metagRoot

F457320

General Info

Members	Datasets	Scaffolds	Average Seq Length
511	308	486	302

Family's Representative Sequence

Representative Sequence	3300042876\|Ga0451577_0000519\|Ga0451577_0000519_44474_45469
Length	331
Sequence	MDFKYTNDFINNFWSMYVVVITLVSVIGCGVFLWMQGNVKHNPGQTTGHLWDETLAEYSNPLPNWWRWMFYITVVFALVYLAIFPGLGSFGGKLDWTMRSQYDAEMKKANEQYAPIFNKFLKQDVMAVAANGEAKEMGQRLFLTYCAQCHGSDAKGAKGFPNLTDADWLWGGTPEKIKETITKGHDAVMTPKGTKPDMDAEQVKDVVHYVRSLSGLSSDSMRVQRGKELFPQACAACHGPEGKGNPDAGYPNLTDKIWLYSSQEADQIETVTKGRVNRMPAWGDFLGEAKVHILTAYVWGLGGGVKPAAPVASAEQPADGQLIRPASGAGQ

Samples

	Sample ID	Description	Type	Environment
1	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
2	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
3	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
4	2526164512	Azovibrio restrictus DSM 23866	Isolate	Unclassified
5	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
6	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
7	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
8	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
9	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
10	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
11	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
12	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
13	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
14	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
15	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
16	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
17	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
18	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
19	2738543013	Variovorax sp. BT01	Isolate	Unclassified
20	2831864461	Roseateles noduli HZ7	Isolate	Nodule
21	2842718218	Acidovorax sp. R-73343	Isolate	Unclassified
22	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
23	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
24	2901300506	Cupriavidus sp. UYMSc13B	Isolate	Unclassified
25	2919497567	Shewanella putrefaciens 3469	Isolate	Unclassified
26	2998344455	Vogesella urethralis SLBN-145	Isolate	Rhizosphere
27	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
28	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
29	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
30	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
31	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
32	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
33	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
34	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
35	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
36	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
37	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
38	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
39	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
40	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
41	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
42	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
43	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
44	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
45	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
46	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
47	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
48	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
49	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
50	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
51	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
52	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
53	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
54	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
55	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
56	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
57	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
58	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
59	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
60	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
61	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
62	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
63	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
64	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
65	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
66	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
67	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
68	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
69	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
70	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
71	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
72	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
73	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
74	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
75	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
76	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
77	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
78	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
79	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
80	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
81	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
82	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
83	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
84	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
85	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
86	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
87	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
88	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
89	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
90	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
91	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
93	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
94	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
95	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
96	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
97	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
98	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
99	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
100	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
101	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
102	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
103	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
104	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
105	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
106	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
107	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
108	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
109	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
110	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
111	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
112	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
113	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
114	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
