007143 3300003856 Bacteria 2992
16 Ga0065704_10001232 3300005289 Bacteria 22542
17 Ga0065704_10001528 3300005289 Bacteria 10213
18 Ga0065704_10076153 3300005289 Bacteria 5242
19 Ga0065704_10080119 3300005289 Bacteria 3998
20 Ga0070668_100010821 3300005347 Bacteria 6787
21 Ga0070665_100002007 3300005548 Bacteria 22895
22 Ga0075364_10003948 3300006051 Bacteria 8510
23 Ga0079104_1000236 3300006946 Bacteria 73974
24 Ga0079104_1000350 3300006946 Bacteria 55523
25 Ga0079104_1000409 3300006946 Bacteria 49469
26 Ga0079104_1000932 3300006946 Bacteria 23328
27 Ga0079104_1001482 3300006946 Bacteria 15639
28 Ga0079104_1003703 3300006946 Bacteria 6933
29 Ga0079104_1005501 3300006946 Bacteria 5046
30 Ga0079104_1006387 3300006946 Bacteria 4470
31 Ga0105251_10000116 3300009011 Bacteria 79645
32 Ga0105251_10000161 3300009011 Bacteria 68868
33 Ga0105251_10000311 3300009011 Bacteria 48775
34 Ga0105251_10002497 3300009011 Bacteria 14397
35 Ga0105251_10011623 3300009011 Bacteria 5023
36 Ga0105251_10013240 3300009011 Bacteria 4623
37 Ga0105244_10000047 3300009036 Bacteria 142097
38 Ga0105244_10000284 3300009036 Bacteria 50269
39 Ga0105244_10000686 3300009036 Bacteria 29647
40 Ga0105244_10001172 3300009036 Bacteria 21688
41 Ga0105244_10001574 3300009036 Bacteria 18139
42 Ga0105244_10002511 3300009036 Bacteria 13806
43 Ga0105244_10002735 3300009036 Bacteria 13167
44 Ga0105244_10022721 3300009036 Bacteria 3448
45 Ga0105250_10000114 3300009092 Bacteria 72357
46 Ga0105250_10000193 3300009092 Bacteria 51667
47 Ga0105250_10000649 3300009092 Bacteria 22105
48 Ga0105250_10001162 3300009092 Bacteria 14798
49 Ga0105250_10001865 3300009092 Bacteria 10971
50 Ga0105240_10007776 3300009093 Bacteria 15497
51 Ga0105247_10000012 3300009101 Bacteria 292188
52 Ga0105241_10000001 3300009174 Bacteria 879793
53 Ga0105237_10000025 3300009545 Bacteria 215920
54 Ga0105237_10003003 3300009545 Bacteria 20380
55 Ga0157373_10000307 3300013100 Bacteria 39624
56 Ga0157373_10007092 3300013100 Bacteria 8356
57 Ga0157373_10009196 3300013100 Bacteria 7307
58 Ga0157371_10008318 3300013102 Bacteria 8283
59 Ga0157371_10009798 3300013102 Bacteria 7514
60 Ga0157371_10010931 3300013102 Bacteria 7037
61 Ga0157370_10000075 3300013104 Bacteria 108060
62 Ga0157370_10001382 3300013104 Bacteria 30022
63 Ga0157370_10006309 3300013104 Bacteria 13102
64 Ga0157369_10114714 3300013105 Bacteria 2861
65 Ga0157372_10012170 3300013307 Bacteria 9165
66 Ga0157372_10016382 3300013307 Bacteria 7953
67 Ga0157372_10039026 3300013307 Bacteria 5241
68 Ga0157372_10056885 3300013307 Bacteria 4370
69 Ga0157372_10063561 3300013307 Bacteria 4139
70 Ga0182008_10004724 3300014497 Bacteria 7896
71 Ga0182006_1000047 3300015261 Bacteria 187006
72 Ga0183366_1001 3300015679 Bacteria 2743932
73 Ga0183370_1001 3300015680 Bacteria 2743932
74 Ga0183369_1001 3300015685 Bacteria 2743932
75 Ga0183368_1001 3300015687 Bacteria 2743932
76 Ga0163161_10000001 3300017792 Bacteria 2041488
77 Ga0163161_10012450 3300017792 Bacteria 5907
78 Ga0213876_10000191 3300021384 Bacteria 64044
79 Ga0209760_100040 3300025207 Bacteria 118059
80 Ga0209784_100001 3300025224 Bacteria 3600592
81 Ga0209566_100001 3300025225 Bacteria 3600765
82 Ga0209674_100002 3300025226 Bacteria 3600592
83 Ga0209563_100002 3300025230 Bacteria 2045675
84 Ga0207427_100020 3300025231 Bacteria 507515
85 Ga0209437_100001 3300025233 Bacteria 2045675
86 Ga0209437_100155 3300025233 Bacteria 152749
87 Ga0209677_100002 3300025253 Bacteria 2045675
88 Ga0209129_1000004 3300025258 Bacteria 884499
89 Ga0207696_1000001 3300025711 Bacteria 2579611
90 Ga0207696_1000015 3300025711 Bacteria 507848
91 Ga0207696_1000038 3300025711 Bacteria 328221
92 Ga0207696_1000082 3300025711 Bacteria 197827
93 Ga0207696_1000481 3300025711 Bacteria 33805
94 Ga0207696_1001195 3300025711 Bacteria 14797
95 Ga0207696_1001734 3300025711 Bacteria 11302
96 Ga0207696_1002817 3300025711 Bacteria 8249
97 Ga0207696_1003172 3300025711 Bacteria 7623
98 Ga0207655_1000001 3300025728 Bacteria 1866413
99 Ga0207655_1000007 3300025728 Bacteria 773492
100 Ga0207655_1000009 3300025728 Bacteria 664676
101 Ga0207655_1000110 3300025728 Bacteria 171137
102 Ga0207655_1000364 3300025728 Bacteria 64194
103 Ga0207655_1000500 3300025728 Bacteria 50276
104 Ga0207655_1001199 3300025728 Bacteria 25008
105 Ga0207655_1003233 3300025728 Bacteria 12237
106 Ga0207655_1004817 3300025728 Bacteria 9394
107 Ga0207655_1005909 3300025728 Bacteria 8200
108 Ga0207655_1017185 3300025728 Bacteria 3911
109 Ga0207713_1000001 3300025735 Bacteria 2295391
110 Ga0207713_1000002 3300025735 Bacteria 1061749
111 Ga0207713_1000012 3300025735 Bacteria 501860
112 Ga0207713_1000035 3300025735 Bacteria 263228
113 Ga0207713_1000039 3300025735 Bacteria 247140
114 Ga0207713_1000351 3300025735 Bacteria 50454
115 Ga0207713_1009881 3300025735 Bacteria 5336
116 Ga0207713_1015779 3300025735 Bacteria 3861
117 Ga0207713_1015858 3300025735 Bacteria 3849
118 Ga0207710_10000083 3300025900 Bacteria 136593
119 Ga0207654_10000004 3300025911 Bacteria 902334
120 Ga0207695_10016593 3300025913 Bacteria 8607
121 Ga0207671_10000075 3300025914 Bacteria 153167
122 Ga0207671_10005640 3300025914 Bacteria 11471
123 Ga0207674_10002024 3300026116 Bacteria 25725
124 Ga0209281_1000001 3300027111 Bacteria 1933496
125 Ga0209281_1000003 3300027111 Bacteria 1260089
126 Ga0209281_1000123 3300027111 Bacteria 203957
127 Ga0209281_1000218 3300027111 Bacteria 125308
128 Ga0209281_1000274 3300027111 Bacteria 98823
129 Ga0209281_1000301 3300027111 Bacteria 89469
130 Ga0209281_1000521 3300027111 Bacteria 49917
131 Ga0209281_1002130 3300027111 Bacteria 8735
132 Ga0209371_1000001 3300027312 Bacteria 2771503
133 Ga0209371_1000002 3300027312 Bacteria 1551985
134 Ga0209371_1000005 3300027312 Bacteria 1061740
135 Ga0209371_1000039 3300027312 Bacteria 350081
136 Ga0209371_1000041 3300027312 Bacteria 340377
137 Ga0209371_1000110 3300027312 Bacteria 141059
138 Ga0209371_1000157 3300027312 Bacteria 106573
