F457119

General Info

Members Datasets Scaffolds Average Seq Length
510 232 1020 160

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10072489|Ga0111539_100724894
Length 192
Sequence MPTFEVSAHMTVRPGQLEEFKKQAMRLPTEGPMTTTSLETKVHDFLSQKRIAVAGVSRHNSDHPVGNLIYQRLKKTGHDVFPVNPHMQTFEGDRCYRDLQSIPGGVDGVVIITRPEVTERIVHDCSDAGVRRVWMHQSLGKGSSVSQKAVTYCHQHDISVIAGACPMMYGDGVDVGHTCMRWILKFTGGLPT

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
210 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
213 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
216 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
217 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 4.9
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 43.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10072489 3300009094 Bacteria 4061
2 SwRhRL2b_contig_3088676 2162886007 Unclassified 1331
3 Ga0065704_10090590 3300005289 Viruses 2776
4 Ga0065704_10133022 3300005289 Unclassified 1605
5 Ga0065704_10205014 3300005289 Unclassified 1131
6 Ga0065704_10369352 3300005289 Bacteria 787
7 Ga0065704_10805525 3300005289 Unclassified 523
8 Ga0065712_10076400 3300005290 Bacteria 3663
9 Ga0065712_10077821 3300005290 Bacteria 3437
10 Ga0065712_10135983 3300005290 Unclassified 1497
11 Ga0065712_10206312 3300005290 Unclassified 1080
12 Ga0065712_10230908 3300005290 Unclassified 1011
13 Ga0065715_10035530 3300005293 Bacteria 1498
14 Ga0065715_10114683 3300005293 Unclassified 2442
15 Ga0065715_10192838 3300005293 Unclassified 1388
16 Ga0065715_11039474 3300005293 Unclassified 535
17 Ga0065707_10002467 3300005295 Bacteria 4561
18 Ga0065707_10090251 3300005295 Bacteria 4181
19 Ga0065707_10112338 3300005295 Bacteria 2364
20 Ga0065707_10119449 3300005295 Bacteria 2159
21 Ga0065707_10181474 3300005295 Unclassified 1416
22 Ga0070676_10124225 3300005328 Bacteria 1624
23 Ga0070676_10161421 3300005328 Bacteria 1443
24 Ga0070676_10182179 3300005328 Bacteria 1366
25 Ga0070683_100012348 3300005329 Bacteria 7421
26 Ga0070690_100038567 3300005330 Unclassified 3016
27 Ga0070690_100062898 3300005330 Archaea 2394
28 Ga0070690_100112222 3300005330 Unclassified 1820
29 Ga0070670_100009539 3300005331 Bacteria 8282
30 Ga0070670_100049097 3300005331 Unclassified 3630
31 Ga0070670_100082507 3300005331 Unclassified 2762
32 Ga0070670_100223008 3300005331 Bacteria 1640
33 Ga0068869_100024646 3300005334 Unclassified 4169
34 Ga0070666_10647351 3300005335 Unclassified 773
35 Ga0070680_100344312 3300005336 Unclassified 1267
36 Ga0070680_100715597 3300005336 Unclassified 862
37 Ga0070680_101172955 3300005336 Unclassified 664
38 Ga0070682_100247141 3300005337 Bacteria 1284
39 Ga0068868_100498629 3300005338 Bacteria 1066
40 Ga0068868_100977664 3300005338 Unclassified 773
41 Ga0070689_100020229 3300005340 Bacteria 4937
42 Ga0070689_100044284 3300005340 Unclassified 3423
43 Ga0070689_100074187 3300005340 Bacteria 2662
44 Ga0070689_100149752 3300005340 Unclassified 1881
45 Ga0070689_100854302 3300005340 Unclassified 803
46 Ga0070687_100006294 3300005343 Unclassified 4861
47 Ga0070687_100014411 3300005343 Bacteria 3550
48 Ga0070687_100194129 3300005343 Unclassified 1225
49 Ga0070661_100018541 3300005344 Bacteria 4949
50 Ga0070669_100005982 3300005353 Bacteria 8779
51 Ga0070669_100228836 3300005353 Bacteria 1473
52 Ga0070669_100308479 3300005353 Bacteria 1275
53 Ga0070675_100000986 3300005354 Bacteria 20361
54 Ga0070675_100002041 3300005354 Bacteria 14983
55 Ga0070675_100018445 3300005354 Bacteria 5554
56 Ga0070675_100106288 3300005354 Bacteria 2369
57 Ga0070675_100168866 3300005354 Unclassified 1885
58 Ga0070671_100007092 3300005355 Bacteria 8968
59 Ga0070671_100038808 3300005355 Bacteria 3952
60 Ga0070671_100731953 3300005355 Bacteria 859
61 Ga0070673_100003385 3300005364 Bacteria 9921
62 Ga0070673_100052842 3300005364 Bacteria 3189
63 Ga0070673_101378274 3300005364 Unclassified 663
64 Ga0070673_101422655 3300005364 Bacteria 653
65 Ga0070688_100292761 3300005365 Bacteria 1174
66 Ga0070688_100340371 3300005365 Unclassified 1095
67 Ga0070667_100329593 3300005367 Bacteria 1379
68 Ga0070709_10310538 3300005434 Unclassified 1154
69 Ga0070713_101658390 3300005436 Unclassified 621
70 Ga0070701_10005894 3300005438 Bacteria 5112
71 Ga0070701_10007601 3300005438 Bacteria 4642
72 Ga0070701_10106543 3300005438 Unclassified 1560
73 Ga0070705_100048143 3300005440 Unclassified 2468
74 Ga0070705_100096623 3300005440 Bacteria 1855
75 Ga0070705_100108218 3300005440 Bacteria 1770
76 Ga0070705_100162700 3300005440 Bacteria 1494
77 Ga0070700_100008129 3300005441 Bacteria 5705
78 Ga0070700_100582763 3300005441 Unclassified 874
79 Ga0070694_100004550 3300005444 Bacteria 8338
80 Ga0070694_100014770 3300005444 Unclassified 4893
81 Ga0070694_100357140 3300005444 Unclassified 1134
82 Ga0070694_100775323 3300005444 Unclassified 785
83 Ga0070663_100640053 3300005455 Unclassified 898
84 Ga0070678_100064102 3300005456 Unclassified 2722