115	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
116	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
124	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
125	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
126	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
129	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
130	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
131	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
133	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
135	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
138	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
141	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
172	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
177	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
178	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
179	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
180	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
181	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
182	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
183	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
184	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
185	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
186	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
187	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
188	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
189	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
190	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
191	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
192	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
193	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
194	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
195	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
196	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
197	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
198	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
199	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
200	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
201	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
202	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
203	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
204	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
205	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
206	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
207	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
208	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
209	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
210	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
211	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
212	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
213	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
214	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
215	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
216	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
217	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
218	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
219	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
220	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
221	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
222	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
223	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
224	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
225	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
226	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
227	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
228	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
229	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
230	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
231	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
232	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
233	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
234	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
235	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
236	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
237	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
238	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
239	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
240	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
241	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
242	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
243	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
244	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
245	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
246	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
247	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
248	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
249	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
250	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
251	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
252	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
253	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
254	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
255	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
256	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
257	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
258	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
259	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
260	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
261	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
262	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
263	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
264	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
265	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
266	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
267	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
268	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
269	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
270	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
271	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
272	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
273	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
274	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
275	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
276	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
277	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
278	3300049538	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
279	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
280	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
281	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
282	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
283	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
284	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
285	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
286	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
287	3300049687	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought	Metagenome	Rhizosphere
288	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
289	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
290	3300049757	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control	Metagenome	Rhizosphere
291	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
292	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
293	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
294	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
295	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
296	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
297	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
298	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
299	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
300	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
301	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
302	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
303	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
304	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
305	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
306	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
307	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
308	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	93.35
Metatranscriptomes	1.37
Isolates	5.28

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	31.31
Nodule	1.37
Rhizoplane	2.35
Rhizosphere	51.27
Stem	0
Stem Tuber	0
Unclassified	13.7

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24741J21665_1000619	3300001915	Bacteria	10705
2	JGI24740J21852_10001129	3300001979	Bacteria	12088
3	JGI25155J39150_1000036	3300002704	Bacteria	97790
4	JGI25156J39149_1000047	3300002705	Bacteria	97697
5	JGI25154J39366_1000068	3300002738	Bacteria	97697
6	JGI25157J39369_1000066	3300002741	Bacteria	97697
7	JGI25152J39213_1000782	3300002773	Bacteria	15991
8	JGI25150J39212_1012533	3300002774	Bacteria	1498
9	JGI25159J45721_1002111	3300002987	Bacteria	7804
10	JGI25159J45721_1002272	3300002987	Bacteria	7406
11	JGI25159J45721_1003942	3300002987	Bacteria	5066
12	JGI25151J46595_10002855	3300003187	Bacteria	9927
13	JGI25151J46595_10003262	3300003187	Bacteria	9020
14	JGI25151J46595_10008912	3300003187	Bacteria	4786
15	JGI25151J46595_10025420	3300003187	Bacteria	2409
16	JGI25153J46596_10002378	3300003215	Bacteria	10881
17	JGI25153J46596_10004461	3300003215	Bacteria	7546
18	rootH1_10008535	3300003316	Bacteria	2140
19	rootH2_10204759	3300003320	Bacteria	1642
20	rootL2_10014620	3300003322	Bacteria	7420
21	rootL2_10018194	3300003322	Bacteria	1404
22	rootH1_10009149	3300003323	Bacteria	1979
23	rootH1_10021813	3300003316	Bacteria	10095
24	rootH1_10021813	3300003323	Bacteria	6866
25	rootH1_10171011	3300003316	Bacteria	1003
26	rootH1_10171011	3300003323	Bacteria	1663
27	rootH1_10235071	3300003323	Bacteria	2607
28	JGI25160J50197_1000331	3300003354	Bacteria	32173
29	JGI25160J50197_1000446	3300003354	Bacteria	25789
30	JGI25161J50226_1000064	3300003374	Bacteria	99448
31	Ga0055539_1000247	3300003752	Bacteria	34873
32	Ga0055533_1002919	3300003756	Bacteria	3669
33	Ga0055532_1000002	3300003758	Bacteria	576000
34	Ga0055532_1000029	3300003758	Bacteria	232900
35	Ga0055525_1000013	3300003759	Bacteria	440870
36	Ga0055525_1000496	3300003759	Bacteria	19973
37	Ga0055527_1000309	3300003760	Bacteria	26520
38	Ga0055535_1000123	3300003761	Bacteria	83521
39	Ga0055529_1000062	3300003763	Bacteria	183782
40	Ga0055526_1002864	3300003771	Bacteria	11369
41	Ga0055526_1004256	3300003771	Bacteria	8670
42	Ga0055526_1011734	3300003771	Bacteria	3905
43	Ga0055526_1013399	3300003771	Bacteria	3473
44	Ga0055537_1000043	3300003773	Bacteria	90816
45	Ga0055537_1000046	3300003773	Bacteria	88251
46	Ga0055537_1005962	3300003773	Bacteria	3173
47	Ga0055537_1008895	3300003773	Bacteria	2265
48	Ga0055524_1000012	3300003775	Bacteria	260384
49	Ga0055524_1000467	3300003775	Bacteria	32384
50	Ga0055524_1000664	3300003775	Bacteria	24165
51	Ga0055536_1000060	3300003781	Bacteria	102699
52	Ga0055534_1001444	3300003784	Bacteria	9456
53	Ga0055534_1001551	3300003784	Bacteria	8964
54	Ga0055528_1002287	3300003790	Bacteria	10381
55	Ga0055530_10000015	3300003791	Bacteria	148790
56	Ga0055530_10017831	3300003791	Bacteria	2209
57	Ga0055530_10024940	3300003791	Bacteria	1681
58	Ga0055530_10051169	3300003791	Bacteria	959
59	Ga0055540_1000039	3300003792	Bacteria	161844
60	Ga0055540_1017655	3300003792	Bacteria	1984
61	Ga0055531_10000064	3300003794	Bacteria	117923
62	Ga0055531_10000536	3300003794	Bacteria	33683
63	Ga0055531_10004642	3300003794	Bacteria	8249
64	Ga0055531_10006807	3300003794	Bacteria	6381
65	Ga0055531_10021470	3300003794	Bacteria	2503
66	Ga0055541_1000312	3300003841	Bacteria	15924
67	Ga0055543_1000284	3300004625	Bacteria	36825
68	Ga0065165_1000074	3300005262	Bacteria	164454
69	Ga0065165_1008550	3300005262	Bacteria	4763
70	Ga0065165_1008562	3300005262	Bacteria	4758
71	Ga0065165_1011549	3300005262	Bacteria	3668
72	Ga0065165_1026895	3300005262	Bacteria	1885
73	Ga0065714_10103580	3300005288	Bacteria	1600
74	Ga0065707_10081899	3300005295	Bacteria	30231
75	Ga0065707_10091143	3300005295	Bacteria	3997
76	Ga0070658_10210694	3300005327	Bacteria	1641
77	Ga0070676_10154271	3300005328	Bacteria	1473
78	Ga0070670_100014925	3300005331	Bacteria	6666
79	Ga0070670_100121386	3300005331	Bacteria	2254
80	Ga0070660_100016021	3300005339	Bacteria	5430
81	Ga0070660_100236568	3300005339	Bacteria	1487
82	Ga0070661_100000077	3300005344	Bacteria	77659
83	Ga0070669_100099256	3300005353	Bacteria	2194
84	Ga0070671_100524901	3300005355	Bacteria	1020
85	Ga0070659_100179288	3300005366	Bacteria	1738
86	Ga0070667_100371226	3300005367	Bacteria	1298
87	Ga0070711_100063098	3300005439	Bacteria	2585
88	Ga0070663_100000011	3300005455	Bacteria	146097
89	Ga0070678_100063692	3300005456	Bacteria	2729
90	Ga0068867_100000223	3300005459	Bacteria	37387
91	Ga0068855_100120767	3300005563	Bacteria	2999
92	Ga0070664_100000002	3300005564	Bacteria	458815
93	Ga0070664_100169949	3300005564	Bacteria	1934
94	Ga0070664_100523283	3300005564	Bacteria	1095
95	Ga0068857_100005940	3300005577	Bacteria	10425
96	Ga0068854_100000043	3300005578	Bacteria	92551
97	Ga0068854_100114654	3300005578	Bacteria	2038
98	Ga0068856_100000009	3300005614	Bacteria	181448
99	Ga0068856_100000986	3300005614	Bacteria	30397
100	Ga0068856_100062772	3300005614	Bacteria	3670
101	Ga0068852_100071430	3300005616	Bacteria	3048
102	Ga0068852_100534556	3300005616	Bacteria	1171
103	Ga0068859_100206035	3300005617	Bacteria	2052
104	Ga0068859_100217291	3300005617	Bacteria	1999
105	Ga0068851_10156267	3300005834	Bacteria	1250
106	Ga0068863_100258346	3300005841	Bacteria	1684
107	Ga0068860_100036135	3300005843	Bacteria	4735
108	Ga0075364_10159228	3300006051	Bacteria	1524
109	Ga0075362_10049487	3300006177	Bacteria	1877
110	Ga0075366_10020268	3300006195	Bacteria	3856
111	Ga0075366_10048043	3300006195	Bacteria	2530
112	Ga0097621_100150784	3300006237	Bacteria	1994
113	Ga0075370_10070112	3300006353	Bacteria	2005