139 Ga0209371_1001739 3300027312 Bacteria 13722
140 Ga0209371_1001769 3300027312 Bacteria 13557
141 Ga0209371_1002716 3300027312 Bacteria 9551
142 Ga0209371_1005315 3300027312 Bacteria 5174
143 Ga0209371_1006362 3300027312 Bacteria 4390
144 Ga0268266_10000435 3300028379 Bacteria 62710
145 Ga0265318_10018053 3300028577 Bacteria 2885
146 Ga0265338_10006633 3300028800 Bacteria 14660
147 Ga0268256_1000001 3300030500 Bacteria 2771065
148 Ga0268256_1000002 3300030500 Bacteria 1535763
149 Ga0268256_1000003 3300030500 Bacteria 1289401
150 Ga0268256_1000006 3300030500 Bacteria 1063991
151 Ga0268256_1000033 3300030500 Bacteria 420973
152 Ga0268256_1000098 3300030500 Bacteria 136395
153 Ga0268256_1001517 3300030500 Bacteria 13722
154 Ga0268256_1001541 3300030500 Bacteria 13580
155 Ga0268256_1003656 3300030500 Bacteria 6807
156 Ga0268256_1005187 3300030500 Bacteria 5174
157 Ga0268256_1005759 3300030500 Bacteria 4771
158 Ga0268256_1008829 3300030500 Bacteria 3416
159 Ga0265330_10004381 3300031235 Bacteria 7168
160 Ga0265330_10008064 3300031235 Bacteria 5093
161 Ga0265320_10000697 3300031240 Bacteria 25616
162 Ga0265325_10009767 3300031241 Bacteria 5590
163 Ga0265329_10001281 3300031242 Bacteria 12258
164 Ga0265316_10002006 3300031344 Bacteria 21452
165 Ga0265316_10035964 3300031344 Bacteria 4007
166 Ga0265313_10002170 3300031595 Bacteria 17418
167 Ga0265313_10002695 3300031595 Bacteria 15043
168 Ga0265313_10023484 3300031595 Bacteria 3320
169 Ga0265313_10030755 3300031595 Bacteria 2759
170 Ga0265314_10001349 3300031711 Bacteria 27734
171 Ga0265314_10008790 3300031711 Bacteria 8631
172 Ga0265314_10028986 3300031711 Bacteria 4119
173 Ga0265342_10002060 3300031712 Bacteria 17851
174 Ga0265342_10002415 3300031712 Bacteria 16170
175 Ga0265342_10020645 3300031712 Bacteria 4219
176 Ga0373950_0000009 3300034818 Bacteria 379994
177 Ga0373950_0000027 3300034818 Bacteria 172704
178 Ga0373950_0000048 3300034818 Bacteria 88822
179 Ga0373950_0000051 3300034818 Bacteria 84318
180 Ga0436365_1037676 3300039437 Bacteria 170132
181 Ga0439438_000001 3300041405 Bacteria 1263568
182 Ga0439438_000215 3300041405 Bacteria 26522
183 Ga0439447_004697 3300041407 Bacteria 4658
184 Ga0439466_0000136 3300041411 Bacteria 28940
185 Ga0439432_001317 3300042006 Bacteria 9399
186 Ga0439452_000001 3300042010 Bacteria 1725439
187 Ga0439452_000002 3300042010 Bacteria 1377577
188 Ga0439452_000008 3300042010 Bacteria 569877
189 Ga0439452_000145 3300042010 Bacteria 53225
190 Ga0439452_000166 3300042010 Bacteria 49240
191 Ga0450907_001689 3300042146 Bacteria 4603
192 Ga0466981_0000002 3300044669 Bacteria 313036
193 Ga0495627_000210 3300046453 Bacteria 63277
194 Ga0495591_000007 3300046458 Bacteria 366385
195 Ga0495591_000022 3300046458 Bacteria 199449
196 Ga0495591_016731 3300046458 Bacteria 2540
197 Ga0495650_0000021 3300046471 Bacteria 531242
198 Ga0495650_0000026 3300046471 Bacteria 476029
199 Ga0495650_0000043 3300046471 Bacteria 357197
200 Ga0495596_0008318 3300046500 Bacteria 4625
201 Ga0495607_0002288 3300046501 Bacteria 15748
202 Ga0495606_0003617 3300046507 Bacteria 16236
203 Ga0495648_0004239 3300046524 Bacteria 12311
204 Ga0495654_0000007 3300046530 Bacteria 403529
205 Ga0495654_0000136 3300046530 Bacteria 76653
206 Ga0495654_0001521 3300046530 Bacteria 15822
207 Ga0495597_0002213 3300046542 Bacteria 12750
208 Ga0495668_0055271 3300046616 Bacteria 2192
209 Ga0495625_0001452 3300046660 Bacteria 28770
210 Ga0495671_0001618 3300046692 Bacteria 14799
211 Ga0495649_0000337 3300046694 Bacteria 40360
212 Ga0495649_0000416 3300046694 Bacteria 37037
213 Ga0495649_0021530 3300046694 Bacteria 3611
214 Ga0495589_0000001 3300046794 Bacteria 888100
215 Ga0495660_0000012 3300046810 Bacteria 350701
216 Ga0495660_0000016 3300046810 Bacteria 321859
217 Ga0495672_0000001 3300047320 Bacteria 1458820
218 Ga0495672_0000015 3300047320 Bacteria 502855
219 Ga0495672_0000020 3300047320 Bacteria 432845
220 Ga0495683_0023153 3300047323 Bacteria 3193
221 Ga0495683_0025382 3300047323 Bacteria 3038
222 Ga0495679_000082 3300047446 Bacteria 87565
223 Ga0495679_001498 3300047446 Bacteria 13187
224 Ga0495679_004279 3300047446 Bacteria 6629
225 Ga0495673_0000065 3300047469 Bacteria 222481
226 Ga0495673_0000247 3300047469 Bacteria 75782
227 Ga0496101_0000318 3300048904 Bacteria 33264
228 Ga0496104_0000540 3300048907 Bacteria 32404
229 Ga0496104_0001118 3300048907 Bacteria 22956
230 Ga0496113_0086355 3300048916 Bacteria 2411
231 Ga0496116_0000001 3300048919 Bacteria 1501681
232 Ga0496116_0000066 3300048919 Bacteria 264035
233 Ga0496116_0000086 3300048919 Bacteria 217597
234 Ga0496116_0000316 3300048919 Bacteria 80027
235 Ga0496116_0000575 3300048919 Bacteria 49158
236 Ga0496116_0002647 3300048919 Bacteria 18545
237 Ga0496116_0002692 3300048919 Bacteria 18340
238 Ga0496116_0003259 3300048919 Bacteria 16172
239 Ga0496116_0021386 3300048919 Bacteria 4881
240 Ga0496116_0029214 3300048919 Bacteria 3979
241 Ga0496116_0044714 3300048919 Bacteria 3005
242 Ga0496117_0000022 3300048920 Bacteria 439512
243 Ga0496117_0000058 3300048920 Bacteria 264132
244 Ga0496117_0000418 3300048920 Bacteria 71636
245 Ga0496117_0000813 3300048920 Bacteria 48357
246 Ga0496117_0001434 3300048920 Bacteria 34407
247 Ga0496117_0003141 3300048920 Bacteria 19694
248 Ga0496117_0007796 3300048920 Bacteria 10315
249 Ga0496117_0043212 3300048920 Bacteria 3280
250 Ga0496118_0000007 3300048921 Bacteria 650986
251 Ga0496118_0000311 3300048921 Bacteria 84212
252 Ga0496118_0000328 3300048921 Bacteria 81811
253 Ga0496118_0004066 3300048921 Bacteria 17735
254 Ga0496118_0010081 3300048921 Bacteria 9400
255 Ga0496118_0010641 3300048921 Bacteria 9079
256 Ga0496118_0012156 3300048921 Bacteria 8305
257 Ga0496118_0016632 3300048921 Bacteria 6739
258 Ga0496118_0016892 3300048921 Bacteria 6667
259 Ga0496118_0021633 3300048921 Bacteria 5653
260 Ga0496118_0038550 3300048921 Bacteria 3827
261 Ga0496118_0057385 3300048921 Bacteria 2918
