F457232

General Info

Members Datasets Scaffolds Average Seq Length
511 255 1023 271

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1009273|JGI25160J50197_10092735
Length 299
Sequence MQPFGLSNLFSKNLSGDPFSLNILSFNMQHQEFEAPEELRDTIKCFWHNTKDFGEQPTGFEVVPDGYAEIIFHFGGPCSISYNGDLQPLPSPFMVGLLNQPVTFYTKNRLEIIGIRCFPWTVFDLLGLPSGKGGIHVFEHPVAQLQSTLNNYIQAGRIEEAIARVKQYFLDARSRIPADSMLFKAGVAMREANGSMPVSQVAAAAHATVRTLERKFKQSSGHTVKDVSALIRFEQVRNQLWHHPDSNIAGLAHEFGYTDQSHLSREFKRYSGTTPAAFARKAKKGQQAVSNDFVAFVQA

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
207 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
217 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
223 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
224 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
225 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
226 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
227 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
228 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
229 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
230 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
231 2738541297 Duganella sp. GV083 Isolate Unclassified
232 2738541357 Duganella sp. GV053 Isolate Unclassified
233 2738543003 Duganella sp. GV066 Isolate Unclassified
234 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
235 2738543026 Duganella sp. GV089 Isolate Unclassified
236 2738543029 Duganella sp. GV039 Isolate Unclassified
237 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
238 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
239 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
240 2821131069 Duganella sp. 1224 Isolate Unclassified
241 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
242 2857564685 Duganella sp. R-74599 Isolate Unclassified
243 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
244 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
245 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
246 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
247 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
248 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
249 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
250 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
251 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
252 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
253 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
254 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
255 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.54
Metatranscriptomes 0
Isolates 6.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 17.61
Nodule 0.2
Rhizoplane 0.98
Rhizosphere 65.56
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1009273 3300003354 Bacteria 3668
2 SwRhRL2b_contig_1307791 2162886007 Bacteria 24587
3 JGI24740J21852_10000062 3300001979 Bacteria 34499
4 JGI24739J22299_10002811 3300001989 Bacteria 6678
5 JGI25154J39366_1000002 3300002738 Bacteria 466942
6 JGI25157J39369_1005255 3300002741 Bacteria 2141
7 JGI25164J39214_1001595 3300002772 Bacteria 4816
8 JGI25150J39212_1001017 3300002774 Bacteria 8666
9 JGI25165J46597_1010484 3300003214 Bacteria 1350
10 JGI25153J46596_10000384 3300003215 Bacteria 30265
11 JGI25153J46596_10014223 3300003215 Bacteria 3321
12 JGI25153J46596_10022943 3300003215 Bacteria 2287
13 rootH1_10126934 3300003316 Bacteria 8956
14 rootH2_10074764 3300003320 Bacteria 8884
15 rootH2_10079932 3300003320 Bacteria 1666
16 rootL2_10005831 3300003322 Bacteria 16353
17 rootL2_10013757 3300003322 Bacteria 18134
18 rootL2_10017887 3300003322 Bacteria 42366
19 rootL2_10036291 3300003322 Bacteria 6749
20 rootL2_10080924 3300003322 Bacteria 1842
21 rootL2_10082227 3300003322 Bacteria 4290
22 rootL2_10189610 3300003322 Bacteria 3726
23 rootH1_10000721 3300003323 Bacteria 11866
24 rootH1_10002777 3300003323 Bacteria 45345
25 rootH1_10013386 3300003316 Bacteria 3606
26 rootH1_10013386 3300003323 Bacteria 42758
27 rootH1_10013560 3300003323 Bacteria 12771
28 rootH1_10014858 3300003323 Bacteria 9065
29 rootH1_10033914 3300003323 Bacteria 3198
30 rootH1_10090846 3300003323 Bacteria 3033
31 rootH1_10118321 3300003323 Bacteria 2917
32 JGI25160J50197_1007512 3300003354 Bacteria 4256
33 JGI25160J50197_1008778 3300003354 Bacteria 3818
34 JGI25160J50197_1010057 3300003354 Bacteria 3454
35 Ga0055535_1006028 3300003761 Bacteria 2534
36 Ga0055529_1000125 3300003763 Bacteria 110810
37 Ga0055526_1010976 3300003771 Bacteria 4142
38 Ga0055528_1000179 3300003790 Bacteria 53605
39 Ga0055530_10004552 3300003791 Bacteria 7083
40 Ga0055531_10000110 3300003794 Bacteria 89725
41 Ga0065165_1000280 3300005262 Bacteria 87088
42 Ga0065165_1000748 3300005262 Bacteria 44623
43 Ga0065165_1024992 3300005262 Bacteria 1996
44 Ga0065714_10002527 3300005288 Bacteria 43361
45 Ga0065714_10008921 3300005288 Bacteria 3585
46 Ga0065704_10000217 3300005289 Bacteria 101781
47 Ga0070676_10002644 3300005328 Bacteria 9227
48 Ga0070683_100016555 3300005329 Bacteria 6505