85 Ga0070678_100158896 3300005456 Unclassified 1829
86 Ga0070662_100088587 3300005457 Archaea 2320
87 Ga0070662_100310603 3300005457 Bacteria 1283
88 Ga0068867_100005805 3300005459 Bacteria 8757
89 Ga0070685_10162624 3300005466 Unclassified 1424
90 Ga0070707_100396057 3300005468 Bacteria 1341
91 Ga0070698_100009951 3300005471 Bacteria 10166
92 Ga0070698_100977811 3300005471 Unclassified 793
93 Ga0070699_100012987 3300005518 Bacteria 7176
94 Ga0070699_100027731 3300005518 Bacteria 4884
95 Ga0070679_100527877 3300005530 Unclassified 1124
96 Ga0070679_100890820 3300005530 Bacteria 833
97 Ga0070684_100000479 3300005535 Bacteria 27366
98 Ga0070684_100413088 3300005535 Bacteria 1245
99 Ga0068853_100491607 3300005539 Unclassified 1158
100 Ga0070672_100043908 3300005543 Unclassified 3450
101 Ga0070672_100160722 3300005543 Bacteria 1863
102 Ga0070672_100208728 3300005543 Bacteria 1635
103 Ga0070686_100015821 3300005544 Bacteria 4380
104 Ga0070686_100017736 3300005544 Unclassified 4166
105 Ga0070686_100017881 3300005544 Bacteria 4150
106 Ga0070695_100312809 3300005545 Bacteria 1165
107 Ga0070696_100146826 3300005546 Archaea 1728
108 Ga0070696_100163895 3300005546 Bacteria 1639
109 Ga0070693_100538853 3300005547 Unclassified 834
110 Ga0070665_100031212 3300005548 Bacteria 5363
111 Ga0070665_101147977 3300005548 Unclassified 788
112 Ga0070704_100001470 3300005549 Bacteria 12643
113 Ga0070704_100006326 3300005549 Bacteria 6976
114 Ga0070704_100015712 3300005549 Bacteria 4765
115 Ga0070704_100182418 3300005549 Bacteria 1680
116 Ga0068855_101007311 3300005563 Unclassified 875
117 Ga0070664_100000224 3300005564 Bacteria 40566
118 Ga0070664_100337048 3300005564 Bacteria 1369
119 Ga0070664_100509357 3300005564 Unclassified 1110
120 Ga0070664_100529458 3300005564 Bacteria 1088
121 Ga0068857_100004602 3300005577 Bacteria 11681
122 Ga0068857_100004763 3300005577 Bacteria 11490
123 Ga0068857_100044463 3300005577 Bacteria 3940
124 Ga0068854_100662665 3300005578 Unclassified 897
125 Ga0068856_100013428 3300005614 Bacteria 7930
126 Ga0070702_100045231 3300005615 Bacteria 2489
127 Ga0068859_100000433 3300005617 Bacteria 41951
128 Ga0068859_100000798 3300005617 Bacteria 31967
129 Ga0068859_100015181 3300005617 Bacteria 7731
130 Ga0068859_100062881 3300005617 Bacteria 3742
131 Ga0068859_100761657 3300005617 Unclassified 1057
132 Ga0068859_100848241 3300005617 Unclassified 1000
133 Ga0068859_101537039 3300005617 Unclassified 735
134 Ga0068859_102144960 3300005617 Unclassified 617
135 Ga0068864_100036386 3300005618 Bacteria 4196
136 Ga0068864_100042123 3300005618 Unclassified 3907
137 Ga0068864_100351717 3300005618 Unclassified 1390
138 Ga0068864_101368594 3300005618 Bacteria 709
139 Ga0068861_100000410 3300005719 Bacteria 24782
140 Ga0068861_101161007 3300005719 Unclassified 745
141 Ga0068870_10019235 3300005840 Unclassified 3310
142 Ga0068870_10043714 3300005840 Bacteria 2338
143 Ga0068870_10595939 3300005840 Unclassified 750
144 Ga0068870_10796930 3300005840 Unclassified 660
145 Ga0068863_100008826 3300005841 Bacteria 9845
146 Ga0068863_100024545 3300005841 Bacteria 5749
147 Ga0068863_100303900 3300005841 Bacteria 1548
148 Ga0068858_100009270 3300005842 Bacteria 9399
149 Ga0068858_100080818 3300005842 Bacteria 3021
150 Ga0068858_100095721 3300005842 Unclassified 2766
151 Ga0068858_100193047 3300005842 Unclassified 1924
152 Ga0068858_100482799 3300005842 Bacteria 1196
153 Ga0068860_100002194 3300005843 Bacteria 20537
154 Ga0068860_100160310 3300005843 Bacteria 2169
155 Ga0068860_101246694 3300005843 Unclassified 764
156 Ga0068862_100002592 3300005844 Bacteria 15960
157 Ga0081455_10061305 3300005937 Unclassified 3166
158 Ga0081455_10309608 3300005937 Bacteria 1129
159 Ga0075366_10505933 3300006195 Unclassified 747
160 Ga0097621_100087228 3300006237 Unclassified 2605
161 Ga0097621_100269936 3300006237 Unclassified 1494
162 Ga0068871_100353190 3300006358 Unclassified 1301
163 Ga0068871_100436145 3300006358 Bacteria 1172
164 Ga0068871_102335418 3300006358 Unclassified 510
165 Ga0075428_100019283 3300006844 Bacteria 7548
166 Ga0075428_100339156 3300006844 Unclassified 1614
167 Ga0075428_100652730 3300006844 Bacteria 1122
168 Ga0075428_101173985 3300006844 Unclassified 810
169 Ga0075428_101598658 3300006844 Unclassified 682
170 Ga0075430_100548634 3300006846 Bacteria 953
171 Ga0075431_100381713 3300006847 Unclassified 1413
172 Ga0075431_100384006 3300006847 Bacteria 1408
173 Ga0075433_10045029 3300006852 Bacteria 3834
174 Ga0075433_10089891 3300006852 Bacteria 2714
175 Ga0075433_10182879 3300006852 Unclassified 1865
176 Ga0075433_10234302 3300006852 Bacteria 1630
177 Ga0075433_10694074 3300006852 Unclassified 892
178 Ga0075434_100013394 3300006871 Bacteria 7802
179 Ga0075434_100081445 3300006871 Bacteria 3234
180 Ga0075434_100249579 3300006871 Bacteria 1794
181 Ga0075434_100270957 3300006871 Bacteria 1717