262 Ga0496119_0000018 3300048922 Bacteria 306476
263 Ga0496119_0000066 3300048922 Bacteria 162680
264 Ga0496119_0000089 3300048922 Bacteria 134344
265 Ga0496119_0002130 3300048922 Bacteria 22276
266 Ga0496119_0003068 3300048922 Bacteria 17642
267 Ga0496119_0004801 3300048922 Bacteria 13266
268 Ga0496119_0015443 3300048922 Bacteria 5877
269 Ga0496119_0016321 3300048922 Bacteria 5658
270 Ga0496119_0043927 3300048922 Bacteria 2819
271 Ga0496119_0047884 3300048922 Bacteria 2655
272 Ga0496120_0000002 3300048923 Bacteria 547999
273 Ga0496120_0000091 3300048923 Bacteria 149829
274 Ga0496120_0000117 3300048923 Bacteria 134343
275 Ga0496120_0000635 3300048923 Bacteria 52296
276 Ga0496120_0001234 3300048923 Bacteria 32345
277 Ga0496120_0001402 3300048923 Bacteria 29168
278 Ga0496120_0002202 3300048923 Bacteria 20588
279 Ga0496120_0004856 3300048923 Bacteria 10991
280 Ga0496120_0007032 3300048923 Bacteria 8456
281 Ga0496120_0007579 3300048923 Bacteria 8051
282 Ga0496120_0012779 3300048923 Bacteria 5689
283 Ga0496120_0034664 3300048923 Bacteria 3021
284 Ga0496121_0000205 3300048924 Bacteria 130748
285 Ga0496121_0001072 3300048924 Bacteria 48407
286 Ga0496121_0008513 3300048924 Bacteria 12038
287 Ga0496121_0013069 3300048924 Bacteria 8964
288 Ga0496121_0017373 3300048924 Bacteria 7355
289 Ga0496121_0024685 3300048924 Bacteria 5737
290 Ga0496121_0062374 3300048924 Bacteria 3053
291 Ga0496122_0000246 3300048925 Bacteria 121388
292 Ga0496122_0000291 3300048925 Bacteria 111096
293 Ga0496122_0000496 3300048925 Bacteria 81800
294 Ga0496122_0001516 3300048925 Bacteria 37035
295 Ga0496122_0005207 3300048925 Bacteria 15613
296 Ga0496122_0007648 3300048925 Bacteria 11930
297 Ga0496122_0011604 3300048925 Bacteria 8894
298 Ga0496123_0000078 3300048926 Bacteria 191819
299 Ga0496123_0000214 3300048926 Bacteria 117986
300 Ga0496123_0000397 3300048926 Bacteria 80703
301 Ga0496123_0003754 3300048926 Bacteria 16653
302 Ga0496123_0003943 3300048926 Bacteria 16077
303 Ga0496123_0004168 3300048926 Bacteria 15462
304 Ga0496123_0005234 3300048926 Bacteria 13178
305 Ga0496123_0007669 3300048926 Bacteria 10089
306 Ga0496123_0009936 3300048926 Bacteria 8488
307 Ga0496123_0069911 3300048926 Bacteria 2200
308 Ga0496124_0000008 3300048927 Bacteria 864372
309 Ga0496124_0000208 3300048927 Bacteria 115312
310 Ga0496124_0000702 3300048927 Bacteria 54791
311 Ga0496124_0001135 3300048927 Bacteria 41843
312 Ga0496124_0001437 3300048927 Bacteria 35236
313 Ga0496124_0002438 3300048927 Bacteria 24375
314 Ga0496124_0002570 3300048927 Bacteria 23528
315 Ga0496124_0002747 3300048927 Bacteria 22438
316 Ga0496124_0012551 3300048927 Bacteria 8349
317 Ga0496124_0026016 3300048927 Bacteria 5285
318 Ga0496124_0125825 3300048927 Bacteria 2042
319 Ga0496125_0000009 3300048928 Bacteria 677678
320 Ga0496125_0000033 3300048928 Bacteria 351850
321 Ga0496125_0000866 3300048928 Bacteria 48477
322 Ga0496125_0022887 3300048928 Bacteria 5788
323 Ga0496125_0027212 3300048928 Bacteria 5189
324 Ga0496125_0065207 3300048928 Bacteria 2887
325 Ga0496126_0001274 3300048929 Bacteria 40513
326 Ga0496126_0001297 3300048929 Bacteria 39818
327 Ga0496126_0001947 3300048929 Bacteria 29335
328 Ga0496126_0007388 3300048929 Bacteria 12051
329 Ga0496126_0067198 3300048929 Bacteria 3203
330 Ga0496126_0082307 3300048929 Bacteria 2844
331 Ga0496126_0103233 3300048929 Bacteria 2491
332 Ga0495678_000859 3300049459 Bacteria 27038
333 Ga0495682_0000001 3300049460 Bacteria 1559116
334 Ga0501034_0000502 3300049571 Bacteria 63266
335 Ga0501046_0000190 3300049580 Bacteria 63267
336 Ga0501047_0000240 3300049581 Bacteria 64681
337 Ga0501048_0008700 3300049582 Bacteria 7652
338 Ga0501067_0000048 3300049583 Bacteria 71117
339 Ga0501067_0000618 3300049583 Bacteria 19156
340 Ga0501067_0001319 3300049583 Bacteria 13444
341 Ga0501069_0004375 3300049585 Bacteria 7292
342 Ga0501072_0000049 3300049588 Bacteria 89925
343 Ga0501073_0000645 3300049589 Bacteria 24512
344 Ga0501073_0005911 3300049589 Bacteria 9134
345 Ga0501073_0011905 3300049589 Bacteria 6350
346 Ga0501080_0000081 3300049742 Bacteria 64244
347 Ga0501080_0006968 3300049742 Bacteria 10199
348 Ga0501083_0000085 3300049744 Bacteria 63823
349 nmdc:mga00v17_16318_c1 3300050491 Bacteria 4186
350 Ga0500621_000002 3300053126 Bacteria 849473
351 Ga0501084_0000100 3300054114 Bacteria 63619
352 Ga0501082_0001600 3300060353 Bacteria 19944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2871272651 2871275046 526
2 3300048919 Ga0496116_0021386 Ga0496116_0021386_10_1599 528
3 3300025711 Ga0207696_1001195 Ga0207696_10011956 578
4 3300049588 Ga0501072_0000049 Ga0501072_0000049_71904_73835 587
5 3300048929 Ga0496126_0103233 Ga0496126_0103233_615_2471 606
6 3300049742 Ga0501080_0006968 Ga0501080_0006968_5174_7120 606
7 iso_pu_bacteria 2547132416 2548648836 607
8 3300031595 Ga0265313_10002695 Ga0265313_1000269510 609
9 3300049571 Ga0501034_0000502 Ga0501034_0000502_58894_60795 609
10 3300049580 Ga0501046_0000190 Ga0501046_0000190_58894_60795 609
11 3300049581 Ga0501047_0000240 Ga0501047_0000240_2472_4373 609
12 3300049582 Ga0501048_0008700 Ga0501048_0008700_1889_3790 609
13 3300049742 Ga0501080_0000081 Ga0501080_0000081_3478_5379 609
14 3300049744 Ga0501083_0000085 Ga0501083_0000085_2472_4373 609
15 3300054114 Ga0501084_0000100 Ga0501084_0000100_2454_4355 609
16 3300060353 Ga0501082_0001600 Ga0501082_0001600_15623_17524 609
17 3300031235 Ga0265330_10008064 Ga0265330_100080642 610
18 3300031240 Ga0265320_10000697 Ga0265320_1000069726 610
19 3300031595 Ga0265313_10002170 Ga0265313_100021703 610
20 3300031711 Ga0265314_10001349 Ga0265314_1000134927 610
21 3300006946 Ga0079104_1000409 Ga0079104_100040941 611
22 3300009092 Ga0105250_10000193 Ga0105250_1000019318 611
23 3300025711 Ga0207696_1000082 Ga0207696_100008241 611
24 3300027111 Ga0209281_1000001 Ga0209281_1000001941 611
25 3300042010 Ga0439452_000145 Ga0439452_000145_43228_45150 611