49 Ga0070683_100096793 3300005329 Bacteria 2776
50 Ga0070680_100001415 3300005336 Bacteria 17343
51 Ga0070682_100000973 3300005337 Bacteria 16612
52 Ga0070682_100001169 3300005337 Bacteria 14977
53 Ga0068868_100061196 3300005338 Bacteria 2982
54 Ga0070660_100190973 3300005339 Bacteria 1659
55 Ga0070691_10010433 3300005341 Bacteria 4239
56 Ga0070668_100114464 3300005347 Bacteria 2149
57 Ga0070673_100007295 3300005364 Bacteria 7279
58 Ga0070688_100176527 3300005365 Bacteria 1478
59 Ga0070659_100101329 3300005366 Bacteria 2318
60 Ga0070678_100011291 3300005456 Bacteria 5503
61 Ga0070681_10105205 3300005458 Bacteria 2764
62 Ga0070681_10273311 3300005458 Bacteria 1601
63 Ga0068867_100004580 3300005459 Bacteria 9723
64 Ga0070679_100006480 3300005530 Bacteria 10911
65 Ga0070684_100008751 3300005535 Bacteria 7938
66 Ga0068853_100000817 3300005539 Bacteria 21716
67 Ga0068853_100070810 3300005539 Bacteria 3036
68 Ga0068853_100211928 3300005539 Bacteria 1766
69 Ga0068853_100304472 3300005539 Bacteria 1474
70 Ga0070672_100415694 3300005543 Bacteria 1154
71 Ga0070665_100003229 3300005548 Bacteria 17523
72 Ga0068855_100002223 3300005563 Bacteria 24009
73 Ga0068855_100019032 3300005563 Bacteria 8254
74 Ga0068855_100056989 3300005563 Bacteria 4581
75 Ga0068855_100066909 3300005563 Bacteria 4188
76 Ga0068855_100446155 3300005563 Bacteria 1412
77 Ga0070664_100174820 3300005564 Bacteria 1906
78 Ga0068857_100051473 3300005577 Bacteria 3654
79 Ga0068857_100091819 3300005577 Bacteria 2718
80 Ga0068854_100110888 3300005578 Bacteria 2069
81 Ga0068856_100035450 3300005614 Bacteria 4890
82 Ga0068856_100133381 3300005614 Bacteria 2489
83 Ga0068856_100297456 3300005614 Bacteria 1631
84 Ga0068856_100671036 3300005614 Bacteria 1057
85 Ga0068852_100000832 3300005616 Bacteria 20414
86 Ga0068852_100028659 3300005616 Bacteria 4562
87 Ga0068852_100324414 3300005616 Bacteria 1496
88 Ga0068860_100111232 3300005843 Bacteria 2619
89 Ga0075366_10073371 3300006195 Bacteria 2040
90 Ga0097621_100000738 3300006237 Bacteria 22914
91 Ga0068871_100000248 3300006358 Bacteria 37581
92 Ga0068871_100234326 3300006358 Bacteria 1594
93 Ga0068865_100000211 3300006881 Bacteria 32506
94 Ga0105244_10000050 3300009036 Bacteria 138868
95 Ga0105240_10000020 3300009093 Bacteria 399699
96 Ga0105240_10000242 3300009093 Bacteria 108001
97 Ga0105240_10000339 3300009093 Bacteria 87543
98 Ga0105240_10000723 3300009093 Bacteria 60353
99 Ga0105240_10006096 3300009093 Bacteria 17790
100 Ga0105240_10009547 3300009093 Bacteria 13736
101 Ga0105240_10040927 3300009093 Bacteria 5920
102 Ga0105240_10053210 3300009093 Bacteria 5083
103 Ga0105240_10057857 3300009093 Bacteria 4840
104 Ga0105240_10278783 3300009093 Bacteria 1921
105 Ga0105240_10320667 3300009093 Bacteria 1766
106 Ga0105240_10599646 3300009093 Bacteria 1213
107 Ga0114129_10075616 3300009147 Bacteria 4689
108 Ga0105241_10006704 3300009174 Bacteria 8474
109 Ga0105241_10011398 3300009174 Bacteria 6518
110 Ga0105241_10016999 3300009174 Bacteria 5339
111 Ga0105241_10113711 3300009174 Bacteria 2170
112 Ga0105241_10248965 3300009174 Bacteria 1506
113 Ga0105242_10017185 3300009176 Bacteria 5632
114 Ga0105248_10814019 3300009177 Bacteria 1054
115 Ga0105237_10000037 3300009545 Bacteria 190855
116 Ga0105237_10000083 3300009545 Bacteria 127032
117 Ga0105237_10000798 3300009545 Bacteria 43129
118 Ga0105237_10000950 3300009545 Bacteria 38941
119 Ga0105237_10001842 3300009545 Bacteria 27258
120 Ga0105237_10015909 3300009545 Bacteria 7822
121 Ga0105237_10017083 3300009545 Bacteria 7528
122 Ga0105237_10041649 3300009545 Bacteria 4631
123 Ga0105237_10080783 3300009545 Bacteria 3241
124 Ga0105237_10083531 3300009545 Bacteria 3185
125 Ga0105237_10088058 3300009545 Bacteria 3094
126 Ga0105237_10106774 3300009545 Bacteria 2792
127 Ga0105237_10845118 3300009545 Bacteria 922
128 Ga0105238_10000678 3300009551 Bacteria 35832
129 Ga0105238_10023729 3300009551 Bacteria 6251
130 Ga0105238_10057429 3300009551 Bacteria 3902
131 Ga0105238_10526227 3300009551 Bacteria 1185
132 Ga0105239_10000001 3300010375 Bacteria 617353
133 Ga0105239_10000064 3300010375 Bacteria 151674
134 Ga0105239_10000098 3300010375 Bacteria 120504
135 Ga0105239_10000430 3300010375 Bacteria 61162
136 Ga0105239_10003355 3300010375 Bacteria 19676
137 Ga0105239_10014209 3300010375 Bacteria 8836
138 Ga0105239_10055274 3300010375 Bacteria 4354
139 Ga0105239_10447821 3300010375 Bacteria 1464
140 Ga0157373_10000041 3300013100 Bacteria 113871
141 Ga0157371_10001078 3300013102 Bacteria 29528
142 Ga0157371_10013877 3300013102 Bacteria 6103
143 Ga0157371_10069577 3300013102 Bacteria 2492
144 Ga0157370_10000166 3300013104 Bacteria 81040
145 Ga0157370_10000973 3300013104 Bacteria 36273
146 Ga0157370_10023228 3300013104 Bacteria 6159
147 Ga0157370_10040449 3300013104 Bacteria 4501
148 Ga0157370_10129135 3300013104 Bacteria 2358
149 Ga0157370_10506410 3300013104 Bacteria 1109
150 Ga0157370_10506416 3300013104 Bacteria 1109
151 Ga0157369_10071663 3300013105 Bacteria 3719