114	Ga0097620_100206028	3300006931	Bacteria	2052
115	Ga0097620_100217277	3300006931	Bacteria	1999
116	Ga0079104_1038028	3300006946	Bacteria	1143
117	Ga0099826_10000020	3300006948	Bacteria	183920
118	Ga0105251_10012131	3300009011	Bacteria	4891
119	Ga0105240_10001225	3300009093	Bacteria	44616
120	Ga0105245_10334032	3300009098	Bacteria	1497
121	Ga0114129_10039251	3300009147	Bacteria	6675
122	Ga0105243_10020345	3300009148	Bacteria	5033
123	Ga0105243_10067150	3300009148	Bacteria	2886
124	Ga0105238_10062386	3300009551	Bacteria	3728
125	Ga0105239_10013435	3300010375	Bacteria	9097
126	Ga0157319_1000013	3300012497	Bacteria	154883
127	Ga0157371_10000068	3300013102	Bacteria	168110
128	Ga0157370_10001168	3300013104	Bacteria	32712
129	Ga0157369_10006584	3300013105	Bacteria	13433
130	Ga0157374_10545417	3300013296	Bacteria	1167
131	Ga0157378_10000138	3300013297	Bacteria	69197
132	Ga0157378_10081196	3300013297	Bacteria	2930
133	Ga0157378_10586646	3300013297	Bacteria	1124
134	Ga0157372_10001313	3300013307	Bacteria	26928
135	Ga0157377_10000029	3300014745	Bacteria	134270
136	Ga0157379_10050057	3300014968	Bacteria	3729
137	Ga0182006_1002380	3300015261	Bacteria	10304
138	Ga0154015_1189915	3300020610	Bacteria	26138
139	Ga0213872_10000139	3300021361	Bacteria	65459
140	Ga0213872_10000166	3300021361	Bacteria	59987
141	Ga0213872_10000396	3300021361	Bacteria	36208
142	Ga0213872_10031354	3300021361	Bacteria	2436
143	Ga0209435_100001	3300025206	Bacteria	1424171
144	Ga0209784_100003	3300025224	Bacteria	1379451
145	Ga0209566_100002	3300025225	Bacteria	2614868
146	Ga0209566_100824	3300025225	Bacteria	15730
147	Ga0209674_100008	3300025226	Bacteria	1076909
148	Ga0209672_100052	3300025228	Bacteria	231179
149	Ga0209147_100002	3300025229	Bacteria	2158988
150	Ga0209563_100004	3300025230	Bacteria	1814108
151	Ga0209563_100025	3300025230	Bacteria	596456
152	Ga0209258_100002	3300025242	Bacteria	2158988
153	Ga0209258_111224	3300025242	Bacteria	1136
154	Ga0207425_1003432	3300025245	Bacteria	5076
155	Ga0207425_1004878	3300025245	Bacteria	3930
156	Ga0207425_1010381	3300025245	Bacteria	2269
157	Ga0209646_1000001	3300025246	Bacteria	3092932
158	Ga0209026_1000003	3300025250	Bacteria	1060571
159	Ga0209677_100009	3300025253	Bacteria	749530
160	Ga0209148_1002335	3300025254	Bacteria	6742
161	Ga0209759_1000001	3300025256	Bacteria	2799452
162	Ga0209759_1011304	3300025256	Bacteria	2547
163	Ga0209129_1000043	3300025258	Bacteria	298978
164	Ga0209565_1000004	3300025263	Bacteria	983150
165	Ga0209565_1000092	3300025263	Bacteria	141563
166	Ga0209565_1001352	3300025263	Bacteria	11094
167	Ga0209565_1002772	3300025263	Bacteria	6068
168	Ga0209455_1000021	3300025272	Bacteria	699993
169	Ga0209673_1000221	3300025273	Bacteria	112739
170	Ga0209673_1004650	3300025273	Bacteria	7259
171	Ga0209673_1014212	3300025273	Bacteria	3090
172	Ga0209673_1015266	3300025273	Bacteria	2928
173	Ga0209673_1017693	3300025273	Bacteria	2620
174	Ga0209673_1021563	3300025273	Bacteria	2249
175	Ga0209673_1031644	3300025273	Bacteria	1642
176	Ga0209130_1000094	3300025284	Bacteria	145569
177	Ga0209130_1000855	3300025284	Bacteria	25210
178	Ga0209675_1000061	3300025291	Bacteria	181096
179	Ga0209675_1000317	3300025291	Bacteria	43071
180	Ga0209675_1001536	3300025291	Bacteria	13164
181	Ga0209675_1002958	3300025291	Bacteria	8382
182	Ga0209675_1011600	3300025291	Bacteria	2910
183	Ga0209676_1000007	3300025292	Bacteria	1029371
184	Ga0209676_1000012	3300025292	Bacteria	841431
185	Ga0209676_1035655	3300025292	Bacteria	1456
186	Ga0209025_1001987	3300025294	Bacteria	23455
187	Ga0209025_1002566	3300025294	Bacteria	18890
188	Ga0209025_1004250	3300025294	Bacteria	12610
189	Ga0209025_1007278	3300025294	Bacteria	8307
190	Ga0209025_1010711	3300025294	Bacteria	6167
191	Ga0209025_1020430	3300025294	Bacteria	3625
192	Ga0209564_1000014	3300025295	Bacteria	621501
193	Ga0209564_1000051	3300025295	Bacteria	357748
194	Ga0209564_1000681	3300025295	Bacteria	50123
195	Ga0209564_1001788	3300025295	Bacteria	19889
196	Ga0209564_1002295	3300025295	Bacteria	15586
197	Ga0209564_1002691	3300025295	Bacteria	13448
198	Ga0209758_1000078	3300025297	Bacteria	266153
199	Ga0209758_1000093	3300025297	Bacteria	241169
200	Ga0209050_1000003	3300025298	Bacteria	1609245
201	Ga0209050_1002918	3300025298	Bacteria	13397
202	Ga0209050_1003108	3300025298	Bacteria	12723
203	Ga0209050_1003348	3300025298	Bacteria	11947
204	Ga0209050_1006588	3300025298	Bacteria	6819
205	Ga0209050_1012967	3300025298	Bacteria	3764
206	Ga0209256_1000001	3300025299	Bacteria	2166974
207	Ga0209256_1001137	3300025299	Bacteria	30308
208	Ga0209256_1001737	3300025299	Bacteria	20841
209	Ga0209256_1050478	3300025299	Bacteria	1009
210	Ga0207426_1000025	3300025302	Bacteria	532921
211	Ga0209051_1000003	3300025303	Bacteria	1609245
212	Ga0209051_1000491	3300025303	Bacteria	51059
213	Ga0209051_1006234	3300025303	Bacteria	6764
214	Ga0209051_1006395	3300025303	Bacteria	6647
215	Ga0209051_1020546	3300025303	Bacteria	2839
216	Ga0209051_1021640	3300025303	Bacteria	2729
217	Ga0209051_1031883	3300025303	Bacteria	2020
218	Ga0209257_1000018	3300025304	Bacteria	836016
219	Ga0209257_1000032	3300025304	Bacteria	680354
220	Ga0209257_1000137	3300025304	Bacteria	204210
221	Ga0209257_1001091	3300025304	Bacteria	35384
222	Ga0209257_1001249	3300025304	Bacteria	31428
223	Ga0209257_1010481	3300025304	Bacteria	4680
224	Ga0209257_1012572	3300025304	Bacteria	3894
225	Ga0209257_1024298	3300025304	Bacteria	2102
226	Ga0207713_1032461	3300025735	Bacteria	2292
227	Ga0207645_10002677	3300025907	Bacteria	13882
228	Ga0207695_10000829	3300025913	Bacteria	57299
229	Ga0207663_10050444	3300025916	Bacteria	2586
230	Ga0207657_10025513	3300025919	Bacteria	5449
231	Ga0207649_10000533	3300025920	Bacteria	26462
232	Ga0207694_10020682	3300025924	Bacteria	4982
233	Ga0207694_10204565	3300025924	Bacteria	1607
234	Ga0207650_10077115	3300025925	Bacteria	2519
235	Ga0207644_10108804	3300025931	Bacteria	2093
236	Ga0207709_10013493	3300025935	Bacteria	4507
237	Ga0207709_10025428	3300025935	Bacteria	3389
238	Ga0207689_10411540	3300025942	Bacteria	1128
239	Ga0207679_10000001	3300025945	Bacteria	777444
240	Ga0207667_10049546	3300025949	Bacteria	4436
241	Ga0207651_10250903	3300025960	Bacteria	1448
242	Ga0207712_10168938	3300025961	Bacteria	1707
243	Ga0207640_10000035	3300025981	Bacteria	111369
244	Ga0207658_10044834	3300025986	Bacteria	3221
245	Ga0207677_10213072	3300026023	Bacteria	1544
246	Ga0207677_10256282	3300026023	Bacteria	1424
247	Ga0207678_10000001	3300026067	Bacteria	433184
248	Ga0207702_10000301	3300026078	Bacteria	57080
249	Ga0207702_10002138	3300026078	Bacteria	18994
250	Ga0207641_10119728	3300026088	Bacteria	2347
251	Ga0207648_10000704	3300026089	Bacteria	37513
252	Ga0207648_10311886	3300026089	Bacteria	1412
253	Ga0207674_10004681	3300026116	Bacteria	16425
254	Ga0207683_10166912	3300026121	Bacteria	1992
255	Ga0207683_10578691	3300026121	Bacteria	1039
256	Ga0207698_10020841	3300026142	Bacteria	4522
257	Ga0207698_10050447	3300026142	Bacteria	3175
258	Ga0209968_1000393	3300027526	Bacteria	7148
259	Ga0209983_1023070	3300027665	Unclassified	1306
260	Ga0209282_1000053	3300027666	Bacteria	103311