26 3300048924 Ga0496121_0001072 Ga0496121_0001072_8033_9946 611
27 3300048927 Ga0496124_0001135 Ga0496124_0001135_38841_40754 611
28 3300048928 Ga0496125_0000009 Ga0496125_0000009_662582_664528 611
29 3300006946 Ga0079104_1005501 Ga0079104_10055014 612
30 3300027111 Ga0209281_1000521 Ga0209281_100052139 612
31 3300031241 Ga0265325_10009767 Ga0265325_100097674 612
32 3300031344 Ga0265316_10002006 Ga0265316_100020068 612
33 3300048925 Ga0496122_0011604 Ga0496122_0011604_1042_2955 612
34 3300048929 Ga0496126_0001947 Ga0496126_0001947_10941_12854 612
35 3300028800 Ga0265338_10006633 Ga0265338_100066333 613
36 3300049583 Ga0501067_0000048 Ga0501067_0000048_32145_34184 614
37 3300049589 Ga0501073_0005911 Ga0501073_0005911_5699_7648 614
38 3300049583 Ga0501067_0000618 Ga0501067_0000618_1637_3691 615
39 3300049589 Ga0501073_0011905 Ga0501073_0011905_2245_4299 615
40 3300009545 Ga0105237_10003003 Ga0105237_100030039 616
41 3300031595 Ga0265313_10030755 Ga0265313_100307552 616
42 3300031711 Ga0265314_10028986 Ga0265314_100289863 616
43 3300028577 Ga0265318_10018053 Ga0265318_100180532 617
44 3300031235 Ga0265330_10004381 Ga0265330_100043816 617
45 3300031242 Ga0265329_10001281 Ga0265329_100012818 617
46 3300031344 Ga0265316_10035964 Ga0265316_100359642 617
47 3300031711 Ga0265314_10008790 Ga0265314_100087905 617
48 3300031712 Ga0265342_10020645 Ga0265342_100206454 617
49 3300009093 Ga0105240_10007776 Ga0105240_1000777612 618
50 3300025913 Ga0207695_10016593 Ga0207695_100165938 618
51 3300025914 Ga0207671_10005640 Ga0207671_100056401 618
52 3300031595 Ga0265313_10023484 Ga0265313_100234843 618
53 3300048924 Ga0496121_0013069 Ga0496121_0013069_271_2175 618
54 3300003856 Ga0058692_1003345 Ga0058692_10033453 619
55 3300005289 Ga0065704_10080119 Ga0065704_100801194 619
56 3300006946 Ga0079104_1000350 Ga0079104_100035051 619
57 3300025711 Ga0207696_1003172 Ga0207696_10031722 619
58 3300027111 Ga0209281_1000218 Ga0209281_100021850 619
59 3300027312 Ga0209371_1000001 Ga0209371_1000001921 619
60 3300030500 Ga0268256_1000001 Ga0268256_10000011719 619
61 3300003856 Ga0058692_1003397 Ga0058692_10033973 620
62 3300005289 Ga0065704_10076153 Ga0065704_100761532 620
63 3300005548 Ga0070665_100002007 Ga0070665_10000200711 620
64 3300006051 Ga0075364_10003948 Ga0075364_100039482 620
65 3300009545 Ga0105237_10000025 Ga0105237_10000025136 620
66 3300013100 Ga0157373_10007092 Ga0157373_100070923 620
67 3300013104 Ga0157370_10006309 Ga0157370_100063094 620
68 3300015679 Ga0183366_1001 Ga0183366_1001997 620
69 3300015680 Ga0183370_1001 Ga0183370_1001997 620
70 3300015685 Ga0183369_1001 Ga0183369_1001997 620
71 3300015687 Ga0183368_1001 Ga0183368_1001997 620
72 3300025914 Ga0207671_10000075 Ga0207671_1000007543 620
73 3300026116 Ga0207674_10002024 Ga0207674_100020246 620
74 3300027312 Ga0209371_1001739 Ga0209371_10017393 620
75 3300028379 Ga0268266_10000435 Ga0268266_1000043566 620
76 3300030500 Ga0268256_1001517 Ga0268256_10015173 620
77 3300031712 Ga0265342_10002060 Ga0265342_100020606 620
78 3300041405 Ga0439438_000215 Ga0439438_000215_15320_17224 620
79 3300042010 Ga0439452_000166 Ga0439452_000166_39290_41197 620
80 3300046471 Ga0495650_0000021 Ga0495650_0000021_40835_42742 620
81 3300048907 Ga0496104_0001118 Ga0496104_0001118_16330_18237 620
82 3300048919 Ga0496116_0002692 Ga0496116_0002692_7982_9889 620
83 3300048920 Ga0496117_0000813 Ga0496117_0000813_16092_17999 620
84 3300048920 Ga0496117_0007796 Ga0496117_0007796_949_2856 620
85 3300048921 Ga0496118_0010081 Ga0496118_0010081_949_2856 620
86 3300048921 Ga0496118_0010641 Ga0496118_0010641_1599_3506 620
87 3300048921 Ga0496118_0038550 Ga0496118_0038550_657_2570 620
88 3300048922 Ga0496119_0002130 Ga0496119_0002130_2987_4894 620
89 3300048922 Ga0496119_0047884 Ga0496119_0047884_500_2407 620
90 3300048923 Ga0496120_0001402 Ga0496120_0001402_7821_9734 620
91 3300048923 Ga0496120_0007032 Ga0496120_0007032_645_2552 620
92 3300048924 Ga0496121_0008513 Ga0496121_0008513_966_2873 620
93 3300048924 Ga0496121_0017373 Ga0496121_0017373_4302_6209 620
94 3300048924 Ga0496121_0024685 Ga0496121_0024685_3005_4918 620
95 3300048924 Ga0496121_0062374 Ga0496121_0062374_991_2898 620
96 3300048925 Ga0496122_0001516 Ga0496122_0001516_13638_15545 620
97 3300048925 Ga0496122_0007648 Ga0496122_0007648_332_2239 620
98 3300048926 Ga0496123_0007669 Ga0496123_0007669_2552_4459 620
99 3300048926 Ga0496123_0009936 Ga0496123_0009936_1163_3070 620
100 3300048926 Ga0496123_0069911 Ga0496123_0069911_250_2163 620
101 3300048927 Ga0496124_0002438 Ga0496124_0002438_5885_7798 620
102 3300048927 Ga0496124_0125825 Ga0496124_0125825_16_1920 620
103 3300048928 Ga0496125_0022887 Ga0496125_0022887_92_1999 620
104 3300048929 Ga0496126_0001297 Ga0496126_0001297_1147_3054 620
105 3300050491 nmdc:mga00v17_16318_c1 nmdc:mga00v17_16318_c1_1624_3531 620
106 3300006946 Ga0079104_1000932 Ga0079104_100093211 621
107 3300027111 Ga0209281_1000301 Ga0209281_100030183 621
108 3300049583 Ga0501067_0001319 Ga0501067_0001319_4783_6747 621
109 3300049589 Ga0501073_0000645 Ga0501073_0000645_16756_18720 621
110 3300009036 Ga0105244_10002735 Ga0105244_100027352 622
111 3300009036 Ga0105244_10022721 Ga0105244_100227212 622
112 3300009092 Ga0105250_10001865 Ga0105250_100018657 622
113 3300025711 Ga0207696_1002817 Ga0207696_10028174 622
114 3300025728 Ga0207655_1000009 Ga0207655_1000009256 622
115 3300025728 Ga0207655_1003233 Ga0207655_10032334 622
116 3300025735 Ga0207713_1000012 Ga0207713_1000012114 622
117 3300034818 Ga0373950_0000009 Ga0373950_0000009_190143_192068 622
118 3300044669 Ga0466981_0000002 Ga0466981_0000002_27625_29532 622
119 3300048928 Ga0496125_0000866 Ga0496125_0000866_8052_9959 622
120 3300048929 Ga0496126_0082307 Ga0496126_0082307_686_2593 622
121 3300005289 Ga0065704_10001528 Ga0065704_100015284 623
122 3300006946 Ga0079104_1003703 Ga0079104_10037035 623
123 3300025711 Ga0207696_1001734 Ga0207696_100173410 623
124 3300025728 Ga0207655_1000001 Ga0207655_1000001996 623