152 Ga0157374_10000002 3300013296 Bacteria 1054226
153 Ga0157374_10041848 3300013296 Bacteria 4224
154 Ga0157374_10293266 3300013296 Bacteria 1608
155 Ga0157374_10319335 3300013296 Bacteria 1539
156 Ga0157378_10046351 3300013297 Bacteria 3864
157 Ga0163162_10021278 3300013306 Bacteria 6384
158 Ga0163162_10048512 3300013306 Bacteria 4255
159 Ga0163162_10225752 3300013306 Bacteria 2003
160 Ga0163162_10307983 3300013306 Bacteria 1716
161 Ga0163162_10711353 3300013306 Bacteria 1126
162 Ga0157372_10000539 3300013307 Bacteria 41692
163 Ga0157372_10017728 3300013307 Bacteria 7643
164 Ga0157372_10731272 3300013307 Bacteria 1151
165 Ga0157375_10000871 3300013308 Bacteria 26276
166 Ga0157375_10046228 3300013308 Bacteria 4242
167 Ga0157375_10444537 3300013308 Bacteria 1462
168 Ga0163163_10062433 3300014325 Bacteria 3692
169 Ga0163163_10676189 3300014325 Bacteria 1096
170 Ga0157376_10000893 3300014969 Bacteria 19513
171 Ga0157376_10106515 3300014969 Bacteria 2460
172 Ga0163161_10000391 3300017792 Bacteria 36781
173 Ga0163161_10001437 3300017792 Bacteria 17579
174 Ga0163161_10005491 3300017792 Bacteria 8792
175 Ga0163161_10156876 3300017792 Bacteria 1733
176 Ga0213872_10001273 3300021361 Bacteria 16910
177 Ga0213872_10045334 3300021361 Bacteria 2000
178 Ga0207427_100113 3300025231 Bacteria 107320
179 Ga0209437_100010 3300025233 Bacteria 838447
180 Ga0209437_110449 3300025233 Bacteria 1418
181 Ga0209258_100116 3300025242 Bacteria 190317
182 Ga0207425_1000507 3300025245 Bacteria 24102
183 Ga0209646_1000005 3300025246 Bacteria 717627
184 Ga0209646_1012531 3300025246 Bacteria 1300
185 Ga0209026_1000232 3300025250 Bacteria 75219
186 Ga0209148_1000251 3300025254 Bacteria 85638
187 Ga0209148_1000466 3300025254 Bacteria 43177
188 Ga0209233_1000017 3300025261 Bacteria 898076
189 Ga0209455_1000044 3300025272 Bacteria 410787
190 Ga0209455_1004245 3300025272 Bacteria 4770
191 Ga0209673_1000014 3300025273 Bacteria 537082
192 Ga0209673_1000018 3300025273 Bacteria 458281
193 Ga0209676_1001308 3300025292 Bacteria 25351
194 Ga0209025_1005739 3300025294 Bacteria 9969
195 Ga0209564_1002610 3300025295 Bacteria 13780
196 Ga0209564_1003474 3300025295 Bacteria 10744
197 Ga0209564_1014163 3300025295 Bacteria 3336
198 Ga0209758_1000904 3300025297 Bacteria 40285
199 Ga0209758_1001441 3300025297 Bacteria 28017
200 Ga0209758_1003892 3300025297 Bacteria 13058
201 Ga0209758_1006266 3300025297 Bacteria 8658
202 Ga0209050_1000481 3300025298 Bacteria 70155
203 Ga0209050_1001578 3300025298 Bacteria 23629
204 Ga0207426_1000241 3300025302 Bacteria 122857
205 Ga0207426_1000600 3300025302 Bacteria 47121
206 Ga0207426_1001944 3300025302 Bacteria 14815
207 Ga0207426_1004511 3300025302 Bacteria 6743
208 Ga0207426_1008487 3300025302 Bacteria 4143
209 Ga0207426_1012461 3300025302 Unclassified 3191
210 Ga0209051_1019758 3300025303 Bacteria 2927
211 Ga0209257_1000006 3300025304 Bacteria 1570111
212 Ga0209257_1003838 3300025304 Bacteria 12312
213 Ga0207655_1000480 3300025728 Bacteria 51524
214 Ga0207680_10029647 3300025903 Bacteria 3077
215 Ga0207647_10050271 3300025904 Bacteria 2581
216 Ga0207645_10003546 3300025907 Bacteria 11810
217 Ga0207654_10000791 3300025911 Bacteria 17421
218 Ga0207654_10053981 3300025911 Bacteria 2322
219 Ga0207654_10068427 3300025911 Bacteria 2100
220 Ga0207707_10000682 3300025912 Bacteria 33701
221 Ga0207695_10000020 3300025913 Bacteria 723025
222 Ga0207695_10000066 3300025913 Bacteria 334103
223 Ga0207695_10000469 3300025913 Bacteria 87551
224 Ga0207695_10000648 3300025913 Bacteria 69088
225 Ga0207695_10017695 3300025913 Bacteria 8278
226 Ga0207695_10048771 3300025913 Bacteria 4470
227 Ga0207695_10053270 3300025913 Bacteria 4232
228 Ga0207695_10082483 3300025913 Bacteria 3250
229 Ga0207671_10000129 3300025914 Bacteria 117585
230 Ga0207671_10001744 3300025914 Bacteria 24440
231 Ga0207671_10002908 3300025914 Bacteria 17689
232 Ga0207671_10003060 3300025914 Bacteria 17120
233 Ga0207671_10003329 3300025914 Bacteria 16151
234 Ga0207671_10007274 3300025914 Bacteria 9631
235 Ga0207671_10007338 3300025914 Bacteria 9573
236 Ga0207671_10054314 3300025914 Bacteria 2968
237 Ga0207657_10268465 3300025919 Bacteria 1357
238 Ga0207652_10016749 3300025921 Bacteria 5989
239 Ga0207694_10006741 3300025924 Bacteria 8725
240 Ga0207694_10038761 3300025924 Bacteria 3664
241 Ga0207704_10000124 3300025938 Bacteria 41992
242 Ga0207661_10006109 3300025944 Bacteria 8508
243 Ga0207661_10637113 3300025944 Bacteria 979
244 Ga0207679_10147599 3300025945 Bacteria 1910
245 Ga0207667_10005504 3300025949 Bacteria 15443
246 Ga0207667_10024641 3300025949 Bacteria 6602
247 Ga0207667_10034531 3300025949 Bacteria 5430
248 Ga0207667_10056769 3300025949 Bacteria 4112
249 Ga0207667_10058038 3300025949 Bacteria 4061
250 Ga0207677_10043094 3300026023 Bacteria 2998
251 Ga0207639_10024038 3300026041 Bacteria 4404
252 Ga0207702_10281716 3300026078 Bacteria 1572
253 Ga0207702_10480478 3300026078 Bacteria 1209
254 Ga0207648_10003695 3300026089 Bacteria 16019
255 Ga0207676_10143407 3300026095 Bacteria 2048