261	Ga0209971_1018342	3300027682	Bacteria	1660
262	Ga0209966_1000111	3300027695	Bacteria	36041
263	Ga0209974_10003750	3300027876	Bacteria	5443
264	Ga0268266_10155103	3300028379	Bacteria	2067
265	Ga0307515_10000006	3300028794	Bacteria	725810
266	Ga0307515_10000645	3300028794	Bacteria	80548
267	Ga0307515_10001095	3300028794	Bacteria	62092
268	Ga0307515_10005856	3300028794	Bacteria	24799
269	Ga0307515_10007438	3300028794	Bacteria	21646
270	Ga0307515_10060136	3300028794	Bacteria	5428
271	Ga0307515_10145737	3300028794	Bacteria	2509
272	Ga0307512_10028671	3300030522	Bacteria	4877
273	Ga0265330_10000032	3300031235	Bacteria	130592
274	Ga0265332_10000001	3300031238	Bacteria	863783
275	Ga0265332_10000010	3300031238	Bacteria	289041
276	Ga0265328_10000027	3300031239	Bacteria	114609
277	Ga0265325_10003737	3300031241	Bacteria	9830
278	Ga0265325_10009531	3300031241	Bacteria	5665
279	Ga0265325_10058736	3300031241	Bacteria	1958
280	Ga0265331_10029014	3300031250	Bacteria	2764
281	Ga0265331_10039477	3300031250	Bacteria	2302
282	Ga0265316_10029076	3300031344	Bacteria	4549
283	Ga0265316_10327447	3300031344	Bacteria	1112
284	Ga0307513_10001949	3300031456	Bacteria	29203
285	Ga0307513_10072473	3300031456	Bacteria	3590
286	Ga0307513_10206133	3300031456	Bacteria	1802
287	Ga0307509_10001394	3300031507	Bacteria	40983
288	Ga0307509_10024769	3300031507	Bacteria	6715
289	Ga0307509_10150685	3300031507	Bacteria	2242
290	Ga0307408_100000010	3300031548	Bacteria	420048
291	Ga0307408_100000924	3300031548	Bacteria	22892
292	Ga0307408_100004521	3300031548	Bacteria	9431
293	Ga0307408_100095561	3300031548	Bacteria	2253
294	Ga0307408_100367098	3300031548	Bacteria	1226
295	Ga0307508_10000684	3300031616	Bacteria	40683
296	Ga0307508_10121840	3300031616	Bacteria	2211
297	Ga0307508_10308466	3300031616	Bacteria	1175
298	Ga0307514_10000528	3300031649	Bacteria	74778
299	Ga0307514_10005730	3300031649	Bacteria	10983
300	Ga0316575_10004710	3300031665	Bacteria	4810
301	Ga0265314_10000022	3300031711	Bacteria	297299
302	Ga0265314_10008153	3300031711	Bacteria	9015
303	Ga0265342_10011592	3300031712	Bacteria	6020
304	Ga0316576_10228183	3300031727	Bacteria	1400
305	Ga0307516_10000068	3300031730	Bacteria	111515
306	Ga0307516_10000706	3300031730	Bacteria	45397
307	Ga0307516_10011494	3300031730	Bacteria	9615
308	Ga0307516_10015589	3300031730	Bacteria	7991
309	Ga0307516_10050673	3300031730	Bacteria	4072
310	Ga0307405_10000872	3300031731	Bacteria	11917
311	Ga0307413_10012831	3300031824	Bacteria	4185
312	Ga0307406_10005288	3300031901	Bacteria	7060
313	Ga0307412_10013358	3300031911	Bacteria	4812
314	Ga0307412_10019709	3300031911	Bacteria	4092
315	Ga0307412_10133562	3300031911	Bacteria	1807
316	Ga0307416_100011331	3300032002	Bacteria	5937
317	Ga0307414_10040677	3300032004	Bacteria	3142
318	Ga0307414_10378675	3300032004	Bacteria	1223
319	Ga0307411_10000845	3300032005	Bacteria	11498
320	Ga0307411_10004430	3300032005	Bacteria	6723
321	Ga0307415_100016450	3300032126	Bacteria	4411
322	Ga0316580_10006454	3300032139	Bacteria	3466
323	Ga0307507_10012243	3300033179	Bacteria	10640
324	Ga0316592_1027533	3300033524	Bacteria	1229
325	Ga0316586_1020306	3300033527	Unclassified	1091
326	Ga0373934_0074553	3300035086	Bacteria	1359
327	Ga0373940_0022466	3300035088	Bacteria	1621
328	Ga0373939_0000029	3300035114	Bacteria	52306
329	Ga0373954_0053802	3300035118	Bacteria	1893
330	Ga0373960_0001521	3300035121	Bacteria	5158
331	Ga0316574_0135638	3300035398	Bacteria	1585
332	Ga0316574_0158244	3300035398	Bacteria	1459
333	Ga0373931_0001864	3300035691	Bacteria	9192
334	Ga0395899_0002459	3300037312	Bacteria	15041
335	Ga0395900_0009807	3300037418	Bacteria	9810
336	Ga0395900_0012927	3300037418	Bacteria	8528
337	Ga0395900_0064542	3300037418	Bacteria	3762
338	Ga0395898_0008981	3300037466	Bacteria	10526
339	Ga0395905_0000132	3300037471	Bacteria	123636
340	Ga0395905_0000613	3300037471	Bacteria	47773
341	Ga0395905_0009981	3300037471	Bacteria	9253
342	Ga0395905_0047814	3300037471	Bacteria	4008
343	Ga0395905_0067702	3300037471	Bacteria	3344
344	Ga0395905_0074256	3300037471	Bacteria	3187
345	Ga0395905_0079384	3300037471	Bacteria	3076
346	Ga0395905_0121111	3300037471	Bacteria	2459
347	Ga0436361_0062004	3300039447	Bacteria	42438
348	Ga0436361_0576920	3300039447	Bacteria	94641
349	Ga0436361_0657731	3300039447	Bacteria	46245
350	Ga0436361_0908337	3300039447	Bacteria	39649
351	Ga0436361_1013719	3300039447	Bacteria	2781
352	Ga0436361_1052276	3300039447	Bacteria	1634
353	Ga0439461_0003235	3300041410	Bacteria	2669
354	Ga0451791_0229544	3300041451	Bacteria	3337
355	Ga0451793_0826947	3300041452	Bacteria	3058
356	Ga0451793_1501464	3300041452	Bacteria	1562
357	Ga0451802_0374000	3300041460	Bacteria	1363
358	Ga0451807_2569176	3300041486	Bacteria	5587
359	Ga0451841_0459877	3300041498	Bacteria	1982
360	Ga0451843_0953232	3300041509	Bacteria	1455
361	Ga0451853_3715129	3300041512	Bacteria	2208
362	Ga0451853_3846431	3300041512	Bacteria	1653
363	Ga0450919_005516	3300042121	Bacteria	1517
364	Ga0450888_005745	3300042126	Bacteria	1332
365	Ga0450890_002202	3300042127	Bacteria	2710
366	Ga0450890_003506	3300042127	Bacteria	2084
367	Ga0450891_000160	3300042129	Bacteria	6383
368	Ga0450892_000173	3300042130	Bacteria	7496
369	Ga0450903_008517	3300042138	Bacteria	1676
370	Ga0450889_000523	3300042144	Bacteria	4278
371	Ga0450907_009946	3300042146	Bacteria	1577
372	Ga0439434_0007195	3300042435	Bacteria	3259
373	Ga0439459_0003513	3300042438	Bacteria	2496
374	Ga0450918_000397	3300042531	Bacteria	9473
375	Ga0451577_0000519	3300042876	Bacteria	64350
376	Ga0451577_0010627	3300042876	Bacteria	8774
377	Ga0451577_0011984	3300042876	Bacteria	8168
378	Ga0451577_0025984	3300042876	Bacteria	5306
379	Ga0451577_0029258	3300042876	Bacteria	4978
380	Ga0451577_0034908	3300042876	Bacteria	4531
381	Ga0451577_0036616	3300042876	Bacteria	4416
382	Ga0451577_0040398	3300042876	Bacteria	4188
383	Ga0451577_0065691	3300042876	Bacteria	3235
384	Ga0451577_0145316	3300042876	Bacteria	2132
385	Ga0451577_0165029	3300042876	Bacteria	1995
386	Ga0453683_0001936	3300044673	Bacteria	16847
387	Ga0453683_0043464	3300044673	Bacteria	2820
388	Ga0453683_0069657	3300044673	Bacteria	2199
389	Ga0466963_0041157	3300044694	Bacteria	3030
390	Ga0453684_0000005	3300044712	Bacteria	1431632
391	Ga0453684_0000296	3300044712	Bacteria	211075
392	Ga0453684_0000419	3300044712	Bacteria	173463
393	Ga0453684_0000917	3300044712	Bacteria	97990
394	Ga0453684_0002403	3300044712	Bacteria	45636
395	Ga0453684_0008979	3300044712	Bacteria	17663
396	Ga0453684_0031462	3300044712	Bacteria	7457
397	Ga0453684_0180539	3300044712	Bacteria	2478
398	Ga0453684_0185789	3300044712	Bacteria	2436
399	Ga0451576_0000325	3300045051	Bacteria	115644
400	Ga0451576_0000335	3300045051	Bacteria	113806
401	Ga0451576_0001402	3300045051	Bacteria	41365
402	Ga0451576_0010625	3300045051	Bacteria	10544
403	Ga0451576_0033644	3300045051	Bacteria	5448
404	Ga0451576_0035386	3300045051	Bacteria	5299
405	Ga0451576_0041456	3300045051	Bacteria	4867
406	Ga0451576_0071714	3300045051	Bacteria	3606
407	Ga0451576_0087554	3300045051	Bacteria	3239
408	Ga0451576_0507117	3300045051	Bacteria	1267