125 3300025735 Ga0207713_1015779 Ga0207713_10157792 623
126 3300027111 Ga0209281_1000123 Ga0209281_100012343 623
127 3300046458 Ga0495591_000022 Ga0495591_000022_38658_40565 623
128 3300048919 Ga0496116_0002647 Ga0496116_0002647_8240_10147 623
129 3300048922 Ga0496119_0043927 Ga0496119_0043927_636_2543 623
130 3300048925 Ga0496122_0000246 Ga0496122_0000246_77050_78957 623
131 3300048926 Ga0496123_0000214 Ga0496123_0000214_71322_73229 623
132 3300031712 Ga0265342_10002415 Ga0265342_1000241514 624
133 3300048926 Ga0496123_0003754 Ga0496123_0003754_6296_8239 624
134 iso_pu_bacteria 2876601092 2876603980 624
135 iso_pu_bacteria 2916178963 2916180756 624
136 iso_pu_bacteria 2919497567 2919500755 624
137 iso_pu_bacteria 2952252522 2952252665 624
138 3300006946 Ga0079104_1006387 Ga0079104_10063876 626
139 3300009011 Ga0105251_10000161 Ga0105251_1000016154 626
140 3300009011 Ga0105251_10000311 Ga0105251_100003116 626
141 3300009011 Ga0105251_10002497 Ga0105251_1000249710 626
142 3300009036 Ga0105244_10002511 Ga0105244_100025116 626
143 3300009174 Ga0105241_10000001 Ga0105241_100000016 626
144 3300014497 Ga0182008_10004724 Ga0182008_100047242 626
145 3300025728 Ga0207655_1000110 Ga0207655_100011089 626
146 3300025735 Ga0207713_1000035 Ga0207713_1000035147 626
147 3300025735 Ga0207713_1009881 Ga0207713_10098812 626
148 3300046542 Ga0495597_0002213 Ga0495597_0002213_2137_4122 626
149 3300048920 Ga0496117_0043212 Ga0496117_0043212_564_2489 626
150 3300048922 Ga0496119_0016321 Ga0496119_0016321_2182_4107 626
151 3300048923 Ga0496120_0000635 Ga0496120_0000635_15330_17255 626
152 3300009011 Ga0105251_10000116 Ga0105251_1000011667 627
153 3300025735 Ga0207713_1000002 Ga0207713_100000292 627
154 3300025735 Ga0207713_1000351 Ga0207713_100035146 627
155 3300025911 Ga0207654_10000004 Ga0207654_1000000431 627
156 3300027111 Ga0209281_1000003 Ga0209281_1000003728 627
157 3300048922 Ga0496119_0003068 Ga0496119_0003068_6938_8863 627
158 3300048923 Ga0496120_0007579 Ga0496120_0007579_3145_5070 627
159 3300048927 Ga0496124_0000008 Ga0496124_0000008_401515_403440 627
160 3300048929 Ga0496126_0007388 Ga0496126_0007388_7364_9316 627
161 iso_pu_bacteria 2602042047 2603642784 627
162 iso_pu_bacteria 2602042066 2603698173 627
163 iso_pu_bacteria 2602042067 2603703386 627
164 iso_pu_bacteria 2667528172 2671103316 627
165 iso_pu_bacteria 2681812866 2681997549 627
166 iso_pu_bacteria 2681812869 2682006941 627
167 iso_pu_bacteria 2690315857 2691332576 627
168 iso_pu_bacteria 2751185917 2753855627 627
169 iso_pu_bacteria 2765235842 2765588609 627
170 iso_pu_bacteria 2775506706 2775538615 627
171 iso_pu_bacteria 2821118458 2821119432 627
172 iso_pu_bacteria 2823373977 2823374397 627
173 iso_pu_bacteria 2844425489 2844427169 627
174 iso_pu_bacteria 2919534386 2919538106 627
175 iso_pu_bacteria 2923634449 2923634493 627
176 iso_pu_bacteria 2927833300 2927834450 627
177 iso_pu_bacteria 2937539931 2937543092 627
178 iso_pu_bacteria 2939607340 2939607788 627
179 iso_pu_bacteria 2974310843 2974312473 627
180 iso_pu_bacteria 8018405270 8018408502 627
181 iso_pu_bacteria 8055097453 8055099798 627
182 3300009092 Ga0105250_10000114 Ga0105250_1000011450 628
183 3300009092 Ga0105250_10001162 Ga0105250_100011626 628
184 3300025711 Ga0207696_1000038 Ga0207696_1000038205 628
185 3300034818 Ga0373950_0000048 Ga0373950_0000048_38879_40906 628
186 3300048919 Ga0496116_0003259 Ga0496116_0003259_5623_7551 628
187 3300048921 Ga0496118_0021633 Ga0496118_0021633_76_2004 628
188 3300048922 Ga0496119_0000018 Ga0496119_0000018_148604_150526 628
189 3300048923 Ga0496120_0000002 Ga0496120_0000002_185650_187572 628
190 iso_pu_bacteria 2609459761 2609910174 628
191 iso_pu_bacteria 2939568625 2939568825 628
192 iso_pu_bacteria 2939642701 2939644128 628
193 iso_pu_bacteria 8055087960 8055091118 628
194 iso_pu_bacteria 8055092621 8055094384 628
195 iso_pu_bacteria 2791355275 2793405812 629
196 iso_pu_bacteria 2871272651 2871275054 629
197 iso_pu_bacteria 2884086401 2884089296 629
198 iso_pu_bacteria 2923525760 2923526124 629
199 iso_pu_bacteria 8057304971 8057308944 629
200 3300006946 Ga0079104_1000236 Ga0079104_100023663 630
201 3300013307 Ga0157372_10063561 Ga0157372_100635612 630
202 3300027111 Ga0209281_1000274 Ga0209281_100027463 630
203 3300046660 Ga0495625_0001452 Ga0495625_0001452_21688_23673 630
204 3300048923 Ga0496120_0001234 Ga0496120_0001234_24899_26818 630
205 3300048927 Ga0496124_0001437 Ga0496124_0001437_22486_24405 630
206 iso_pu_bacteria 2547132181 2547695108 630
207 iso_pu_bacteria 2554235234 2555260247 630
208 iso_pu_bacteria 2599185169 2599410953 630
209 iso_pu_bacteria 2600255254 2601521579 630
210 iso_pu_bacteria 2600255255 2601526604 630
211 iso_pu_bacteria 2600255256 2601535198 630
212 iso_pu_bacteria 2600255257 2601540761 630
213 iso_pu_bacteria 2600255280 2601613434 630
214 iso_pu_bacteria 2600255281 2601622337 630
215 iso_pu_bacteria 2600255287 2601643148 630
216 iso_pu_bacteria 2600255288 2601650373 630
217 iso_pu_bacteria 2600255289 2601655662 630
218 iso_pu_bacteria 2600255290 2601656909 630
219 iso_pu_bacteria 2600255291 2601662969 630
220 iso_pu_bacteria 2600255298 2601695928 630
221 iso_pu_bacteria 2600255299 2601700602 630
222 iso_pu_bacteria 2600255300 2601704706 630
223 iso_pu_bacteria 2600255301 2601709735 630
224 iso_pu_bacteria 2600255302 2601714747 630
225 iso_pu_bacteria 2600255303 2601720953 630
226 iso_pu_bacteria 2600255304 2601725153 630
227 iso_pu_bacteria 2600255305 2601729695 630
228 iso_pu_bacteria 2600255306 2601734712 630
229 iso_pu_bacteria 2600255307 2601743658 630
230 iso_pu_bacteria 2600255309 2601753210 630
231 iso_pu_bacteria 2600255310 2601758380 630
232 iso_pu_bacteria 2600255311 2601764489 630
233 iso_pu_bacteria 2600255392 2602020941 630
234 iso_pu_bacteria 2602042046 2603638260 630
235 iso_pu_bacteria 2602042052 2603660343 630
236 iso_pu_bacteria 2602042053 2603665618 630