256 Ga0207674_10024361 3300026116 Bacteria 6469
257 Ga0207674_10052414 3300026116 Bacteria 4161
258 Ga0207674_10302409 3300026116 Bacteria 1549
259 Ga0207683_10021741 3300026121 Bacteria 5499
260 Ga0207698_10074559 3300026142 Bacteria 2707
261 Ga0207698_10092164 3300026142 Bacteria 2483
262 Ga0207698_10232033 3300026142 Bacteria 1676
263 Ga0207698_10273440 3300026142 Bacteria 1559
264 Ga0268266_10000714 3300028379 Bacteria 44837
265 Ga0268264_10021349 3300028381 Bacteria 5286
266 Ga0307517_10007343 3300028786 Bacteria 16093
267 Ga0307515_10000141 3300028794 Bacteria 172241
268 Ga0307515_10000983 3300028794 Bacteria 65204
269 Ga0307515_10048150 3300028794 Bacteria 6454
270 Ga0307511_10000024 3300030521 Bacteria 112616
271 Ga0265327_10000048 3300031251 Bacteria 269173
272 Ga0265327_10000055 3300031251 Bacteria 247188
273 Ga0307513_10120925 3300031456 Bacteria 2586
274 Ga0307513_10343700 3300031456 Bacteria 1242
275 Ga0307513_10393110 3300031456 Bacteria 1123
276 Ga0307509_10054325 3300031507 Bacteria 4266
277 Ga0307509_10164040 3300031507 Bacteria 2114
278 Ga0307509_10212259 3300031507 Bacteria 1759
279 Ga0307516_10003814 3300031730 Bacteria 19114
280 Ga0307516_10311361 3300031730 Bacteria 1248
281 Ga0307412_10000033 3300031911 Bacteria 206649
282 Ga0307414_10001167 3300032004 Bacteria 13480
283 Ga0307510_10002907 3300033180 Bacteria 19705
284 Ga0307510_10012274 3300033180 Bacteria 10158
285 Ga0307510_10260979 3300033180 Bacteria 1214
286 Ga0307510_10262435 3300033180 Bacteria 1208
287 Ga0395905_0001243 3300037471 Bacteria 31598
288 Ga0395905_0049914 3300037471 Bacteria 3921
289 Ga0436361_0092558 3300039447 Bacteria 4439
290 Ga0436361_0797777 3300039447 Bacteria 10788
291 Ga0436361_1205590 3300039447 Bacteria 1910
292 Ga0451800_1655331 3300041459 Bacteria 1142
293 Ga0451853_2991443 3300041512 Bacteria 2007
294 Ga0439445_0000328 3300042004 Bacteria 9260
295 Ga0466972_0000021 3300044658 Bacteria 196266
296 Ga0466972_0000180 3300044658 Bacteria 48646
297 Ga0466972_0010090 3300044658 Bacteria 4746
298 Ga0466972_0023519 3300044658 Bacteria 3063
299 Ga0466972_0028276 3300044658 Bacteria 2767
300 Ga0466965_0007242 3300044683 Bacteria 5083
301 Ga0466961_0075346 3300044693 Bacteria 2139
302 Ga0466964_0004096 3300044706 Bacteria 5365
303 Ga0466971_0088418 3300044719 Bacteria 1417
304 Ga0466968_0000298 3300044735 Bacteria 15837
305 Ga0466968_0024351 3300044735 Bacteria 2472
306 Ga0466968_0042254 3300044735 Bacteria 1927
307 Ga0466970_0000208 3300044765 Bacteria 28733
308 Ga0466970_0084535 3300044765 Bacteria 1718
309 Ga0466970_0102544 3300044765 Bacteria 1559
310 Ga0466957_0010222 3300044842 Bacteria 5375
311 Ga0466957_0023464 3300044842 Bacteria 3647
312 Ga0466959_0000048 3300045049 Bacteria 83528
313 Ga0466959_0000199 3300045049 Bacteria 39433
314 Ga0495617_000007 3300046452 Bacteria 369986
315 Ga0495638_0074133 3300046460 Bacteria 2076
316 Ga0495638_0078514 3300046460 Bacteria 2008
317 Ga0495638_0183280 3300046460 Bacteria 1193
318 Ga0495638_0253476 3300046460 Bacteria 969
319 Ga0495638_0273605 3300046460 Bacteria 921
320 Ga0495653_0000037 3300046463 Bacteria 120575
321 Ga0495650_0000013 3300046471 Bacteria 611135
322 Ga0495650_0000431 3300046471 Bacteria 67716
323 Ga0495650_0000500 3300046471 Bacteria 59272
324 Ga0495650_0000817 3300046471 Bacteria 37911
325 Ga0495650_0002327 3300046471 Bacteria 15716
326 Ga0495650_0027036 3300046471 Bacteria 2658
327 Ga0495605_0000181 3300046474 Bacteria 78127
328 Ga0495584_0000253 3300046491 Bacteria 38533
329 Ga0495585_0000299 3300046492 Bacteria 49739
330 Ga0495585_0000312 3300046492 Bacteria 48297
331 Ga0495585_0003771 3300046492 Bacteria 10117
332 Ga0495596_0008852 3300046500 Bacteria 4455
333 Ga0495607_0029830 3300046501 Bacteria 3355
334 Ga0495607_0078973 3300046501 Bacteria 1814
335 Ga0495607_0186302 3300046501 Bacteria 1037
336 Ga0495583_0119799 3300046506 Bacteria 1108
337 Ga0495606_0000010 3300046507 Bacteria 299893
338 Ga0495606_0000014 3300046507 Bacteria 289347
339 Ga0495606_0000268 3300046507 Bacteria 91857
340 Ga0495606_0001263 3300046507 Bacteria 35160
341 Ga0495606_0003568 3300046507 Bacteria 16404
342 Ga0495606_0017695 3300046507 Bacteria 5377
343 Ga0495606_0050564 3300046507 Bacteria 2718
344 Ga0495610_0000004 3300046512 Bacteria 1006135
345 Ga0495610_0000160 3300046512 Bacteria 74776
346 Ga0495610_0000370 3300046512 Bacteria 46662
347 Ga0495610_0004937 3300046512 Bacteria 9670
348 Ga0495610_0053059 3300046512 Bacteria 1966
349 Ga0495616_0002378 3300046513 Bacteria 12525
350 Ga0495616_0015480 3300046513 Bacteria 4242
351 Ga0495616_0029586 3300046513 Bacteria 2890
352 Ga0495628_0125411 3300046516 Bacteria 1968
353 Ga0495631_0054581 3300046518 Bacteria 1742
354 Ga0495637_0001437 3300046520 Bacteria 14040
355 Ga0495637_0059407 3300046520 Bacteria 1573
356 Ga0495643_0000727 3300046522 Bacteria 37586
357 Ga0495648_0009230 3300046524 Bacteria 7674
358 Ga0495648_0009276 3300046524 Bacteria 7648
359 Ga0495648_0018094 3300046524 Bacteria 5009