409	Ga0451576_0508387	3300045051	Bacteria	1266
410	Ga0451576_1047060	3300045051	Bacteria	855
411	Ga0495605_0010223	3300046474	Bacteria	5253
412	Ga0495596_0001460	3300046500	Bacteria	13531
413	Ga0495607_0009479	3300046501	Bacteria	6585
414	Ga0495606_0096189	3300046507	Bacteria	1812
415	Ga0495610_0027509	3300046512	Bacteria	3020
416	Ga0495610_0046941	3300046512	Bacteria	2127
417	Ga0495616_0035353	3300046513	Bacteria	2586
418	Ga0495630_0191324	3300046517	Bacteria	1561
419	Ga0495632_0028905	3300046519	Bacteria	2891
420	Ga0495643_0045076	3300046522	Bacteria	2395
421	Ga0495648_0070416	3300046524	Bacteria	2032
422	Ga0495609_0018892	3300046538	Bacteria	3192
423	Ga0495597_0000613	3300046542	Bacteria	29235
424	Ga0495625_0005656	3300046660	Bacteria	11326
425	Ga0495661_0074175	3300046665	Bacteria	1981
426	Ga0495669_0067935	3300046684	Bacteria	1621
427	Ga0495671_0002872	3300046692	Bacteria	10775
428	Ga0495673_0071077	3300047469	Bacteria	1464
429	Ga0495686_0009040	3300047472	Bacteria	7230
430	Ga0495615_0001284	3300048090	Bacteria	3674
431	Ga0496101_0134279	3300048904	Bacteria	1881
432	Ga0496103_0101209	3300048906	Bacteria	1824
433	Ga0496104_0067943	3300048907	Bacteria	3386
434	Ga0496105_0186710	3300048908	Bacteria	1696
435	Ga0496109_0128900	3300048912	Bacteria	2360
436	Ga0496114_0110350	3300048917	Bacteria	2356
437	Ga0496115_0056926	3300048918	Bacteria	3143
438	Ga0496116_0015160	3300048919	Bacteria	6110
439	Ga0496118_0032366	3300048921	Bacteria	4309
440	Ga0496121_0020387	3300048924	Bacteria	6568
441	Ga0496121_0048271	3300048924	Bacteria	3623
442	Ga0496121_0054986	3300048924	Bacteria	3321
443	Ga0496123_0007738	3300048926	Bacteria	10030
444	Ga0496124_0016024	3300048927	Bacteria	7154
445	Ga0496125_0065401	3300048928	Bacteria	2881
446	Ga0496125_0133765	3300048928	Bacteria	1739
447	Ga0501308_001875	3300049128	Bacteria	1763
448	Ga0501309_000398	3300049129	Bacteria	3395
449	Ga0501310_000784	3300049130	Bacteria	2820
450	Ga0501300_001793	3300049523	Bacteria	3204
451	Ga0501322_000198	3300049538	Bacteria	2532
452	Ga0501031_0001710	3300049568	Bacteria	13785
453	Ga0501037_0123772	3300049573	Bacteria	1858
454	Ga0501047_0471586	3300049581	Bacteria	1083
455	Ga0501198_000074	3300049649	Bacteria	24845
456	Ga0501217_009672	3300049661	Bacteria	2101
457	Ga0501222_000087	3300049662	Bacteria	24815
458	Ga0501233_027435	3300049668	Bacteria	1265
459	Ga0501257_016016	3300049686	Bacteria	1736
460	Ga0501258_000592	3300049687	Bacteria	2549
461	Ga0501221_000577	3300049704	Bacteria	5854
462	Ga0501229_000615	3300049706	Bacteria	4012
463	Ga0501232_000565	3300049757	Bacteria	2523
464	Ga0501267_000171	3300049764	Bacteria	4399
465	nmdc:mga03683_141575_c1	3300050489	Bacteria	1081
466	nmdc:mga0k408_148755_c1	3300050493	Bacteria	1394
467	nmdc:mga0k408_22057_c1	3300050493	Bacteria	3583
468	nmdc:mga07m45_115204_c1	3300050496	Bacteria	1550
469	nmdc:mga07m45_12016_c1	3300050496	Bacteria	4565
470	nmdc:mga05p37_140301_c1	3300050507	Bacteria	2961
471	Ga0500578_0002153	3300053086	Bacteria	17310
472	Ga0500644_0003670	3300053088	Bacteria	3810
473	Ga0500644_0009747	3300053088	Bacteria	2580
474	Ga0500651_0013330	3300053093	Bacteria	5006
475	Ga0500569_013159	3300053109	Bacteria	2019
476	Ga0500593_028848	3300053117	Bacteria	2479
477	Ga0500642_0029205	3300053130	Bacteria	2282
478	Ga0500652_000881	3300053131	Bacteria	9948
479	Ga0500658_0037385	3300053134	Bacteria	1931
480	Ga0500604_0013711	3300053151	Bacteria	2199
481	Ga0500604_0040444	3300053151	Bacteria	1405
482	Ga0500619_000047	3300053154	Bacteria	37681
483	Ga0500622_0000525	3300053156	Bacteria	35545
484	Ga0500622_0005018	3300053156	Bacteria	8065
485	Ga0500645_000155	3300053730	Bacteria	53212
486	Ga0500645_012193	3300053730	Bacteria	2782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300026121	Ga0207683_10578691	Ga0207683_105786913	230
2	3300031507	Ga0307509_10150685	Ga0307509_101506852	244
3	3300025924	Ga0207694_10204565	Ga0207694_102045652	253
4	3300005616	Ga0068852_100071430	Ga0068852_1000714304	260
5	3300026142	Ga0207698_10020841	Ga0207698_100208413	260
6	3300053151	Ga0500604_0040444	Ga0500604_0040444_149_1060	260
7	3300005295	Ga0065707_10081899	Ga0065707_1008189911	261
8	3300048924	Ga0496121_0054986	Ga0496121_0054986_704_1702	261
9	3300035398	Ga0316574_0135638	Ga0316574_0135638_560_1519	262
10	3300045051	Ga0451576_1047060	Ga0451576_1047060_14_832	262
11	3300031665	Ga0316575_10004710	Ga0316575_100047105	263
12	3300035086	Ga0373934_0074553	Ga0373934_0074553_286_1212	263
13	3300048904	Ga0496101_0134279	Ga0496101_0134279_318_1256	267
14	3300048907	Ga0496104_0067943	Ga0496104_0067943_929_1867	267
15	3300005331	Ga0070670_100121386	Ga0070670_1001213862	269
16	3300031548	Ga0307408_100095561	Ga0307408_1000955614	272
17	3300005295	Ga0065707_10091143	Ga0065707_100911432	273
18	3300049128	Ga0501308_001875	Ga0501308_001875_702_1595	273
19	3300049129	Ga0501309_000398	Ga0501309_000398_1330_2223	273
20	3300049130	Ga0501310_000784	Ga0501310_000784_1180_2073	273
21	3300049523	Ga0501300_001793	Ga0501300_001793_413_1306	273
22	3300049538	Ga0501322_000198	Ga0501322_000198_673_1566	273
23	3300049661	Ga0501217_009672	Ga0501217_009672_1164_2057	273
24	3300049668	Ga0501233_027435	Ga0501233_027435_72_965	273
25	3300049687	Ga0501258_000592	Ga0501258_000592_1021_1914	273
26	3300049704	Ga0501221_000577	Ga0501221_000577_1310_2203	273
27	3300049706	Ga0501229_000615	Ga0501229_000615_1622_2515	273
28	3300049757	Ga0501232_000565	Ga0501232_000565_1072_1965	273
29	3300049764	Ga0501267_000171	Ga0501267_000171_2268_3161	273
30	3300032004	Ga0307414_10040677	Ga0307414_100406772	274
31	3300032005	Ga0307411_10000845	Ga0307411_100008455	274
32	3300049649	Ga0501198_000074	Ga0501198_000074_3331_4242	274
33	3300049662	Ga0501222_000087	Ga0501222_000087_20604_21515	274
34	3300041410	Ga0439461_0003235	Ga0439461_0003235_1315_2208	275
35	3300042126	Ga0450888_005745	Ga0450888_005745_401_1294	275
36	3300042127	Ga0450890_002202	Ga0450890_002202_556_1449	275
37	3300042129	Ga0450891_000160	Ga0450891_000160_2255_3148	275
38	3300042130	Ga0450892_000173	Ga0450892_000173_4562_5455	275
39	3300042138	Ga0450903_008517	Ga0450903_008517_339_1232	275
40	3300042144	Ga0450889_000523	Ga0450889_000523_1289_2182	275
41	3300044673	Ga0453683_0043464	Ga0453683_0043464_158_1090	275
42	3300045051	Ga0451576_0033644	Ga0451576_0033644_3491_4423	275
43	3300003323	rootH1_10235071	rootH1_102350714	276
44	3300005459	Ga0068867_100000223	Ga0068867_10000022316	276
45	3300009148	Ga0105243_10020345	Ga0105243_100203455	276
46	3300014745	Ga0157377_10000029	Ga0157377_1000002924	276
47	3300025935	Ga0207709_10013493	Ga0207709_100134935	276
48	3300026089	Ga0207648_10000704	Ga0207648_1000070424	276
49	iso_pu_bacteria	2919497567	2919500104	276
50	3300031238	Ga0265332_10000010	Ga0265332_10000010124	277
51	3300031548	Ga0307408_100000010	Ga0307408_10000001013	277
52	3300045051	Ga0451576_0035386	Ga0451576_0035386_4200_5120	277
53	3300046517	Ga0495630_0191324	Ga0495630_0191324_274_1155	277
54	3300005366	Ga0070659_100179288	Ga0070659_1001792882	278
55	3300005614	Ga0068856_100062772	Ga0068856_1000627723	278
56	3300027665	Ga0209983_1023070	Ga0209983_10230702	278