237 iso_pu_bacteria 2602042103 2603837068 630
238 iso_pu_bacteria 2602042104 2603842144 630
239 iso_pu_bacteria 2602042105 2603847217 630
240 iso_pu_bacteria 2602042106 2603852287 630
241 iso_pu_bacteria 2602042109 2603864510 630
242 iso_pu_bacteria 2602042110 2603870341 630
243 iso_pu_bacteria 2602042111 2603875355 630
244 iso_pu_bacteria 2603880178 2606047532 630
245 iso_pu_bacteria 2603880184 2606070049 630
246 iso_pu_bacteria 2603880202 2606145965 630
247 iso_pu_bacteria 2603880211 2606174933 630
248 iso_pu_bacteria 2636415599 2637225799 630
249 iso_pu_bacteria 2675903046 2676407942 630
250 iso_pu_bacteria 2775507074 2777023649 630
251 iso_pu_bacteria 2791355010 2792311385 630
252 iso_pu_bacteria 2811995292 2813729294 630
253 iso_pu_bacteria 2814123068 2814696804 630
254 iso_pu_bacteria 2904513164 2904513347 630
255 iso_pu_bacteria 2919108558 2919112103 630
256 iso_pu_bacteria 2919493220 2919494703 630
257 iso_pu_bacteria 2919543075 2919546659 630
258 iso_pu_bacteria 2935625433 2935626960 630
259 iso_pu_bacteria 2939617950 2939619296 630
260 iso_pu_bacteria 2969079654 2969082797 630
261 iso_pu_bacteria 2971820967 2971824134 630
262 iso_pu_bacteria 2974435778 2974438173 630
263 iso_pu_bacteria 2984559226 2984559862 630
264 iso_pu_bacteria 2984595703 2984597943 630
265 iso_pu_bacteria 8019504834 8019506180 630
266 3300049585 Ga0501069_0004375 Ga0501069_0004375_3827_5878 631
267 iso_pu_bacteria 8018221730 8018222178 631
268 3300006946 Ga0079104_1001482 Ga0079104_100148211 632
269 3300009036 Ga0105244_10000047 Ga0105244_1000004795 632
270 3300009036 Ga0105244_10000284 Ga0105244_1000028439 632
271 3300021384 Ga0213876_10000191 Ga0213876_1000019128 632
272 3300025728 Ga0207655_1000364 Ga0207655_100036435 632
273 3300025728 Ga0207655_1000500 Ga0207655_100050040 632
274 3300027111 Ga0209281_1002130 Ga0209281_10021305 632
275 3300034818 Ga0373950_0000051 Ga0373950_0000051_41296_43329 632
276 3300039437 Ga0436365_1037676 Ga0436365_1037676_27941_29887 632
277 3300046694 Ga0495649_0000337 Ga0495649_0000337_29448_31370 632
278 3300046694 Ga0495649_0000416 Ga0495649_0000416_8991_10913 632
279 3300047446 Ga0495679_001498 Ga0495679_001498_1458_3380 632
280 3300047469 Ga0495673_0000065 Ga0495673_0000065_141860_143767 632
281 3300048925 Ga0496122_0000291 Ga0496122_0000291_6680_8626 632
282 3300048926 Ga0496123_0000078 Ga0496123_0000078_102953_104899 632
283 iso_pu_bacteria 2945874760 2945877376 632
284 3300009036 Ga0105244_10001172 Ga0105244_1000117213 633
285 3300013102 Ga0157371_10009798 Ga0157371_100097989 633
286 3300013307 Ga0157372_10056885 Ga0157372_100568854 633
287 3300015261 Ga0182006_1000047 Ga0182006_1000047150 633
288 3300025728 Ga0207655_1001199 Ga0207655_100119914 633
289 3300034818 Ga0373950_0000027 Ga0373950_0000027_13633_15657 633
290 3300042006 Ga0439432_001317 Ga0439432_001317_1761_3719 633
291 3300042010 Ga0439452_000002 Ga0439452_000002_1340059_1341993 633
292 3300048922 Ga0496119_0015443 Ga0496119_0015443_3422_5380 633
293 3300048923 Ga0496120_0012779 Ga0496120_0012779_3139_5097 633
294 3300048927 Ga0496124_0002570 Ga0496124_0002570_11817_13742 633
295 iso_pu_bacteria 2599185299 2599925882 633
296 iso_pu_bacteria 2608642108 2608669660 633
297 iso_pu_bacteria 2648501693 2650896325 633
298 iso_pu_bacteria 2671180115 2671589453 633
299 iso_pu_bacteria 2684622997 2686353604 633
300 iso_pu_bacteria 2808606414 2809125098 633
301 iso_pu_bacteria 2844528606 2844531138 633
302 iso_pu_bacteria 2847797336 2847799608 633
303 iso_pu_bacteria 2865014394 2865015511 633
304 iso_pu_bacteria 2881609920 2881610435 633
305 iso_pu_bacteria 2945951305 2945952737 633
306 iso_pu_bacteria 2978975091 2978979311 633
307 iso_pu_bacteria 2990261002 2990262310 633
308 3300002773 JGI25152J39213_1000562 JGI25152J39213_10005627 634
309 3300003856 Ga0058692_1000796 Ga0058692_100079611 634
310 3300003856 Ga0058692_1001239 Ga0058692_10012395 634
311 3300013307 Ga0157372_10012170 Ga0157372_100121707 634
312 3300025258 Ga0209129_1000004 Ga0209129_10000047 634
313 3300027312 Ga0209371_1000002 Ga0209371_100000294 634
314 3300027312 Ga0209371_1000041 Ga0209371_1000041141 634
315 3300030500 Ga0268256_1000002 Ga0268256_10000021370 634
316 3300030500 Ga0268256_1000003 Ga0268256_1000003965 634
317 3300041405 Ga0439438_000001 Ga0439438_000001_1088085_1090043 634
318 3300042010 Ga0439452_000008 Ga0439452_000008_64981_66918 634
319 3300048919 Ga0496116_0029214 Ga0496116_0029214_1645_3582 634
320 3300048919 Ga0496116_0044714 Ga0496116_0044714_89_2026 634
321 3300048920 Ga0496117_0003141 Ga0496117_0003141_7520_9457 634
322 3300048921 Ga0496118_0004066 Ga0496118_0004066_7520_9457 634
323 3300048921 Ga0496118_0057385 Ga0496118_0057385_417_2354 634
324 3300048922 Ga0496119_0000066 Ga0496119_0000066_65296_67233 634
325 3300048923 Ga0496120_0034664 Ga0496120_0034664_915_2852 634
326 3300048926 Ga0496123_0004168 Ga0496123_0004168_9970_11907 634
327 3300048928 Ga0496125_0065207 Ga0496125_0065207_940_2877 634
328 3300048929 Ga0496126_0067198 Ga0496126_0067198_870_2807 634
329 iso_pu_bacteria 2706794495 2707099059 634
330 iso_pu_bacteria 2846540461 2846543356 634
331 iso_pu_bacteria 2854601825 2854604001 634
332 iso_pu_bacteria 8054844752 8054846135 634
333 iso_pu_bacteria 8054849141 8054850605 634
334 iso_pu_bacteria 8055693939 8055695925 634
335 3300047446 Ga0495679_000082 Ga0495679_000082_45583_47589 635
336 iso_pu_bacteria 2511231025 2511382852 635
337 iso_pu_bacteria 2511231035 2511435149 635
338 iso_pu_bacteria 2852103415 2852105788 635
339 iso_pu_bacteria 2939602548 2939606194 635
340 iso_pu_bacteria 8016733728 8016735670 635
341 iso_pu_bacteria 8019499862 8019500930 635
342 iso_pu_bacteria 8057160832 8057161887 635
343 3300013104 Ga0157370_10000075 Ga0157370_1000007523 636
344 3300030500 Ga0268256_1005759 Ga0268256_10057594 636
345 3300046458 Ga0495591_016731 Ga0495591_016731_121_2034 636
346 3300046471 Ga0495650_0000026 Ga0495650_0000026_333819_335732 636