360 Ga0495648_0064034 3300046524 Bacteria 2167
361 Ga0495642_0030546 3300046528 Bacteria 2155
362 Ga0495652_0247450 3300046529 Bacteria 1323
363 Ga0495654_0000004 3300046530 Bacteria 515304
364 Ga0495654_0003249 3300046530 Bacteria 10030
365 Ga0495654_0032395 3300046530 Bacteria 2650
366 Ga0495609_0106139 3300046538 Bacteria 1214
367 Ga0495633_0000006 3300046558 Bacteria 326774
368 Ga0495633_0000137 3300046558 Bacteria 96876
369 Ga0495633_0001799 3300046558 Bacteria 15821
370 Ga0495633_0028042 3300046558 Bacteria 2746
371 Ga0495668_0000038 3300046616 Bacteria 232122
372 Ga0495668_0002688 3300046616 Bacteria 14268
373 Ga0495668_0003308 3300046616 Bacteria 12194
374 Ga0495611_0002238 3300046648 Bacteria 8981
375 Ga0495625_0000100 3300046660 Bacteria 139983
376 Ga0495625_0000371 3300046660 Bacteria 68809
377 Ga0495625_0000486 3300046660 Bacteria 59478
378 Ga0495625_0002832 3300046660 Bacteria 18231
379 Ga0495625_0002863 3300046660 Bacteria 18101
380 Ga0495625_0004614 3300046660 Bacteria 12952
381 Ga0495625_0020142 3300046660 Bacteria 5155
382 Ga0495625_0056363 3300046660 Bacteria 2798
383 Ga0495625_0067497 3300046660 Bacteria 2516
384 Ga0495661_0038251 3300046665 Bacteria 2990
385 Ga0495661_0046590 3300046665 Bacteria 2646
386 Ga0495588_0000139 3300046674 Bacteria 109955
387 Ga0495671_0000001 3300046692 Bacteria 1169494
388 Ga0495649_0000002 3300046694 Bacteria 1093458
389 Ga0495649_0038267 3300046694 Unclassified 2633
390 Ga0495600_0056347 3300046809 Bacteria 2568
391 Ga0495660_0006541 3300046810 Bacteria 6886
392 Ga0495660_0025635 3300046810 Bacteria 3347
393 Ga0495683_0011679 3300047323 Bacteria 4621
394 Ga0495687_000004 3300047443 Bacteria 779298
395 Ga0495687_000122 3300047443 Bacteria 119372
396 Ga0495679_034932 3300047446 Bacteria 1596
397 Ga0495673_0000017 3300047469 Bacteria 574970
398 Ga0495686_0000016 3300047472 Bacteria 443701
399 Ga0495686_0000251 3300047472 Bacteria 96361
400 Ga0495686_0001041 3300047472 Bacteria 33277
401 Ga0495686_0001829 3300047472 Bacteria 21405
402 Ga0495686_0018779 3300047472 Bacteria 4631
403 Ga0495686_0023359 3300047472 Bacteria 4080
404 Ga0495686_0029443 3300047472 Bacteria 3572
405 Ga0495686_0091607 3300047472 Unclassified 1845
406 Ga0495686_0113082 3300047472 Bacteria 1626
407 Ga0495614_0040777 3300048089 Bacteria 1992
408 Ga0496102_0044117 3300048905 Bacteria 4046
409 Ga0496106_0014474 3300048909 Bacteria 5829
410 Ga0496115_0015455 3300048918 Bacteria 5789
411 Ga0496115_0115096 3300048918 Bacteria 2211
412 Ga0496116_0000022 3300048919 Bacteria 482506
413 Ga0496116_0018835 3300048919 Bacteria 5304
414 Ga0496117_0000074 3300048920 Bacteria 232732
415 Ga0496118_0001613 3300048921 Bacteria 33370
416 Ga0496119_0000017 3300048922 Bacteria 309779
417 Ga0496119_0205865 3300048922 Bacteria 1015
418 Ga0496122_0000354 3300048925 Bacteria 98798
419 Ga0496122_0029413 3300048925 Bacteria 4635
420 Ga0496122_0036565 3300048925 Bacteria 3967
421 Ga0496123_0001157 3300048926 Bacteria 39190
422 Ga0496123_0004573 3300048926 Bacteria 14424
423 Ga0496124_0007620 3300048927 Bacteria 11470
424 Ga0496124_0143555 3300048927 Bacteria 1881
425 Ga0496125_0003881 3300048928 Bacteria 17669
426 Ga0496125_0025376 3300048928 Bacteria 5427
427 Ga0496125_0028020 3300048928 Bacteria 5095
428 Ga0496126_0043090 3300048929 Bacteria 4166
429 Ga0496126_0230418 3300048929 Bacteria 1552
430 Ga0495678_006672 3300049459 Bacteria 6104
431 Ga0495682_0015125 3300049460 Bacteria 2924
432 Ga0501034_0182894 3300049571 Bacteria 2061
433 Ga0501047_0049646 3300049581 Bacteria 4051
434 Ga0501047_0350273 3300049581 Bacteria 1314
435 Ga0501047_0546740 3300049581 Bacteria 983
436 Ga0501048_0039018 3300049582 Bacteria 3408
437 Ga0501241_004951 3300049758 Bacteria 2488
438 Ga0501035_0125975 3300049822 Bacteria 2236
439 Ga0501044_0094865 3300049823 Bacteria 3007
440 Ga0501226_005032 3300049853 Bacteria 1516
441 nmdc:mga0k408_22_c2 3300050493 Bacteria 93033
442 nmdc:mga05p37_63461_c1 3300050507 Bacteria 4546
443 Ga0500635_0001793 3300053080 Bacteria 5234
444 Ga0500578_0000091 3300053086 Bacteria 102427
445 Ga0500578_0012971 3300053086 Bacteria 5375
446 Ga0500644_0000366 3300053088 Bacteria 22129
447 Ga0500644_0003639 3300053088 Bacteria 3823
448 Ga0500646_0019898 3300053090 Bacteria 1779
449 Ga0500583_0000332 3300053092 Bacteria 15783
450 Ga0500583_0012366 3300053092 Bacteria 3255
451 Ga0500583_0017325 3300053092 Bacteria 2900
452 Ga0500651_0031403 3300053093 Bacteria 3344
453 Ga0500557_023473 3300053105 Bacteria 1793
454 Ga0500562_000015 3300053108 Bacteria 143120
455 Ga0500562_016911 3300053108 Bacteria 1876
456 Ga0500562_017877 3300053108 Unclassified 1830
457 Ga0500594_0008340 3300053118 Bacteria 2360
458 Ga0500594_0034366 3300053118 Bacteria 1354
459 Ga0500618_000010 3300053125 Bacteria 203909
460 Ga0500618_000172 3300053125 Bacteria 53899
461 Ga0500618_008344 3300053125 Bacteria 2897
462 Ga0500559_0012435 3300053136 Bacteria 3618
463 Ga0500559_0037918 3300053136 Bacteria 2091
464 Ga0500568_0016488 3300053139 Bacteria 3284