182 Ga0075434_101418807 3300006871 Bacteria 704
183 Ga0075429_100003426 3300006880 Bacteria 13527
184 Ga0075429_100132596 3300006880 Unclassified 2180
185 Ga0075429_100328555 3300006880 Bacteria 1338
186 Ga0075429_100958904 3300006880 Unclassified 748
187 Ga0068865_100219105 3300006881 Bacteria 1487
188 Ga0068865_100469302 3300006881 Unclassified 1044
189 Ga0097620_100000433 3300006931 Bacteria 41951
190 Ga0097620_100000798 3300006931 Bacteria 31967
191 Ga0097620_100015182 3300006931 Bacteria 7731
192 Ga0097620_100062882 3300006931 Bacteria 3742
193 Ga0097620_100761678 3300006931 Unclassified 1057
194 Ga0097620_100848306 3300006931 Unclassified 1000
195 Ga0097620_101536910 3300006931 Unclassified 735
196 Ga0097620_102144989 3300006931 Unclassified 617
197 Ga0075435_100087233 3300007076 Bacteria 2571
198 Ga0075435_100095462 3300007076 Bacteria 2459
199 Ga0105240_10303304 3300009093 Bacteria 1826
200 Ga0111539_10027564 3300009094 Bacteria 6938
201 Ga0111539_10032854 3300009094 Bacteria 6301
202 Ga0111539_10040795 3300009094 Bacteria 5585
203 Ga0111539_10194034 3300009094 Unclassified 2369
204 Ga0111539_10265851 3300009094 Bacteria 1997
205 Ga0111539_10470478 3300009094 Bacteria 1463
206 Ga0111539_10656559 3300009094 Unclassified 1221
207 Ga0105245_11110743 3300009098 Bacteria 837
208 Ga0114129_10004473 3300009147 Bacteria 19707
209 Ga0114129_10105684 3300009147 Bacteria 3890
210 Ga0114129_10336817 3300009147 Bacteria 2002
211 Ga0114129_10736005 3300009147 Bacteria 1264
212 Ga0114129_12287474 3300009147 Unclassified 649
213 Ga0105243_10020707 3300009148 Unclassified 4989
214 Ga0105243_10061887 3300009148 Unclassified 2995
215 Ga0105243_10465040 3300009148 Bacteria 1190
216 Ga0105243_11643903 3300009148 Unclassified 670
217 Ga0105241_10023260 3300009174 Bacteria 4595
218 Ga0105241_10234022 3300009174 Bacteria 1550
219 Ga0105242_10163510 3300009176 Bacteria 1950
220 Ga0105248_10212309 3300009177 Unclassified 2181
221 Ga0105248_10450946 3300009177 Unclassified 1449
222 Ga0105248_10787752 3300009177 Bacteria 1073
223 Ga0105237_10062111 3300009545 Bacteria 3735
224 Ga0105238_10158825 3300009551 Bacteria 2236
225 Ga0105249_10002389 3300009553 Bacteria 16296
226 Ga0105249_11045713 3300009553 Unclassified 886
227 Ga0105239_10006592 3300010375 Bacteria 13446
228 Ga0105246_10350923 3300011119 Unclassified 1209
229 Ga0157374_10124574 3300013296 Unclassified 2490
230 Ga0157374_10156025 3300013296 Unclassified 2221
231 Ga0157374_10680092 3300013296 Bacteria 1041
232 Ga0157374_11608174 3300013296 Unclassified 674
233 Ga0157378_10120473 3300013297 Unclassified 2418
234 Ga0157378_10124213 3300013297 Unclassified 2383
235 Ga0163162_10080403 3300013306 Unclassified 3327
236 Ga0163162_10774470 3300013306 Unclassified 1078
237 Ga0163162_11063583 3300013306 Unclassified 916
238 Ga0163162_11240843 3300013306 Unclassified 846
239 Ga0157375_10005046 3300013308 Bacteria 11463
240 Ga0157375_10082232 3300013308 Bacteria 3262
241 Ga0157375_10407230 3300013308 Bacteria 1526
242 Ga0157375_10652919 3300013308 Unclassified 1208
243 Ga0163163_10012751 3300014325 Bacteria 7668
244 Ga0163163_10031311 3300014325 Bacteria 5133
245 Ga0163163_10350949 3300014325 Bacteria 1531
246 Ga0157380_10009141 3300014326 Bacteria 7088
247 Ga0157380_10242903 3300014326 Bacteria 1625
248 Ga0157380_11442916 3300014326 Unclassified 740
249 Ga0182008_10008707 3300014497 Bacteria 5519
250 Ga0157377_10030046 3300014745 Bacteria 2940
251 Ga0157377_10055129 3300014745 Bacteria 2253
252 Ga0157379_10063954 3300014968 Unclassified 3289
253 Ga0157379_10745607 3300014968 Unclassified 922
254 Ga0157376_10284678 3300014969 Bacteria 1558
255 Ga0157376_10462285 3300014969 Unclassified 1240
256 Ga0207642_10180907 3300025899 Unclassified 1149
257 Ga0207680_10361278 3300025903 Unclassified 1021
258 Ga0207680_10468029 3300025903 Bacteria 896
259 Ga0207699_10252557 3300025906 Unclassified 1216
260 Ga0207645_10129073 3300025907 Bacteria 1645
261 Ga0207643_10021930 3300025908 Unclassified 3514
262 Ga0207643_10818658 3300025908 Unclassified 603
263 Ga0207654_10007936 3300025911 Bacteria 5353
264 Ga0207671_10046960 3300025914 Bacteria 3195
265 Ga0207660_10265018 3300025917 Unclassified 1360
266 Ga0207662_10015989 3300025918 Unclassified 4229
267 Ga0207662_10145980 3300025918 Unclassified 1502
268 Ga0207649_10011382 3300025920 Bacteria 4906
269 Ga0207652_10815989 3300025921 Bacteria 828
270 Ga0207646_10678010 3300025922 Unclassified 922
271 Ga0207681_10006926 3300025923 Bacteria 6955
272 Ga0207681_10170655 3300025923 Bacteria 1648
273 Ga0207681_10205691 3300025923 Bacteria 1514
274 Ga0207650_10035621 3300025925 Bacteria 3616
275 Ga0207650_10071451 3300025925 Unclassified 2611
276 Ga0207650_10122474 3300025925 Unclassified 2027
277 Ga0207650_10130150 3300025925 Unclassified 1968
278 Ga0207650_10314577 3300025925 Bacteria 1281
279 Ga0207650_10892687 3300025925 Unclassified 755