347 3300046501 Ga0495607_0002288 Ga0495607_0002288_2669_4582 636
348 3300046507 Ga0495606_0003617 Ga0495606_0003617_2132_4045 636
349 3300046530 Ga0495654_0000136 Ga0495654_0000136_23929_25842 636
350 3300046692 Ga0495671_0001618 Ga0495671_0001618_4079_5992 636
351 3300046694 Ga0495649_0021530 Ga0495649_0021530_1191_3104 636
352 3300046810 Ga0495660_0000016 Ga0495660_0000016_149078_150991 636
353 3300047320 Ga0495672_0000001 Ga0495672_0000001_379107_381020 636
354 3300047323 Ga0495683_0023153 Ga0495683_0023153_1208_3121 636
355 3300047323 Ga0495683_0025382 Ga0495683_0025382_321_2234 636
356 3300047469 Ga0495673_0000247 Ga0495673_0000247_32759_34672 636
357 3300049459 Ga0495678_000859 Ga0495678_000859_22578_24491 636
358 3300049460 Ga0495682_0000001 Ga0495682_0000001_721466_723379 636
359 3300053126 Ga0500621_000002 Ga0500621_000002_732902_734815 636
360 iso_pu_bacteria 2791354903 2791922540 636
361 iso_pu_bacteria 2908669403 2908669512 636
362 iso_pu_bacteria 2939573065 2939573927 636
363 3300003856 Ga0058692_1000639 Ga0058692_100063910 637
364 3300005347 Ga0070668_100010821 Ga0070668_1000108213 637
365 3300009011 Ga0105251_10013240 Ga0105251_100132405 637
366 3300013102 Ga0157371_10010931 Ga0157371_100109316 637
367 3300013104 Ga0157370_10001382 Ga0157370_1000138223 637
368 3300013105 Ga0157369_10114714 Ga0157369_101147141 637
369 3300013307 Ga0157372_10016382 Ga0157372_100163824 637
370 3300013307 Ga0157372_10039026 Ga0157372_100390264 637
371 3300017792 Ga0163161_10012450 Ga0163161_100124504 637
372 3300025233 Ga0209437_100155 Ga0209437_100155154 637
373 3300025728 Ga0207655_1004817 Ga0207655_10048175 637
374 3300025728 Ga0207655_1005909 Ga0207655_10059096 637
375 3300025735 Ga0207713_1000001 Ga0207713_10000011311 637
376 3300025735 Ga0207713_1015858 Ga0207713_10158584 637
377 3300027312 Ga0209371_1000039 Ga0209371_1000039147 637
378 3300027312 Ga0209371_1000157 Ga0209371_100015725 637
379 3300027312 Ga0209371_1001769 Ga0209371_10017695 637
380 3300027312 Ga0209371_1002716 Ga0209371_100271610 637
381 3300027312 Ga0209371_1005315 Ga0209371_10053153 637
382 3300030500 Ga0268256_1000033 Ga0268256_1000033216 637
383 3300030500 Ga0268256_1000098 Ga0268256_1000098129 637
384 3300030500 Ga0268256_1001541 Ga0268256_10015415 637
385 3300030500 Ga0268256_1005187 Ga0268256_10051873 637
386 3300041407 Ga0439447_004697 Ga0439447_004697_828_2744 637
387 3300041411 Ga0439466_0000136 Ga0439466_0000136_1597_3513 637
388 3300042010 Ga0439452_000001 Ga0439452_000001_1125340_1127256 637
389 3300042146 Ga0450907_001689 Ga0450907_001689_459_2375 637
390 3300046500 Ga0495596_0008318 Ga0495596_0008318_1162_3078 637
391 3300046524 Ga0495648_0004239 Ga0495648_0004239_1504_3420 637
392 3300047320 Ga0495672_0000015 Ga0495672_0000015_81139_83055 637
393 3300047446 Ga0495679_004279 Ga0495679_004279_2167_4083 637
394 3300048916 Ga0496113_0086355 Ga0496113_0086355_269_2185 637
395 3300048919 Ga0496116_0000575 Ga0496116_0000575_1551_3467 637
396 3300048920 Ga0496117_0000022 Ga0496117_0000022_80979_82895 637
397 3300048920 Ga0496117_0000058 Ga0496117_0000058_183195_185111 637
398 3300048920 Ga0496117_0001434 Ga0496117_0001434_11492_13408 637
399 3300048921 Ga0496118_0000007 Ga0496118_0000007_493503_495419 637
400 3300048921 Ga0496118_0000328 Ga0496118_0000328_79117_81033 637
401 3300048921 Ga0496118_0016632 Ga0496118_0016632_931_2847 637
402 3300048922 Ga0496119_0000089 Ga0496119_0000089_76482_78398 637
403 3300048923 Ga0496120_0000117 Ga0496120_0000117_55946_57862 637
404 3300048924 Ga0496121_0000205 Ga0496121_0000205_127234_129150 637
405 3300048925 Ga0496122_0005207 Ga0496122_0005207_6499_8415 637
406 3300048926 Ga0496123_0003943 Ga0496123_0003943_4422_6338 637
407 3300048927 Ga0496124_0000208 Ga0496124_0000208_57377_59293 637
408 3300048927 Ga0496124_0026016 Ga0496124_0026016_881_2797 637
409 3300048928 Ga0496125_0027212 Ga0496125_0027212_10_1926 637
410 iso_pu_bacteria 2506520007 2506578821 637
411 iso_pu_bacteria 2506520008 2506583960 637
412 iso_pu_bacteria 2508501071 2508852756 637
413 iso_pu_bacteria 2537561728 2538424861 637
414 iso_pu_bacteria 2654587920 2656279754 637
415 iso_pu_bacteria 2687453601 2689445331 637
416 iso_pu_bacteria 2772190666 2772439308 637
417 iso_pu_bacteria 2806310673 2807179060 637
418 iso_pu_bacteria 2855195626 2855199742 637
419 iso_pu_bacteria 2858466076 2858468497 637
420 iso_pu_bacteria 2869551831 2869554775 637
421 iso_pu_bacteria 2871282230 2871285003 637
422 iso_pu_bacteria 2888366609 2888369366 637
423 iso_pu_bacteria 2888373701 2888377990 637
424 iso_pu_bacteria 2900051742 2900051985 637
425 iso_pu_bacteria 2932406140 2932407780 637
426 iso_pu_bacteria 2937967321 2937967939 637
427 iso_pu_bacteria 2939577877 2939580185 637
428 iso_pu_bacteria 640753048 640938259 637
429 iso_pu_bacteria 8004592986 8004597044 637
430 iso_pu_bacteria 8015394850 8015395499 637
431 3300003856 Ga0058692_1003964 Ga0058692_10039644 638
432 3300003856 Ga0058692_1007143 Ga0058692_10071433 638
433 3300009036 Ga0105244_10001574 Ga0105244_1000157410 638
434 3300025728 Ga0207655_1000007 Ga0207655_100000796 638
435 3300027312 Ga0209371_1000005 Ga0209371_1000005434 638
436 3300027312 Ga0209371_1000110 Ga0209371_1000110115 638
437 3300027312 Ga0209371_1006362 Ga0209371_10063625 638
438 3300030500 Ga0268256_1000006 Ga0268256_1000006623 638
439 3300030500 Ga0268256_1003656 Ga0268256_10036565 638
440 3300030500 Ga0268256_1008829 Ga0268256_10088291 638
441 3300047320 Ga0495672_0000020 Ga0495672_0000020_156463_158451 638
442 3300048919 Ga0496116_0000316 Ga0496116_0000316_14345_16264 638
443 iso_pu_bacteria 2891670763 2891672789 638
444 iso_pu_bacteria 2904504865 2904507661 638
445 3300013100 Ga0157373_10000307 Ga0157373_1000030730 639
446 3300013102 Ga0157371_10008318 Ga0157371_100083186 639
447 3300025728 Ga0207655_1017185 Ga0207655_10171852 639
448 3300046458 Ga0495591_000007 Ga0495591_000007_223594_225516 639