465 Ga0500568_0043531 3300053139 Bacteria 1794
466 Ga0500568_0085976 3300053139 Bacteria 1190
467 Ga0500588_0001979 3300053146 Bacteria 4053
468 Ga0500604_0002021 3300053151 Bacteria 5604
469 Ga0500604_0014014 3300053151 Bacteria 2179
470 Ga0500616_0019628 3300053153 Bacteria 3808
471 Ga0500622_0000004 3300053156 Bacteria 557587
472 Ga0500622_0000005 3300053156 Bacteria 502443
473 Ga0500622_0000082 3300053156 Bacteria 101502
474 Ga0500622_0001790 3300053156 Bacteria 16394
475 Ga0500622_0003293 3300053156 Bacteria 10942
476 Ga0500622_0012582 3300053156 Bacteria 4581
477 Ga0500633_0012202 3300053160 Bacteria 2366
478 Ga0500645_033122 3300053730 Bacteria 1547
479 Ga0500661_008111 3300055283 Bacteria 1931
480 2522550478 2522125168 Bacteria 7376607
481 2585145497 2582581278 Bacteria 5296881
482 2588213863 2585428183 Bacteria 5166119
483 2588218520 2585428184 Bacteria 4978681
484 2588225795 2585428185 Bacteria 4969476
485 2588233366 2585428187 Bacteria 4629388
486 2738736316 2738541279 Bacteria 6149495
487 2738768759 2738541285 Bacteria 6150075
488 2738825216 2738541297 Bacteria 6549566
489 2739149013 2738541357 Bacteria 6549408
490 2739190932 2738543003 Bacteria 6549560
491 2739217898 2738543007 Bacteria 6149845
492 2739317409 2738543026 Bacteria 6549408
493 2739335650 2738543029 Bacteria 6549249
494 2740057805 2739367874 Bacteria 4872888
495 2765573279 2765235839 Bacteria 5314748
496 2819680125 2818991460 Bacteria 7595395
497 2821133813 2821131069 Bacteria 6108407
498 2821142657 2821136567 Bacteria 8080116
499 2857565601 2857564685 Bacteria 6290584
500 2871720763 2871720351 Bacteria 4862476
501 2889291048 2889290771 Bacteria 5530962
502 2904470173 2904467357 Bacteria 8057758
503 2911141815 2911138879 Bacteria 5811561
504 2919439977 2919437846 Bacteria 6199444
505 2929182135 2929177148 Bacteria 7883697
506 2929242260 2929239360 Bacteria 7745570
507 2929922302 2929921140 Bacteria 8649150
508 2945927193 2945924605 Bacteria 4296724
509 2945978055 2945977869 Bacteria 7777518
510 2984575367 2984572630 Bacteria 4186940
511 2984608820 2984606641 Bacteria 4186971
512 8003152492 8003151029 Bacteria 8187759
513 JGI25160J50197_1009273
514 SwRhRL2b_contig_1307791
515 JGI24740J21852_10000062
516 JGI24739J22299_10002811
517 JGI25154J39366_1000002
518 JGI25157J39369_1005255
519 JGI25164J39214_1001595
520 JGI25150J39212_1001017
521 JGI25165J46597_1010484
522 JGI25153J46596_10000384
523 JGI25153J46596_10014223
524 JGI25153J46596_10022943
525 rootH1_10126934
526 rootH2_10074764
527 rootH2_10079932
528 rootL2_10005831
529 rootL2_10013757
530 rootL2_10017887
531 rootL2_10036291
532 rootL2_10080924
533 rootL2_10082227
534 rootL2_10189610
535 rootH1_10000721
536 rootH1_10002777
537 rootH1_10013386
538 rootH1_10013560
539 rootH1_10014858
540 rootH1_10033914
541 rootH1_10090846
542 rootH1_10118321
543 JGI25160J50197_1007512
544 JGI25160J50197_1008778
545 JGI25160J50197_1010057
546 Ga0055535_1006028
547 Ga0055529_1000125
548 Ga0055526_1010976
549 Ga0055528_1000179
550 Ga0055530_10004552
551 Ga0055531_10000110
552 Ga0065165_1000280
553 Ga0065165_1000748
554 Ga0065165_1024992
555 Ga0065714_10002527
556 Ga0065714_10008921
557 Ga0065704_10000217
558 Ga0070676_10002644
559 Ga0070683_100016555
560 Ga0070683_100096793
561 Ga0070680_100001415
562 Ga0070682_100000973
563 Ga0070682_100001169
564 Ga0068868_100061196
565 Ga0070660_100190973
566 Ga0070691_10010433
567 Ga0070668_100114464
568 Ga0070673_100007295
569 Ga0070688_100176527
570 Ga0070659_100101329
571 Ga0070678_100011291
572 Ga0070681_10105205
573 Ga0070681_10273311
574 Ga0068867_100004580
575 Ga0070679_100006480
576 Ga0070684_100008751
577 Ga0068853_100000817
578 Ga0068853_100070810
579 Ga0068853_100211928
580 Ga0068853_100304472
581 Ga0070672_100415694
582 Ga0070665_100003229
583 Ga0068855_100002223
584 Ga0068855_100019032
585 Ga0068855_100056989
586 Ga0068855_100066909
587 Ga0068855_100446155
588 Ga0070664_100174820
589 Ga0068857_100051473
590 Ga0068857_100091819
591 Ga0068854_100110888
592 Ga0068856_100035450
593 Ga0068856_100133381
594 Ga0068856_100297456
595 Ga0068856_100671036
596 Ga0068852_100000832
597 Ga0068852_100028659
598 Ga0068852_100324414
599 Ga0068860_100111232
600 Ga0075366_10073371
601 Ga0097621_100000738
602 Ga0068871_100000248
603 Ga0068871_100234326
604 Ga0068865_100000211
605 Ga0105244_10000050
606 Ga0105240_10000020
607 Ga0105240_10000242
608 Ga0105240_10000339
609 Ga0105240_10000723
610 Ga0105240_10006096
611 Ga0105240_10009547
612 Ga0105240_10040927
613 Ga0105240_10053210
614 Ga0105240_10057857
615 Ga0105240_10278783
616 Ga0105240_10320667
617 Ga0105240_10599646
618 Ga0114129_10075616
619 Ga0105241_10006704
620 Ga0105241_10011398
621 Ga0105241_10016999
622 Ga0105241_10113711
623 Ga0105241_10248965
624 Ga0105242_10017185
625 Ga0105248_10814019
626 Ga0105237_10000037
627 Ga0105237_10000083
628 Ga0105237_10000798
629 Ga0105237_10000950
630 Ga0105237_10001842
631 Ga0105237_10015909
632 Ga0105237_10017083
633 Ga0105237_10041649
634 Ga0105237_10080783