280 Ga0207659_10000770 3300025926 Bacteria 18992
281 Ga0207659_10002736 3300025926 Bacteria 10521
282 Ga0207659_10012559 3300025926 Bacteria 5393
283 Ga0207659_10031252 3300025926 Unclassified 3643
284 Ga0207659_10316852 3300025926 Bacteria 1285
285 Ga0207659_11180668 3300025926 Unclassified 658
286 Ga0207644_10015899 3300025931 Bacteria 5060
287 Ga0207706_10025310 3300025933 Bacteria 5319
288 Ga0207706_10142367 3300025933 Bacteria 2109
289 Ga0207706_10350575 3300025933 Bacteria 1284
290 Ga0207686_10558823 3300025934 Unclassified 896
291 Ga0207709_10159481 3300025935 Unclassified 1571
292 Ga0207709_10220619 3300025935 Unclassified 1367
293 Ga0207670_10010541 3300025936 Bacteria 5331
294 Ga0207670_10060926 3300025936 Bacteria 2573
295 Ga0207670_10098152 3300025936 Unclassified 2087
296 Ga0207670_10357511 3300025936 Bacteria 1158
297 Ga0207670_10564760 3300025936 Bacteria 931
298 Ga0207670_10684772 3300025936 Unclassified 848
299 Ga0207691_10027473 3300025940 Bacteria 5334
300 Ga0207691_10134701 3300025940 Bacteria 2180
301 Ga0207711_10064517 3300025941 Unclassified 3164
302 Ga0207711_10118958 3300025941 Unclassified 2357
303 Ga0207689_10089597 3300025942 Unclassified 2527
304 Ga0207689_10485344 3300025942 Bacteria 1035
305 Ga0207679_10006534 3300025945 Bacteria 7370
306 Ga0207679_10177531 3300025945 Unclassified 1759
307 Ga0207679_10497131 3300025945 Bacteria 1088
308 Ga0207679_11308111 3300025945 Unclassified 665
309 Ga0207667_10739093 3300025949 Unclassified 984
310 Ga0207667_11117062 3300025949 Unclassified 771
311 Ga0207651_10063719 3300025960 Bacteria 2576
312 Ga0207651_10066444 3300025960 Archaea 2534
313 Ga0207651_10181689 3300025960 Bacteria 1669
314 Ga0207651_10223885 3300025960 Bacteria 1523
315 Ga0207651_10347290 3300025960 Unclassified 1248
316 Ga0207651_10684851 3300025960 Unclassified 902
317 Ga0207651_10874895 3300025960 Unclassified 799
318 Ga0207712_10004314 3300025961 Bacteria 8979
319 Ga0207640_10343865 3300025981 Unclassified 1196
320 Ga0207658_10129666 3300025986 Unclassified 2024
321 Ga0207677_10403326 3300026023 Unclassified 1160
322 Ga0207677_10469562 3300026023 Bacteria 1082
323 Ga0207703_10019674 3300026035 Bacteria 5277
324 Ga0207703_10074719 3300026035 Unclassified 2807
325 Ga0207703_10090141 3300026035 Unclassified 2576
326 Ga0207703_10181006 3300026035 Bacteria 1860
327 Ga0207703_10603746 3300026035 Unclassified 1038
328 Ga0207678_10641558 3300026067 Unclassified 933
329 Ga0207708_10012999 3300026075 Bacteria 6210
330 Ga0207708_10171814 3300026075 Bacteria 1717
331 Ga0207708_10964025 3300026075 Unclassified 740
332 Ga0207702_10060059 3300026078 Unclassified 3240
333 Ga0207641_10005559 3300026088 Bacteria 10744
334 Ga0207641_10013677 3300026088 Bacteria 6659
335 Ga0207641_10256554 3300026088 Bacteria 1635
336 Ga0207641_10983816 3300026088 Unclassified 840
337 Ga0207648_10000835 3300026089 Bacteria 34699
338 Ga0207676_10005398 3300026095 Bacteria 9048
339 Ga0207676_10067593 3300026095 Bacteria 2855
340 Ga0207676_10234101 3300026095 Unclassified 1644
341 Ga0207676_11333095 3300026095 Unclassified 713
342 Ga0207674_10008418 3300026116 Bacteria 11914
343 Ga0207674_10051361 3300026116 Unclassified 4208
344 Ga0207674_10074590 3300026116 Bacteria 3404
345 Ga0207674_10190424 3300026116 Bacteria 2001
346 Ga0207675_100001637 3300026118 Bacteria 22454
347 Ga0207675_100308191 3300026118 Unclassified 1543
348 Ga0207683_10196133 3300026121 Unclassified 1835
349 Ga0207683_10250202 3300026121 Bacteria 1617
350 Ga0207683_10557739 3300026121 Bacteria 1059
351 Ga0207683_10692983 3300026121 Unclassified 944
352 Ga0207698_11263048 3300026142 Unclassified 753
353 Ga0209966_1029147 3300027695 Bacteria 1111
354 Ga0207428_10007529 3300027907 Bacteria 9921
355 Ga0207428_10017908 3300027907 Bacteria 6071
356 Ga0207428_10434271 3300027907 Bacteria 958
357 Ga0207428_10438167 3300027907 Unclassified 954
358 Ga0268266_10702925 3300028379 Bacteria 974
359 Ga0268265_10001817 3300028380 Bacteria 17054
360 Ga0268265_10150559 3300028380 Unclassified 1962
361 Ga0268265_11326346 3300028380 Unclassified 720
362 Ga0268264_10013880 3300028381 Bacteria 6624
363 Ga0268264_10797462 3300028381 Unclassified 943
364 Ga0265325_10032343 3300031241 Bacteria 2793
365 Ga0307416_100480102 3300032002 Unclassified 1303
366 Ga0307415_100820644 3300032126 Unclassified 851
367 Ga0373958_0103095 3300034819 Unclassified 672
368 Ga0373940_0127299 3300035088 Unclassified 795
369 Ga0373939_0034695 3300035114 Unclassified 1482
370 Ga0373939_0037632 3300035114 Unclassified 1438
371 Ga0373941_0121447 3300035115 Unclassified 932
372 Ga0373942_0115007 3300035207 Unclassified 835
373 Ga0373961_0107574 3300035241 Unclassified 910
374 Ga0373962_0266805 3300035242 Unclassified 599
375 Ga0373931_0109025 3300035691 Bacteria 1568
376 Ga0373931_0471889 3300035691 Unclassified 805
377 Ga0373931_1115098 3300035691 Unclassified 538
378 Ga0373935_0828832 3300035692 Unclassified 684