57	3300035088	Ga0373940_0022466	Ga0373940_0022466_674_1594	278
58	3300035114	Ga0373939_0000029	Ga0373939_0000029_44968_45888	278
59	3300035121	Ga0373960_0001521	Ga0373960_0001521_1158_2078	278
60	3300035691	Ga0373931_0001864	Ga0373931_0001864_6626_7546	278
61	3300045051	Ga0451576_0507117	Ga0451576_0507117_331_1248	278
62	3300050496	nmdc:mga07m45_12016_c1	nmdc:mga07m45_12016_c1_1473_2393	278
63	iso_pu_bacteria	2526164512	2526213436	278
64	iso_pu_bacteria	2643221544	2643742274	279
65	iso_pu_bacteria	2643221585	2643937096	279
66	iso_pu_bacteria	2643221656	2644318261	279
67	3300005288	Ga0065714_10103580	Ga0065714_101035803	280
68	3300006177	Ga0075362_10049487	Ga0075362_100494872	280
69	3300025961	Ga0207712_10168938	Ga0207712_101689382	280
70	3300031507	Ga0307509_10001394	Ga0307509_1000139438	280
71	3300031548	Ga0307408_100004521	Ga0307408_1000045213	280
72	3300031616	Ga0307508_10308466	Ga0307508_103084661	280
73	3300031727	Ga0316576_10228183	Ga0316576_102281832	280
74	3300031730	Ga0307516_10000706	Ga0307516_1000070638	280
75	3300032139	Ga0316580_10006454	Ga0316580_100064545	280
76	3300033524	Ga0316592_1027533	Ga0316592_10275333	280
77	3300033527	Ga0316586_1020306	Ga0316586_10203062	280
78	3300035398	Ga0316574_0158244	Ga0316574_0158244_389_1282	280
79	3300042435	Ga0439434_0007195	Ga0439434_0007195_225_1118	280
80	3300048924	Ga0496121_0048271	Ga0496121_0048271_1573_2493	280
81	iso_pu_bacteria	2738541337	2739057012	280
82	iso_pu_bacteria	2831864461	2831868161	280
83	iso_pu_bacteria	2886848708	2886852897	280
84	3300005367	Ga0070667_100371226	Ga0070667_1003712263	281
85	3300005439	Ga0070711_100063098	Ga0070711_1000630983	281
86	3300005617	Ga0068859_100217291	Ga0068859_1002172913	281
87	3300006237	Ga0097621_100150784	Ga0097621_1001507844	281
88	3300006931	Ga0097620_100217277	Ga0097620_1002172773	281
89	3300009098	Ga0105245_10334032	Ga0105245_103340323	281
90	3300009551	Ga0105238_10062386	Ga0105238_100623865	281
91	3300010375	Ga0105239_10013435	Ga0105239_100134352	281
92	3300013296	Ga0157374_10545417	Ga0157374_105454171	281
93	3300013297	Ga0157378_10081196	Ga0157378_100811963	281
94	3300025916	Ga0207663_10050444	Ga0207663_100504443	281
95	3300025924	Ga0207694_10020682	Ga0207694_100206824	281
96	3300028794	Ga0307515_10007438	Ga0307515_100074389	281
97	3300031730	Ga0307516_10000068	Ga0307516_1000006855	281
98	3300035118	Ga0373954_0053802	Ga0373954_0053802_569_1507	281
99	3300042876	Ga0451577_0011984	Ga0451577_0011984_6099_7016	281
100	3300045051	Ga0451576_0000335	Ga0451576_0000335_55330_56283	281
101	3300045051	Ga0451576_0071714	Ga0451576_0071714_2058_3059	281
102	3300048906	Ga0496103_0101209	Ga0496103_0101209_907_1800	281
103	3300048908	Ga0496105_0186710	Ga0496105_0186710_739_1677	281
104	3300048917	Ga0496114_0110350	Ga0496114_0110350_832_1770	281
105	3300048918	Ga0496115_0056926	Ga0496115_0056926_1213_2151	281
106	3300048921	Ga0496118_0032366	Ga0496118_0032366_2994_3887	281
107	3300031344	Ga0265316_10327447	Ga0265316_103274471	282
108	3300031616	Ga0307508_10121840	Ga0307508_101218403	282
109	3300042876	Ga0451577_0036616	Ga0451577_0036616_1781_2779	282
110	3300042876	Ga0451577_0040398	Ga0451577_0040398_1624_2526	282
111	3300042876	Ga0451577_0165029	Ga0451577_0165029_138_1037	282
112	3300044712	Ga0453684_0000917	Ga0453684_0000917_21143_22042	282
113	3300044712	Ga0453684_0008979	Ga0453684_0008979_1440_2339	282
114	3300044712	Ga0453684_0180539	Ga0453684_0180539_1402_2301	282
115	3300045051	Ga0451576_0508387	Ga0451576_0508387_22_1035	282
116	iso_pu_bacteria	2585428057	2587729735	282
117	iso_pu_bacteria	2585428058	2587734200	282
118	iso_pu_bacteria	2588253510	2588293591	282
119	iso_pu_bacteria	2643221592	2643968275	282
120	iso_pu_bacteria	2643221625	2644143572	282
121	iso_pu_bacteria	2643221648	2644272053	282
122	iso_pu_bacteria	2738543013	2739249084	282
123	3300005328	Ga0070676_10154271	Ga0070676_101542712	283
124	3300005578	Ga0068854_100114654	Ga0068854_1001146543	283
125	3300005834	Ga0068851_10156267	Ga0068851_101562673	283
126	3300013297	Ga0157378_10000138	Ga0157378_1000013841	283
127	3300013297	Ga0157378_10586646	Ga0157378_105866462	283
128	3300025907	Ga0207645_10002677	Ga0207645_1000267715	283
129	3300025931	Ga0207644_10108804	Ga0207644_101088043	283
130	3300025960	Ga0207651_10250903	Ga0207651_102509032	283
131	3300026023	Ga0207677_10256282	Ga0207677_102562823	283
132	3300031250	Ga0265331_10029014	Ga0265331_100290143	283
133	3300045051	Ga0451576_0041456	Ga0451576_0041456_834_1799	283
134	iso_pu_bacteria	2998344455	2998346024	283
135	3300003320	rootH2_10204759	rootH2_102047592	284
136	3300003322	rootL2_10014620	rootL2_100146207	284
137	3300003323	rootH1_10009149	rootH1_100091493	284
138	3300003323	rootH1_10021813	rootH1_100218133	284
139	3300003323	rootH1_10171011	rootH1_101710112	284
140	3300003771	Ga0055526_1002864	Ga0055526_10028642	284
141	3300003775	Ga0055524_1000467	Ga0055524_100046728	284
142	3300003791	Ga0055530_10017831	Ga0055530_100178314	284
143	3300003792	Ga0055540_1017655	Ga0055540_10176552	284
144	3300003794	Ga0055531_10004642	Ga0055531_100046423	284
145	3300003794	Ga0055531_10006807	Ga0055531_100068076	284
146	3300005614	Ga0068856_100000986	Ga0068856_1000009869	284
147	3300005616	Ga0068852_100534556	Ga0068852_1005345561	284
148	3300006195	Ga0075366_10020268	Ga0075366_100202686	284
149	3300012497	Ga0157319_1000013	Ga0157319_100001310	284
150	3300025242	Ga0209258_111224	Ga0209258_1112242	284
151	3300025273	Ga0209673_1014212	Ga0209673_10142122	284
152	3300025273	Ga0209673_1031644	Ga0209673_10316442	284
153	3300025295	Ga0209564_1000051	Ga0209564_100005140	284
154	3300025298	Ga0209050_1003348	Ga0209050_100334813	284
155	3300025299	Ga0209256_1001137	Ga0209256_100113727	284
156	3300025299	Ga0209256_1001737	Ga0209256_100173719	284
157	3300025303	Ga0209051_1006395	Ga0209051_10063956	284
158	3300025304	Ga0209257_1001091	Ga0209257_10010917	284
159	3300025304	Ga0209257_1001249	Ga0209257_10012497	284
160	3300026078	Ga0207702_10002138	Ga0207702_100021383	284
161	3300031239	Ga0265328_10000027	Ga0265328_1000002725	284
162	3300031730	Ga0307516_10015589	Ga0307516_100155896	284
163	3300037471	Ga0395905_0009981	Ga0395905_0009981_7612_8508	284
164	3300042127	Ga0450890_003506	Ga0450890_003506_629_1531	284
165	3300042438	Ga0439459_0003513	Ga0439459_0003513_847_1749	284
166	3300044694	Ga0466963_0041157	Ga0466963_0041157_100_1002	284
167	3300044712	Ga0453684_0031462	Ga0453684_0031462_816_1715	284
168	3300048927	Ga0496124_0016024	Ga0496124_0016024_1331_2233	284
169	3300053156	Ga0500622_0005018	Ga0500622_0005018_6056_6958	284
170	iso_pu_bacteria	2585428062	2587756373	284
171	iso_pu_bacteria	2643221639	2644217926	284
172	iso_pu_bacteria	2643221646	2644258332	284
173	iso_pu_bacteria	2643221660	2644341348	284
174	iso_pu_bacteria	2842718218	2842720254	284
175	3300003215	JGI25153J46596_10004461	JGI25153J46596_100044618	285
176	3300025297	Ga0209758_1000078	Ga0209758_100007818	285
177	3300025304	Ga0209257_1012572	Ga0209257_10125724	285
178	3300026089	Ga0207648_10311886	Ga0207648_103118862	285
179	3300042876	Ga0451577_0029258	Ga0451577_0029258_310_1212	285