635 Ga0105237_10083531
636 Ga0105237_10088058
637 Ga0105237_10106774
638 Ga0105237_10845118
639 Ga0105238_10000678
640 Ga0105238_10023729
641 Ga0105238_10057429
642 Ga0105238_10526227
643 Ga0105239_10000001
644 Ga0105239_10000064
645 Ga0105239_10000098
646 Ga0105239_10000430
647 Ga0105239_10003355
648 Ga0105239_10014209
649 Ga0105239_10055274
650 Ga0105239_10447821
651 Ga0157373_10000041
652 Ga0157371_10001078
653 Ga0157371_10013877
654 Ga0157371_10069577
655 Ga0157370_10000166
656 Ga0157370_10000973
657 Ga0157370_10023228
658 Ga0157370_10040449
659 Ga0157370_10129135
660 Ga0157370_10506410
661 Ga0157370_10506416
662 Ga0157369_10071663
663 Ga0157374_10000002
664 Ga0157374_10041848
665 Ga0157374_10293266
666 Ga0157374_10319335
667 Ga0157378_10046351
668 Ga0163162_10021278
669 Ga0163162_10048512
670 Ga0163162_10225752
671 Ga0163162_10307983
672 Ga0163162_10711353
673 Ga0157372_10000539
674 Ga0157372_10017728
675 Ga0157372_10731272
676 Ga0157375_10000871
677 Ga0157375_10046228
678 Ga0157375_10444537
679 Ga0163163_10062433
680 Ga0163163_10676189
681 Ga0157376_10000893
682 Ga0157376_10106515
683 Ga0163161_10000391
684 Ga0163161_10001437
685 Ga0163161_10005491
686 Ga0163161_10156876
687 Ga0213872_10001273
688 Ga0213872_10045334
689 Ga0207427_100113
690 Ga0209437_100010
691 Ga0209437_110449
692 Ga0209258_100116
693 Ga0207425_1000507
694 Ga0209646_1000005
695 Ga0209646_1012531
696 Ga0209026_1000232
697 Ga0209148_1000251
698 Ga0209148_1000466
699 Ga0209233_1000017
700 Ga0209455_1000044
701 Ga0209455_1004245
702 Ga0209673_1000014
703 Ga0209673_1000018
704 Ga0209676_1001308
705 Ga0209025_1005739
706 Ga0209564_1002610
707 Ga0209564_1003474
708 Ga0209564_1014163
709 Ga0209758_1000904
710 Ga0209758_1001441
711 Ga0209758_1003892
712 Ga0209758_1006266
713 Ga0209050_1000481
714 Ga0209050_1001578
715 Ga0207426_1000241
716 Ga0207426_1000600
717 Ga0207426_1001944
718 Ga0207426_1004511
719 Ga0207426_1008487
720 Ga0207426_1012461
721 Ga0209051_1019758
722 Ga0209257_1000006
723 Ga0209257_1003838
724 Ga0207655_1000480
725 Ga0207680_10029647
726 Ga0207647_10050271
727 Ga0207645_10003546
728 Ga0207654_10000791
729 Ga0207654_10053981
730 Ga0207654_10068427
731 Ga0207707_10000682
732 Ga0207695_10000020
733 Ga0207695_10000066
734 Ga0207695_10000469
735 Ga0207695_10000648
736 Ga0207695_10017695
737 Ga0207695_10048771
738 Ga0207695_10053270
739 Ga0207695_10082483
740 Ga0207671_10000129
741 Ga0207671_10001744
742 Ga0207671_10002908
743 Ga0207671_10003060
744 Ga0207671_10003329
745 Ga0207671_10007274
746 Ga0207671_10007338
747 Ga0207671_10054314
748 Ga0207657_10268465
749 Ga0207652_10016749
750 Ga0207694_10006741
751 Ga0207694_10038761
752 Ga0207704_10000124
753 Ga0207661_10006109
754 Ga0207661_10637113
755 Ga0207679_10147599
756 Ga0207667_10005504
757 Ga0207667_10024641
758 Ga0207667_10034531
759 Ga0207667_10056769
760 Ga0207667_10058038
761 Ga0207677_10043094
762 Ga0207639_10024038
763 Ga0207702_10281716
764 Ga0207702_10480478
765 Ga0207648_10003695
766 Ga0207676_10143407
767 Ga0207674_10024361
768 Ga0207674_10052414
769 Ga0207674_10302409
770 Ga0207683_10021741
771 Ga0207698_10074559
772 Ga0207698_10092164
773 Ga0207698_10232033
774 Ga0207698_10273440
775 Ga0268266_10000714
776 Ga0268264_10021349
777 Ga0307517_10007343
778 Ga0307515_10000141
779 Ga0307515_10000983
780 Ga0307515_10048150
781 Ga0307511_10000024
782 Ga0265327_10000048
783 Ga0265327_10000055
784 Ga0307513_10120925
785 Ga0307513_10343700
786 Ga0307513_10393110
787 Ga0307509_10054325
788 Ga0307509_10164040
789 Ga0307509_10212259
790 Ga0307516_10003814
791 Ga0307516_10311361
792 Ga0307412_10000033
793 Ga0307414_10001167
794 Ga0307510_10002907
795 Ga0307510_10012274
796 Ga0307510_10260979
797 Ga0307510_10262435
798 Ga0395905_0001243
799 Ga0395905_0049914
800 Ga0436361_0092558
801 Ga0436361_0797777
802 Ga0436361_1205590
803 Ga0451800_1655331
804 Ga0451853_2991443
805 Ga0439445_0000328
806 Ga0466972_0000021
807 Ga0466972_0000180
808 Ga0466972_0010090
809 Ga0466972_0023519
810 Ga0466972_0028276
811 Ga0466965_0007242
812 Ga0466961_0075346
813 Ga0466964_0004096
814 Ga0466971_0088418
815 Ga0466968_0000298
816 Ga0466968_0024351
817 Ga0466968_0042254
818 Ga0466970_0000208
819 Ga0466970_0084535
820 Ga0466970_0102544
821 Ga0466957_0010222
822 Ga0466957_0023464
823 Ga0466959_0000048
824 Ga0466959_0000199
825 Ga0495617_000007
826 Ga0495638_0074133
827 Ga0495638_0078514
828 Ga0495638_0183280
829 Ga0495638_0253476
830 Ga0495638_0273605
831 Ga0495653_0000037
832 Ga0495650_0000013
833 Ga0495650_0000431
834 Ga0495650_0000500
835 Ga0495650_0000817
836 Ga0495650_0002327
837 Ga0495650_0027036
838 Ga0495605_0000181
839 Ga0495584_0000253
840 Ga0495585_0000299
841 Ga0495585_0000312
842 Ga0495585_0003771
843 Ga0495596_0008852
844 Ga0495607_0029830
845 Ga0495607_0078973
846 Ga0495607_0186302
847 Ga0495583_0119799
848 Ga0495606_0000010
849 Ga0495606_0000014
850 Ga0495606_0000268
851 Ga0495606_0001263
852 Ga0495606_0003568
853 Ga0495606_0017695
854 Ga0495606_0050564
855 Ga0495610_0000004
856 Ga0495610_0000160