379 Ga0373927_0054818 3300035695 Bacteria 2579
380 Ga0373925_0866208 3300037068 Bacteria 745
381 Ga0439436_0043417 3300041404 Unclassified 1283
382 Ga0439436_0180364 3300041404 Unclassified 601
383 Ga0439453_0009502 3300041408 Bacteria 1586
384 Ga0439461_0040446 3300041410 Unclassified 1005
385 Ga0439433_0051680 3300041999 Unclassified 970
386 Ga0450898_107680 3300042134 Bacteria 587
387 Ga0439435_0037185 3300042436 Bacteria 1348
388 Ga0451577_0226523 3300042876 Bacteria 1690
389 Ga0451577_0619416 3300042876 Bacteria 982
390 Ga0453683_0351423 3300044673 Unclassified 947
391 Ga0451576_0005215 3300045051 Bacteria 16411
392 Ga0451576_0044829 3300045051 Unclassified 4659
393 Ga0451576_0070771 3300045051 Bacteria 3630
394 Ga0451576_0146163 3300045051 Unclassified 2465
395 Ga0451576_0295705 3300045051 Bacteria 1693
396 Ga0451576_0620729 3300045051 Unclassified 1136
397 Ga0451576_0933430 3300045051 Bacteria 910
398 Ga0451576_1659755 3300045051 Unclassified 662
399 Ga0495580_0143259 3300046472 Unclassified 1657
400 Ga0495580_0156359 3300046472 Bacteria 1579
401 Ga0495580_0238096 3300046472 Bacteria 1248
402 Ga0495582_0126677 3300046473 Bacteria 1441
403 Ga0495582_0312448 3300046473 Unclassified 904
404 Ga0495584_0311074 3300046491 Bacteria 800
405 Ga0495584_0325433 3300046491 Unclassified 781
406 Ga0495594_0006593 3300046499 Bacteria 5973
407 Ga0495594_0534863 3300046499 Unclassified 665
408 Ga0495630_0787489 3300046517 Unclassified 726
409 Ga0495663_0018268 3300046525 Unclassified 1996
410 Ga0495666_0240945 3300046526 Unclassified 825
411 Ga0495598_0104831 3300046537 Bacteria 940
412 Ga0495621_0003475 3300046539 Bacteria 4348
413 Ga0495621_0067042 3300046539 Unclassified 1314
414 Ga0495621_0161414 3300046539 Unclassified 886
415 Ga0495621_0219504 3300046539 Unclassified 769
416 Ga0495633_0180091 3300046558 Bacteria 973
417 Ga0495668_0257533 3300046616 Bacteria 955
418 Ga0495635_0025402 3300046663 Bacteria 4126
419 Ga0495659_0014502 3300046664 Bacteria 2580
420 Ga0495659_0110240 3300046664 Bacteria 1074
421 Ga0495659_0172628 3300046664 Bacteria 877
422 Ga0495658_0115588 3300046683 Bacteria 1617
423 Ga0495669_0010253 3300046684 Bacteria 3959
424 Ga0495613_0008197 3300046689 Bacteria 7762
425 Ga0495581_0300358 3300047315 Unclassified 938
426 Ga0495636_0046342 3300047318 Bacteria 1813
427 Ga0495636_0126588 3300047318 Bacteria 1134
428 Ga0495684_0316687 3300047471 Bacteria 1116
429 Ga0495614_0141589 3300048089 Unclassified 1069
430 Ga0495615_0003580 3300048090 Unclassified 2618
431 Ga0496100_1208252 3300048903 Unclassified 596
432 Ga0496101_0337195 3300048904 Unclassified 1184
433 Ga0496102_0780644 3300048905 Unclassified 878
434 Ga0496104_0070351 3300048907 Bacteria 3326
435 Ga0496105_0018911 3300048908 Bacteria 5549
436 Ga0496105_0535813 3300048908 Unclassified 916
437 Ga0496106_0124214 3300048909 Bacteria 2020
438 Ga0496106_0260457 3300048909 Bacteria 1388
439 Ga0496106_0827424 3300048909 Unclassified 734
440 Ga0496107_0740275 3300048910 Unclassified 722
441 Ga0496108_0010091 3300048911 Bacteria 7663
442 Ga0496108_0423589 3300048911 Bacteria 1163
443 Ga0496108_0790263 3300048911 Unclassified 819
444 Ga0496109_0001912 3300048912 Bacteria 17308
445 Ga0496109_0280632 3300048912 Bacteria 1570
446 Ga0496109_1485880 3300048912 Unclassified 613
447 Ga0496110_0001931 3300048913 Bacteria 15354
448 Ga0496110_0049047 3300048913 Bacteria 3703
449 Ga0496111_0006720 3300048914 Bacteria 7487
450 Ga0496111_0335506 3300048914 Bacteria 1119
451 Ga0496112_0001225 3300048915 Bacteria 19326
452 Ga0496112_1417732 3300048915 Unclassified 609
453 Ga0496113_0474947 3300048916 Unclassified 1005
454 Ga0496114_1211674 3300048917 Unclassified 641
455 Ga0496115_0102871 3300048918 Unclassified 2343
456 Ga0501040_0097927 3300049576 Bacteria 2044
457 Ga0501041_0285976 3300049577 Bacteria 1038
458 Ga0501046_0655589 3300049580 Unclassified 742
459 Ga0501071_0221702 3300049587 Unclassified 1423
460 Ga0501072_0167572 3300049588 Bacteria 1753
461 Ga0501072_0180189 3300049588 Bacteria 1685
462 Ga0501076_0161214 3300049592 Bacteria 1827
463 Ga0501076_0823293 3300049592 Bacteria 766
464 Ga0501076_0940321 3300049592 Unclassified 712
465 Ga0501217_148994 3300049661 Unclassified 698
466 Ga0501228_013915 3300049666 Unclassified 844
467 Ga0501249_047856 3300049679 Unclassified 978
468 Ga0501255_013500 3300049684 Bacteria 971
469 Ga0501256_010495 3300049685 Bacteria 885
470 Ga0501081_0092720 3300049743 Unclassified 2126
471 Ga0501081_0518242 3300049743 Unclassified 889
472 Ga0501265_056374 3300049762 Unclassified 631
473 Ga0501271_033103 3300049768 Bacteria 647
474 Ga0501276_007796 3300049773 Unclassified 862
475 Ga0501045_0796043 3300049824 Unclassified 696
476 nmdc:mga07m45_652593_c1 3300050496 Bacteria 606
477 nmdc:mga05p37_109336_c1 3300050507 Bacteria 3401
478 nmdc:mga05p37_1845264_c1 3300050507 Bacteria 581