449 3300046530 Ga0495654_0000007 Ga0495654_0000007_260730_262652 639
450 3300046616 Ga0495668_0055271 Ga0495668_0055271_28_1950 639
451 3300048904 Ga0496101_0000318 Ga0496101_0000318_19353_21275 639
452 3300048919 Ga0496116_0000086 Ga0496116_0000086_132186_134108 639
453 3300048922 Ga0496119_0004801 Ga0496119_0004801_8620_10542 639
454 3300048923 Ga0496120_0000091 Ga0496120_0000091_79609_81531 639
455 3300048923 Ga0496120_0002202 Ga0496120_0002202_11396_13318 639
456 3300048926 Ga0496123_0005234 Ga0496123_0005234_3222_5144 639
457 3300048927 Ga0496124_0002747 Ga0496124_0002747_2296_4218 639
458 3300048927 Ga0496124_0012551 Ga0496124_0012551_6232_8154 639
459 3300013100 Ga0157373_10009196 Ga0157373_100091965 640
460 3300009011 Ga0105251_10011623 Ga0105251_100116231 641
461 3300009092 Ga0105250_10000649 Ga0105250_100006497 641
462 3300009101 Ga0105247_10000012 Ga0105247_1000001276 641
463 3300017792 Ga0163161_10000001 Ga0163161_100000011549 641
464 3300025711 Ga0207696_1000001 Ga0207696_10000011631 641
465 3300025735 Ga0207713_1000039 Ga0207713_1000039189 641
466 3300025900 Ga0207710_10000083 Ga0207710_10000083134 641
467 3300046453 Ga0495627_000210 Ga0495627_000210_23709_25634 641
468 3300046530 Ga0495654_0001521 Ga0495654_0001521_1744_3669 641
469 3300046794 Ga0495589_0000001 Ga0495589_0000001_332527_334452 641
470 3300048919 Ga0496116_0000001 Ga0496116_0000001_1064579_1066504 641
471 3300048920 Ga0496117_0000418 Ga0496117_0000418_15120_17045 641
472 3300048921 Ga0496118_0012156 Ga0496118_0012156_5853_7778 641
473 3300025711 Ga0207696_1000015 Ga0207696_1000015226 642
474 iso_pu_bacteria 2585427591 2585830303 643
475 iso_pu_bacteria 2585427592 2585834703 643
476 iso_pu_bacteria 2667528173 2671110559 645
477 iso_pu_bacteria 2904474040 2904477295 645
478 iso_pu_bacteria 2919150387 2919153462 645
479 iso_pu_bacteria 2927143783 2927144088 645
480 3300002771 JGI25163J39215_1000032 JGI25163J39215_10000328 649
481 3300002772 JGI25164J39214_1000002 JGI25164J39214_1000002206 649
482 3300003751 Ga0055538_1000015 Ga0055538_100001563 649
483 3300003752 Ga0055539_1000009 Ga0055539_1000009154 649
484 3300003756 Ga0055533_1000012 Ga0055533_1000012205 649
485 3300003759 Ga0055525_1000014 Ga0055525_1000014154 649
486 3300003841 Ga0055541_1000006 Ga0055541_1000006205 649
487 3300005289 Ga0065704_10001232 Ga0065704_1000123213 649
488 3300009036 Ga0105244_10000686 Ga0105244_1000068616 649
489 3300025207 Ga0209760_100040 Ga0209760_10004020 649
490 3300025224 Ga0209784_100001 Ga0209784_1000012091 649
491 3300025225 Ga0209566_100001 Ga0209566_1000012091 649
492 3300025226 Ga0209674_100002 Ga0209674_1000022091 649
493 3300025230 Ga0209563_100002 Ga0209563_100002626 649
494 3300025231 Ga0207427_100020 Ga0207427_100020150 649
495 3300025233 Ga0209437_100001 Ga0209437_100001626 649
496 3300025253 Ga0209677_100002 Ga0209677_100002626 649
497 3300025711 Ga0207696_1000481 Ga0207696_100048119 649
498 3300046471 Ga0495650_0000043 Ga0495650_0000043_327385_329334 649
499 3300046810 Ga0495660_0000012 Ga0495660_0000012_8035_9984 649
500 3300048907 Ga0496104_0000540 Ga0496104_0000540_15149_17098 649
501 3300048919 Ga0496116_0000066 Ga0496116_0000066_254066_256015 649
502 3300048921 Ga0496118_0000311 Ga0496118_0000311_74383_76332 649
503 3300048921 Ga0496118_0016892 Ga0496118_0016892_1236_3185 649
504 3300048923 Ga0496120_0004856 Ga0496120_0004856_3157_5106 649
505 3300048925 Ga0496122_0000496 Ga0496122_0000496_64225_66174 649
506 3300048926 Ga0496123_0000397 Ga0496123_0000397_64222_66171 649
507 3300048927 Ga0496124_0000702 Ga0496124_0000702_28341_30290 649
508 3300048928 Ga0496125_0000033 Ga0496125_0000033_14390_16339 649
509 3300048929 Ga0496126_0001274 Ga0496126_0001274_30767_32716 649

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01131

Topoisom_bac

DNA topoisomerase

149

611

0.93

PF01751

Toprim

Toprim domain

1

133

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o59-assembly2.cif.gz_B structure of e. coli topoisomerase iii in complex with an 8-base single stranded oligonucleotide. frozen in glycerol ph 8.0 0.9834 1 618
2o54-assembly2.cif.gz_B structure of e. coli topoisomerase iii in complex with an 8-base single stranded oligonucleotide. frozen in glycerol at ph 7.0 0.9785 1 624
1i7d-assembly1.cif.gz_A noncovalent complex of e.coli dna topoisomerase iii with an 8-base single-stranded dna oligonucleotide 0.9742 1 618
1i7d-assembly1.cif.gz_A noncovalent complex of e.coli dna topoisomerase iii with an 8-base single-stranded dna oligonucleotide 0.9681 1 618
2o59-assembly2.cif.gz_B structure of e. coli topoisomerase iii in complex with an 8-base single stranded oligonucleotide. frozen in glycerol ph 8.0 0.9679 1 618
ID Description Score Start End Superfamily
2o19A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9861 1 155 3.40.50.140
2o19A04 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; domain 4;Topoisomerase I, domain 4 0.9769 289 416 1.10.290.10
2o19A02 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; domain 2;Topoisomerase I, domain 2 0.9749 159 616 1.10.460.10
2o19A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9737 1 155 3.40.50.140
1i7dA02 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; domain 2;Topoisomerase I, domain 2 0.9696 159 607 1.10.460.10
ID Description Score Start End GO Terms
AF-A0A378F787-F1-model_v4 Omega-protein (Relaxing enzyme) (Swivelase) (Untwisting enzyme) 0.9971 1 198 GO:0003677
GO:0003917
GO:0006265
GO:0006281
GO:0006310
GO:0043597
AF-A0A636LL44-F1-model_v4 DNA topoisomerase III 0.9951 1 168 GO:0003677
GO:0003917
GO:0006265
GO:0006281
GO:0006310
GO:0043597
AF-A0A379VTQ1-F1-model_v4 Selenophosphate synthetase (EC 5.99.1.2) 0.9944 1 126 GO:0004756
GO:0005524
GO:0005737
GO:0016260
GO:0016853
AF-A0A0D8QLB4-F1-model_v4 deleted 0.9923 19 108
AF-A0A379BCC7-F1-model_v4 deleted 0.9921 1 221

Feature Viewer

pLDDT pTM Quality
88.08 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map