857 Ga0495610_0000370
858 Ga0495610_0004937
859 Ga0495610_0053059
860 Ga0495616_0002378
861 Ga0495616_0015480
862 Ga0495616_0029586
863 Ga0495628_0125411
864 Ga0495631_0054581
865 Ga0495637_0001437
866 Ga0495637_0059407
867 Ga0495643_0000727
868 Ga0495648_0009230
869 Ga0495648_0009276
870 Ga0495648_0018094
871 Ga0495648_0064034
872 Ga0495642_0030546
873 Ga0495652_0247450
874 Ga0495654_0000004
875 Ga0495654_0003249
876 Ga0495654_0032395
877 Ga0495609_0106139
878 Ga0495633_0000006
879 Ga0495633_0000137
880 Ga0495633_0001799
881 Ga0495633_0028042
882 Ga0495668_0000038
883 Ga0495668_0002688
884 Ga0495668_0003308
885 Ga0495611_0002238
886 Ga0495625_0000100
887 Ga0495625_0000371
888 Ga0495625_0000486
889 Ga0495625_0002832
890 Ga0495625_0002863
891 Ga0495625_0004614
892 Ga0495625_0020142
893 Ga0495625_0056363
894 Ga0495625_0067497
895 Ga0495661_0038251
896 Ga0495661_0046590
897 Ga0495588_0000139
898 Ga0495671_0000001
899 Ga0495649_0000002
900 Ga0495649_0038267
901 Ga0495600_0056347
902 Ga0495660_0006541
903 Ga0495660_0025635
904 Ga0495683_0011679
905 Ga0495687_000004
906 Ga0495687_000122
907 Ga0495679_034932
908 Ga0495673_0000017
909 Ga0495686_0000016
910 Ga0495686_0000251
911 Ga0495686_0001041
912 Ga0495686_0001829
913 Ga0495686_0018779
914 Ga0495686_0023359
915 Ga0495686_0029443
916 Ga0495686_0091607
917 Ga0495686_0113082
918 Ga0495614_0040777
919 Ga0496102_0044117
920 Ga0496106_0014474
921 Ga0496115_0015455
922 Ga0496115_0115096
923 Ga0496116_0000022
924 Ga0496116_0018835
925 Ga0496117_0000074
926 Ga0496118_0001613
927 Ga0496119_0000017
928 Ga0496119_0205865
929 Ga0496122_0000354
930 Ga0496122_0029413
931 Ga0496122_0036565
932 Ga0496123_0001157
933 Ga0496123_0004573
934 Ga0496124_0007620
935 Ga0496124_0143555
936 Ga0496125_0003881
937 Ga0496125_0025376
938 Ga0496125_0028020
939 Ga0496126_0043090
940 Ga0496126_0230418
941 Ga0495678_006672
942 Ga0495682_0015125
943 Ga0501034_0182894
944 Ga0501047_0049646
945 Ga0501047_0350273
946 Ga0501047_0546740
947 Ga0501048_0039018
948 Ga0501241_004951
949 Ga0501035_0125975
950 Ga0501044_0094865
951 Ga0501226_005032
952 nmdc:mga0k408_22_c2
953 nmdc:mga05p37_63461_c1
954 Ga0500635_0001793
955 Ga0500578_0000091
956 Ga0500578_0012971
957 Ga0500644_0000366
958 Ga0500644_0003639
959 Ga0500646_0019898
960 Ga0500583_0000332
961 Ga0500583_0012366
962 Ga0500583_0017325
963 Ga0500651_0031403
964 Ga0500557_023473
965 Ga0500562_000015
966 Ga0500562_016911
967 Ga0500562_017877
968 Ga0500594_0008340
969 Ga0500594_0034366
970 Ga0500618_000010
971 Ga0500618_000172
972 Ga0500618_008344
973 Ga0500559_0012435
974 Ga0500559_0037918
975 Ga0500568_0016488
976 Ga0500568_0043531
977 Ga0500568_0085976
978 Ga0500588_0001979
979 Ga0500604_0002021
980 Ga0500604_0014014
981 Ga0500616_0019628
982 Ga0500622_0000004
983 Ga0500622_0000005
984 Ga0500622_0000082
985 Ga0500622_0001790
986 Ga0500622_0003293
987 Ga0500622_0012582
988 Ga0500633_0012202
989 Ga0500645_033122
990 Ga0500661_008111
991 2522550478
992 2585145497
993 2588213863
994 2588218520
995 2588225795
996 2588233366
997 2738736316
998 2738768759
999 2738825216
1000 2739149013
1001 2739190932
1002 2739217898
1003 2739317409
1004 2739335650
1005 2740057805
1006 2765573279
1007 2819680125
1008 2821133813
1009 2821142657
1010 2857565601
1011 2871720763
1012 2889291048
1013 2904470173
1014 2911141815
1015 2919439977
1016 2929182135
1017 2929242260
1018 2929922302
1019 2945927193
1020 2945978055
1021 2984575367
1022 2984608820
1023 8003152492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

201

281

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

241

279

0.9

PF20240

DUF6597

Domain of unknown function (DUF6597)

31

132

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.879 158 252
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.8676 150 254
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.8562 151 254
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.8525 154 263
1bl0-assembly1.cif.gz_A multiple antibiotic resistance protein (mara)/dna complex 0.8478 153 252
ID Description Score Start End Superfamily
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9449 208 252 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9324 208 253 1.10.10.60
af_P06134_78_136_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9256 202 255 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9232 205 253 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9184 205 257 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A427CAM7-F1-model_v4 AraC family transcriptional regulator 0.9521 151 262 GO:0003700
GO:0043565
AF-A0A2A5GNV0-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9357 153 256 GO:0003700
GO:0043565
AF-G7WCZ7-F1-model_v4 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain 0.9312 152 262 GO:0003700
GO:0043565
AF-A0A2N5NN61-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9308 154 257 GO:0003700
GO:0043565
AF-A0A1W1VMV8-F1-model_v4 AraC-type DNA-binding protein 0.9305 1 257 GO:0003700
GO:0043565

Map