479 nmdc:mga05p37_48_c1 3300050507 Bacteria 104863
480 nmdc:mga05p37_578625_c1 3300050507 Bacteria 1272
481 nmdc:mga09592_312380_c1 3300050508 Bacteria 1362
482 nmdc:mga09592_335156_c1 3300050508 Bacteria 1310
483 nmdc:mga09592_649796_c1 3300050508 Bacteria 900
484 nmdc:mga06r32_317197_c1 3300050510 Unclassified 1544
485 nmdc:mga06r32_660488_c1 3300050510 Bacteria 1013
486 nmdc:mga08y16_14177_c1 3300050511 Bacteria 8388
487 nmdc:mga08y16_324229_c1 3300050511 Bacteria 1585
488 nmdc:mga08y16_41946_c1 3300050511 Unclassified 4792
489 nmdc:mga08y16_447573_c1 3300050511 Bacteria 1317
490 nmdc:mga08y16_509981_c1 3300050511 Bacteria 1221
491 nmdc:mga08y16_815807_c1 3300050511 Bacteria 925
492 nmdc:mga08y16_825751_c1 3300050511 Bacteria 918
493 nmdc:mga08y16_9646_c1 3300050511 Bacteria 10137
494 nmdc:mga0n895_235974_c1 3300050512 Bacteria 1856
495 nmdc:mga0n895_342004_c1 3300050512 Bacteria 1515
496 nmdc:mga0n895_5270_c1 3300050512 Bacteria 10271
497 nmdc:mga0n895_581688_c1 3300050512 Unclassified 1123
498 nmdc:mga0n895_59800_c1 3300050512 Bacteria 3760
499 nmdc:mga0n895_758334_c1 3300050512 Unclassified 963
500 nmdc:mga0rr50_17008_c1 3300050513 Bacteria 4844
501 nmdc:mga0rr50_203056_c1 3300050513 Bacteria 1629
502 nmdc:mga0a205_17976_c1 3300050515 Bacteria 6639
503 nmdc:mga0a205_24686_c1 3300050515 Bacteria 5719
504 nmdc:mga0a205_270454_c1 3300050515 Bacteria 1576
505 Ga0495601_0035163 3300053077 Bacteria 3126
506 Ga0495619_0472777 3300053085 Bacteria 863
507 Ga0590071_000079 3300059421 Bacteria 26516
508 Ga0590074_000280 3300059423 Bacteria 6888
509 Ga0590075_000048 3300059424 Bacteria 31197
510 Ga0590077_000030 3300059426 Bacteria 33448
511 Ga0111539_10072489
512 SwRhRL2b_contig_3088676
513 Ga0065704_10090590
514 Ga0065704_10133022
515 Ga0065704_10205014
516 Ga0065704_10369352
517 Ga0065704_10805525
518 Ga0065712_10076400
519 Ga0065712_10077821
520 Ga0065712_10135983
521 Ga0065712_10206312
522 Ga0065712_10230908
523 Ga0065715_10035530
524 Ga0065715_10114683
525 Ga0065715_10192838
526 Ga0065715_11039474
527 Ga0065707_10002467
528 Ga0065707_10090251
529 Ga0065707_10112338
530 Ga0065707_10119449
531 Ga0065707_10181474
532 Ga0070676_10124225
533 Ga0070676_10161421
534 Ga0070676_10182179
535 Ga0070683_100012348
536 Ga0070690_100038567
537 Ga0070690_100062898
538 Ga0070690_100112222
539 Ga0070670_100009539
540 Ga0070670_100049097
541 Ga0070670_100082507
542 Ga0070670_100223008
543 Ga0068869_100024646
544 Ga0070666_10647351
545 Ga0070680_100344312
546 Ga0070680_100715597
547 Ga0070680_101172955
548 Ga0070682_100247141
549 Ga0068868_100498629
550 Ga0068868_100977664
551 Ga0070689_100020229
552 Ga0070689_100044284
553 Ga0070689_100074187
554 Ga0070689_100149752
555 Ga0070689_100854302
556 Ga0070687_100006294
557 Ga0070687_100014411
558 Ga0070687_100194129
559 Ga0070661_100018541
560 Ga0070669_100005982
561 Ga0070669_100228836
562 Ga0070669_100308479
563 Ga0070675_100000986
564 Ga0070675_100002041
565 Ga0070675_100018445
566 Ga0070675_100106288
567 Ga0070675_100168866
568 Ga0070671_100007092
569 Ga0070671_100038808
570 Ga0070671_100731953
571 Ga0070673_100003385
572 Ga0070673_100052842
573 Ga0070673_101378274
574 Ga0070673_101422655
575 Ga0070688_100292761
576 Ga0070688_100340371
577 Ga0070667_100329593
578 Ga0070709_10310538
579 Ga0070713_101658390
580 Ga0070701_10005894
581 Ga0070701_10007601
582 Ga0070701_10106543
583 Ga0070705_100048143
584 Ga0070705_100096623
585 Ga0070705_100108218
586 Ga0070705_100162700
587 Ga0070700_100008129
588 Ga0070700_100582763
589 Ga0070694_100004550
590 Ga0070694_100014770
591 Ga0070694_100357140
592 Ga0070694_100775323
593 Ga0070663_100640053
594 Ga0070678_100064102
595 Ga0070678_100158896
596 Ga0070662_100088587
597 Ga0070662_100310603
598 Ga0068867_100005805
599 Ga0070685_10162624
600 Ga0070707_100396057
601 Ga0070698_100009951
602 Ga0070698_100977811
603 Ga0070699_100012987
604 Ga0070699_100027731
605 Ga0070679_100527877
606 Ga0070679_100890820
607 Ga0070684_100000479
608 Ga0070684_100413088
609 Ga0068853_100491607
610 Ga0070672_100043908
611 Ga0070672_100160722
612 Ga0070672_100208728
613 Ga0070686_100015821
614 Ga0070686_100017736
615 Ga0070686_100017881
616 Ga0070695_100312809
617 Ga0070696_100146826
618 Ga0070696_100163895
619 Ga0070693_100538853
620 Ga0070665_100031212
621 Ga0070665_101147977
622 Ga0070704_100001470
623 Ga0070704_100006326
624 Ga0070704_100015712
625 Ga0070704_100182418
626 Ga0068855_101007311
627 Ga0070664_100000224
628 Ga0070664_100337048
629 Ga0070664_100509357
630 Ga0070664_100529458
631 Ga0068857_100004602
632 Ga0068857_100004763
633 Ga0068857_100044463
634 Ga0068854_100662665
635 Ga0068856_100013428
636 Ga0070702_100045231
637 Ga0068859_100000433
638 Ga0068859_100000798
639 Ga0068859_100015181
640 Ga0068859_100062881
641 Ga0068859_100761657
642 Ga0068859_100848241
643 Ga0068859_101537039
644 Ga0068859_102144960
645 Ga0068864_100036386
646 Ga0068864_100042123
647 Ga0068864_100351717
648 Ga0068864_101368594
649 Ga0068861_100000410
650 Ga0068861_101161007
651 Ga0068870_10019235
652 Ga0068870_10043714
653 Ga0068870_10595939
654 Ga0068870_10796930
655 Ga0068863_100008826
656 Ga0068863_100024545
657 Ga0068863_100303900
658 Ga0068858_100009270
659 Ga0068858_100080818
660 Ga0068858_100095721
661 Ga0068858_100193047
662 Ga0068858_100482799
663 Ga0068860_100002194
664 Ga0068860_100160310
665 Ga0068860_101246694
666 Ga0068862_100002592
667 Ga0081455_10061305
668 Ga0081455_10309608
669 Ga0075366_10505933
670 Ga0097621_100087228
671 Ga0097621_100269936
672 Ga0068871_100353190
673 Ga0068871_100436145
674 Ga0068871_102335418
675 Ga0075428_100019283
676 Ga0075428_100339156
677 Ga0075428_100652730
678 Ga0075428_101173985
679 Ga0075428_101598658
680 Ga0075430_100548634
681 Ga0075431_100381713
682 Ga0075431_100384006
683 Ga0075433_10045029
684 Ga0075433_10089891
685 Ga0075433_10182879
686 Ga0075433_10234302
687 Ga0075433_10694074
688 Ga0075434_100013394
689 Ga0075434_100081445
690 Ga0075434_100249579
691 Ga0075434_100270957
692 Ga0075434_101418807
693 Ga0075429_100003426
694 Ga0075429_100132596
695 Ga0075429_100328555
696 Ga0075429_100958904
697 Ga0068865_100219105
698 Ga0068865_100469302
699 Ga0097620_100000433
700 Ga0097620_100000798
701 Ga0097620_100015182
702 Ga0097620_100062882
703 Ga0097620_100761678
704 Ga0097620_100848306
705 Ga0097620_101536910
706 Ga0097620_102144989
707 Ga0075435_100087233
708 Ga0075435_100095462
709 Ga0105240_10303304
710 Ga0111539_10027564
711 Ga0111539_10032854
712 Ga0111539_10040795
713 Ga0111539_10194034
714 Ga0111539_10265851
715 Ga0111539_10470478
716 Ga0111539_10656559
717 Ga0105245_11110743
718 Ga0114129_10004473
719 Ga0114129_10105684
720 Ga0114129_10336817
721 Ga0114129_10736005
722 Ga0114129_12287474
723 Ga0105243_10020707
724 Ga0105243_10061887
725 Ga0105243_10465040
726 Ga0105243_11643903
727 Ga0105241_10023260
728 Ga0105241_10234022
729 Ga0105242_10163510
730 Ga0105248_10212309
731 Ga0105248_10450946
732 Ga0105248_10787752
733 Ga0105237_10062111
734 Ga0105238_10158825
735 Ga0105249_10002389
736 Ga0105249_11045713
737 Ga0105239_10006592
738 Ga0105246_10350923
739 Ga0157374_10124574
740 Ga0157374_10156025
741 Ga0157374_10680092
742 Ga0157374_11608174
743 Ga0157378_10120473
744 Ga0157378_10124213
745 Ga0163162_10080403
746 Ga0163162_10774470
747 Ga0163162_11063583
748 Ga0163162_11240843
749 Ga0157375_10005046
750 Ga0157375_10082232
751 Ga0157375_10407230
752 Ga0157375_10652919
753 Ga0163163_10012751
754 Ga0163163_10031311
755 Ga0163163_10350949
756 Ga0157380_10009141
757 Ga0157380_10242903
758 Ga0157380_11442916
759 Ga0182008_10008707
760 Ga0157377_10030046
761 Ga0157377_10055129
762 Ga0157379_10063954
763 Ga0157379_10745607
764 Ga0157376_10284678
765 Ga0157376_10462285
766 Ga0207642_10180907
767 Ga0207680_10361278
768 Ga0207680_10468029
769 Ga0207699_10252557
770 Ga0207645_10129073
771 Ga0207643_10021930
772 Ga0207643_10818658
773 Ga0207654_10007936
774 Ga0207671_10046960
775 Ga0207660_10265018
776 Ga0207662_10015989
777 Ga0207662_10145980
778 Ga0207649_10011382
779 Ga0207652_10815989
780 Ga0207646_10678010
781 Ga0207681_10006926
782 Ga0207681_10170655
783 Ga0207681_10205691
784 Ga0207650_10035621
785 Ga0207650_10071451
786 Ga0207650_10122474
787 Ga0207650_10130150
788 Ga0207650_10314577
789 Ga0207650_10892687
790 Ga0207659_10000770
791 Ga0207659_10002736
792 Ga0207659_10012559
793 Ga0207659_10031252
794 Ga0207659_10316852
795 Ga0207659_11180668
796 Ga0207644_10015899
797 Ga0207706_10025310
798 Ga0207706_10142367
799 Ga0207706_10350575
800 Ga0207686_10558823
801 Ga0207709_10159481
802 Ga0207709_10220619
803 Ga0207670_10010541
804 Ga0207670_10060926
805 Ga0207670_10098152
806 Ga0207670_10357511
807 Ga0207670_10564760
808 Ga0207670_10684772
809 Ga0207691_10027473
810 Ga0207691_10134701
811 Ga0207711_10064517
812 Ga0207711_10118958
813 Ga0207689_10089597
814 Ga0207689_10485344
815 Ga0207679_10006534
816 Ga0207679_10177531
817 Ga0207679_10497131
818 Ga0207679_11308111
819 Ga0207667_10739093
820 Ga0207667_11117062
821 Ga0207651_10063719
822 Ga0207651_10066444
823 Ga0207651_10181689
824 Ga0207651_10223885
825 Ga0207651_10347290
826 Ga0207651_10684851
827 Ga0207651_10874895
828 Ga0207712_10004314
829 Ga0207640_10343865
830 Ga0207658_10129666
831 Ga0207677_10403326
832 Ga0207677_10469562
833 Ga0207703_10019674
834 Ga0207703_10074719
835 Ga0207703_10090141
836 Ga0207703_10181006
837 Ga0207703_10603746
838 Ga0207678_10641558
839 Ga0207708_10012999
840 Ga0207708_10171814
841 Ga0207708_10964025
842 Ga0207702_10060059
843 Ga0207641_10005559
844 Ga0207641_10013677
845 Ga0207641_10256554
846 Ga0207641_10983816
847 Ga0207648_10000835
848 Ga0207676_10005398
849 Ga0207676_10067593
850 Ga0207676_10234101
851 Ga0207676_11333095
852 Ga0207674_10008418
853 Ga0207674_10051361
854 Ga0207674_10074590
855 Ga0207674_10190424
856 Ga0207675_100001637
857 Ga0207675_100308191
858 Ga0207683_10196133
859 Ga0207683_10250202
860 Ga0207683_10557739
861 Ga0207683_10692983
862 Ga0207698_11263048
863 Ga0209966_1029147
864 Ga0207428_10007529
865 Ga0207428_10017908
866 Ga0207428_10434271
867 Ga0207428_10438167
868 Ga0268266_10702925
869 Ga0268265_10001817
870 Ga0268265_10150559
871 Ga0268265_11326346
872 Ga0268264_10013880
873 Ga0268264_10797462
874 Ga0265325_10032343
875 Ga0307416_100480102
876 Ga0307415_100820644
877 Ga0373958_0103095
878 Ga0373940_0127299
879 Ga0373939_0034695
880 Ga0373939_0037632
881 Ga0373941_0121447
882 Ga0373942_0115007
883 Ga0373961_0107574
884 Ga0373962_0266805
885 Ga0373931_0109025
886 Ga0373931_0471889
887 Ga0373931_1115098
888 Ga0373935_0828832
889 Ga0373927_0054818
890 Ga0373925_0866208
891 Ga0439436_0043417
892 Ga0439436_0180364
893 Ga0439453_0009502
894 Ga0439461_0040446
895 Ga0439433_0051680
896 Ga0450898_107680
897 Ga0439435_0037185
898 Ga0451577_0226523
899 Ga0451577_0619416
900 Ga0453683_0351423
901 Ga0451576_0005215
902 Ga0451576_0044829
903 Ga0451576_0070771
904 Ga0451576_0146163
905 Ga0451576_0295705
906 Ga0451576_0620729
907 Ga0451576_0933430
908 Ga0451576_1659755
909 Ga0495580_0143259
910 Ga0495580_0156359
911 Ga0495580_0238096
912 Ga0495582_0126677
913 Ga0495582_0312448
914 Ga0495584_0311074
915 Ga0495584_0325433
916 Ga0495594_0006593
917 Ga0495594_0534863
918 Ga0495630_0787489
919 Ga0495663_0018268
920 Ga0495666_0240945
921 Ga0495598_0104831
922 Ga0495621_0003475
923 Ga0495621_0067042
924 Ga0495621_0161414
925 Ga0495621_0219504
926 Ga0495633_0180091
927 Ga0495668_0257533
928 Ga0495635_0025402
929 Ga0495659_0014502
930 Ga0495659_0110240
931 Ga0495659_0172628
932 Ga0495658_0115588
933 Ga0495669_0010253
934 Ga0495613_0008197
935 Ga0495581_0300358
936 Ga0495636_0046342
937 Ga0495636_0126588
938 Ga0495684_0316687
939 Ga0495614_0141589
940 Ga0495615_0003580
941 Ga0496100_1208252
942 Ga0496101_0337195
943 Ga0496102_0780644
944 Ga0496104_0070351
945 Ga0496105_0018911
946 Ga0496105_0535813
947 Ga0496106_0124214
948 Ga0496106_0260457
949 Ga0496106_0827424
950 Ga0496107_0740275
951 Ga0496108_0010091
952 Ga0496108_0423589
953 Ga0496108_0790263
954 Ga0496109_0001912
955 Ga0496109_0280632
956 Ga0496109_1485880
957 Ga0496110_0001931
958 Ga0496110_0049047
959 Ga0496111_0006720
960 Ga0496111_0335506
961 Ga0496112_0001225
962 Ga0496112_1417732
963 Ga0496113_0474947
964 Ga0496114_1211674
965 Ga0496115_0102871
966 Ga0501040_0097927
967 Ga0501041_0285976
968 Ga0501046_0655589
969 Ga0501071_0221702
970 Ga0501072_0167572
971 Ga0501072_0180189
972 Ga0501076_0161214
973 Ga0501076_0823293
974 Ga0501076_0940321
975 Ga0501217_148994
976 Ga0501228_013915
977 Ga0501249_047856
978 Ga0501255_013500
979 Ga0501256_010495
980 Ga0501081_0092720
981 Ga0501081_0518242
982 Ga0501265_056374
983 Ga0501271_033103
984 Ga0501276_007796
985 Ga0501045_0796043
986 nmdc:mga07m45_652593_c1
987 nmdc:mga05p37_109336_c1
988 nmdc:mga05p37_1845264_c1
989 nmdc:mga05p37_48_c1
990 nmdc:mga05p37_578625_c1
991 nmdc:mga09592_312380_c1
992 nmdc:mga09592_335156_c1
993 nmdc:mga09592_649796_c1
994 nmdc:mga06r32_317197_c1
995 nmdc:mga06r32_660488_c1
996 nmdc:mga08y16_14177_c1
997 nmdc:mga08y16_324229_c1
998 nmdc:mga08y16_41946_c1
999 nmdc:mga08y16_447573_c1
1000 nmdc:mga08y16_509981_c1
1001 nmdc:mga08y16_815807_c1
1002 nmdc:mga08y16_825751_c1
1003 nmdc:mga08y16_9646_c1
1004 nmdc:mga0n895_235974_c1
1005 nmdc:mga0n895_342004_c1
1006 nmdc:mga0n895_5270_c1
1007 nmdc:mga0n895_581688_c1
1008 nmdc:mga0n895_59800_c1
1009 nmdc:mga0n895_758334_c1
1010 nmdc:mga0rr50_17008_c1
1011 nmdc:mga0rr50_203056_c1
1012 nmdc:mga0a205_17976_c1
1013 nmdc:mga0a205_24686_c1
1014 nmdc:mga0a205_270454_c1
1015 Ga0495601_0035163
1016 Ga0495619_0472777
1017 Ga0590071_000079
1018 Ga0590074_000280
1019 Ga0590075_000048
1020 Ga0590077_000030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

49

171

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.9052 17 128
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8951 1 117
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8926 1 130
3q9u-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8857 2 104
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.8629 1 135
ID Description Score Start End Superfamily
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9052 17 128 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8951 1 117 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8562 5 133 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8374 17 142 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8248 17 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V4HC14-F1-model_v4 CoA-binding protein 0.9622 4 156
AF-A0A849M667-F1-model_v4 CoA-binding protein 0.9605 7 156
AF-A0A660TNN4-F1-model_v4 CoA-binding protein 0.9587 6 138
AF-A0A6H9L9M6-F1-model_v4 CoA-binding protein 0.9546 1 160
AF-A0A1G0PHE0-F1-model_v4 CoA-binding domain-containing protein 0.9533 3 160

Map