180	3300044673	Ga0453683_0001936	Ga0453683_0001936_4547_5449	285
181	3300045051	Ga0451576_0010625	Ga0451576_0010625_4137_5039	285
182	iso_pu_bacteria	2511231002	2511243820	285
183	iso_pu_bacteria	2881101125	2881105506	285
184	3300003322	rootL2_10018194	rootL2_100181942	286
185	3300005262	Ga0065165_1011549	Ga0065165_10115494	286
186	3300006353	Ga0075370_10070112	Ga0075370_100701124	286
187	3300025273	Ga0209673_1004650	Ga0209673_10046502	286
188	3300025298	Ga0209050_1002918	Ga0209050_100291810	286
189	3300025303	Ga0209051_1031883	Ga0209051_10318833	286
190	3300026023	Ga0207677_10213072	Ga0207677_102130722	286
191	3300041452	Ga0451793_0826947	Ga0451793_0826947_717_1628	286
192	3300041460	Ga0451802_0374000	Ga0451802_0374000_308_1216	286
193	3300042876	Ga0451577_0025984	Ga0451577_0025984_3525_4457	286
194	3300044712	Ga0453684_0000419	Ga0453684_0000419_35914_36891	286
195	3300046519	Ga0495632_0028905	Ga0495632_0028905_25_936	286
196	3300050496	nmdc:mga07m45_115204_c1	nmdc:mga07m45_115204_c1_628_1539	286
197	3300053086	Ga0500578_0002153	Ga0500578_0002153_5242_6153	286
198	3300053093	Ga0500651_0013330	Ga0500651_0013330_354_1265	286
199	3300053109	Ga0500569_013159	Ga0500569_013159_407_1318	286
200	3300053130	Ga0500642_0029205	Ga0500642_0029205_1140_2051	286
201	3300053131	Ga0500652_000881	Ga0500652_000881_1632_2543	286
202	3300053151	Ga0500604_0013711	Ga0500604_0013711_423_1334	286
203	3300053156	Ga0500622_0000525	Ga0500622_0000525_30718_31629	286
204	3300021361	Ga0213872_10031354	Ga0213872_100313541	287
205	3300025986	Ga0207658_10044834	Ga0207658_100448342	287
206	3300031730	Ga0307516_10050673	Ga0307516_100506736	287
207	3300037471	Ga0395905_0067702	Ga0395905_0067702_1605_2516	287
208	3300039447	Ga0436361_0576920	Ga0436361_0576920_8587_9516	287
209	3300041486	Ga0451807_2569176	Ga0451807_2569176_71_1009	287
210	3300041509	Ga0451843_0953232	Ga0451843_0953232_110_1048	287
211	3300042876	Ga0451577_0065691	Ga0451577_0065691_1669_2604	287
212	3300044712	Ga0453684_0002403	Ga0453684_0002403_21846_22847	287
213	3300045051	Ga0451576_0000325	Ga0451576_0000325_98900_99901	287
214	3300045051	Ga0451576_0001402	Ga0451576_0001402_23921_24856	287
215	3300046507	Ga0495606_0096189	Ga0495606_0096189_75_995	287
216	3300050489	nmdc:mga03683_141575_c1	nmdc:mga03683_141575_c1_99_1016	287
217	3300050493	nmdc:mga0k408_22057_c1	nmdc:mga0k408_22057_c1_496_1431	287
218	3300002773	JGI25152J39213_1000782	JGI25152J39213_10007825	288
219	3300002774	JGI25150J39212_1012533	JGI25150J39212_10125332	288
220	3300003215	JGI25153J46596_10002378	JGI25153J46596_100023784	288
221	3300003316	rootH1_10008535	rootH1_100085352	288
222	3300003761	Ga0055535_1000123	Ga0055535_100012338	288
223	3300003771	Ga0055526_1013399	Ga0055526_10133992	288
224	3300003791	Ga0055530_10024940	Ga0055530_100249403	288
225	3300003794	Ga0055531_10000064	Ga0055531_1000006428	288
226	3300005262	Ga0065165_1000074	Ga0065165_100007434	288
227	3300005327	Ga0070658_10210694	Ga0070658_102106943	288
228	3300005331	Ga0070670_100014925	Ga0070670_1000149252	288
229	3300005339	Ga0070660_100016021	Ga0070660_1000160212	288
230	3300005339	Ga0070660_100236568	Ga0070660_1002365682	288
231	3300005353	Ga0070669_100099256	Ga0070669_1000992561	288
232	3300005456	Ga0070678_100063692	Ga0070678_1000636924	288
233	3300005563	Ga0068855_100120767	Ga0068855_1001207674	288
234	3300005564	Ga0070664_100523283	Ga0070664_1005232831	288
235	3300005617	Ga0068859_100206035	Ga0068859_1002060353	288
236	3300005841	Ga0068863_100258346	Ga0068863_1002583463	288
237	3300005843	Ga0068860_100036135	Ga0068860_1000361354	288
238	3300006931	Ga0097620_100206028	Ga0097620_1002060283	288
239	3300009093	Ga0105240_10001225	Ga0105240_1000122530	288
240	3300009147	Ga0114129_10039251	Ga0114129_100392514	288
241	3300009148	Ga0105243_10067150	Ga0105243_100671502	288
242	3300014968	Ga0157379_10050057	Ga0157379_100500573	288
243	3300025245	Ga0207425_1003432	Ga0207425_10034326	288
244	3300025258	Ga0209129_1000043	Ga0209129_1000043132	288
245	3300025273	Ga0209673_1017693	Ga0209673_10176932	288
246	3300025295	Ga0209564_1000014	Ga0209564_1000014239	288
247	3300025297	Ga0209758_1000093	Ga0209758_100009386	288
248	3300025298	Ga0209050_1003108	Ga0209050_10031089	288
249	3300025303	Ga0209051_1020546	Ga0209051_10205464	288
250	3300025304	Ga0209257_1000032	Ga0209257_1000032547	288
251	3300025304	Ga0209257_1024298	Ga0209257_10242983	288
252	3300025919	Ga0207657_10025513	Ga0207657_100255132	288
253	3300025925	Ga0207650_10077115	Ga0207650_100771151	288
254	3300025935	Ga0207709_10025428	Ga0207709_100254282	288
255	3300025949	Ga0207667_10049546	Ga0207667_100495461	288
256	3300026088	Ga0207641_10119728	Ga0207641_101197282	288
257	3300026121	Ga0207683_10166912	Ga0207683_101669122	288
258	3300027526	Ga0209968_1000393	Ga0209968_10003936	288
259	3300027682	Ga0209971_1018342	Ga0209971_10183422	288
260	3300027695	Ga0209966_1000111	Ga0209966_100011125	288
261	3300027876	Ga0209974_10003750	Ga0209974_100037504	288
262	3300028379	Ga0268266_10155103	Ga0268266_101551032	288
263	3300028794	Ga0307515_10000006	Ga0307515_10000006100	288
264	3300028794	Ga0307515_10000645	Ga0307515_1000064530	288
265	3300028794	Ga0307515_10005856	Ga0307515_1000585622	288
266	3300028794	Ga0307515_10060136	Ga0307515_100601362	288
267	3300028794	Ga0307515_10145737	Ga0307515_101457374	288
268	3300030522	Ga0307512_10028671	Ga0307512_100286713	288
269	3300031235	Ga0265330_10000032	Ga0265330_1000003239	288
270	3300031238	Ga0265332_10000001	Ga0265332_1000000188	288
271	3300031241	Ga0265325_10003737	Ga0265325_100037372	288
272	3300031241	Ga0265325_10009531	Ga0265325_100095316	288
273	3300031241	Ga0265325_10058736	Ga0265325_100587363	288
274	3300031250	Ga0265331_10039477	Ga0265331_100394772	288
275	3300031344	Ga0265316_10029076	Ga0265316_100290765	288
276	3300031456	Ga0307513_10206133	Ga0307513_102061333	288
277	3300031507	Ga0307509_10024769	Ga0307509_100247695	288
278	3300031548	Ga0307408_100367098	Ga0307408_1003670981	288
279	3300031616	Ga0307508_10000684	Ga0307508_1000068421	288
280	3300031649	Ga0307514_10005730	Ga0307514_1000573011	288
281	3300031711	Ga0265314_10000022	Ga0265314_1000002288	288
282	3300031711	Ga0265314_10008153	Ga0265314_100081535	288
283	3300031730	Ga0307516_10011494	Ga0307516_100114946	288
284	3300031911	Ga0307412_10019709	Ga0307412_100197094	288
285	3300031911	Ga0307412_10133562	Ga0307412_101335622	288
286	3300033179	Ga0307507_10012243	Ga0307507_100122439	288
287	3300037312	Ga0395899_0002459	Ga0395899_0002459_13142_14056	288
288	3300037418	Ga0395900_0009807	Ga0395900_0009807_7352_8266	288
289	3300037418	Ga0395900_0064542	Ga0395900_0064542_901_1815	288
290	3300037466	Ga0395898_0008981	Ga0395898_0008981_1554_2468	288
291	3300037471	Ga0395905_0000132	Ga0395905_0000132_13721_14635	288
292	3300037471	Ga0395905_0047814	Ga0395905_0047814_1642_2556	288
293	3300037471	Ga0395905_0074256	Ga0395905_0074256_1982_2896	288
294	3300037471	Ga0395905_0079384	Ga0395905_0079384_1998_2912	288
295	3300041451	Ga0451791_0229544	Ga0451791_0229544_1946_2860	288
296	3300041452	Ga0451793_1501464	Ga0451793_1501464_26_943	288
297	3300041498	Ga0451841_0459877	Ga0451841_0459877_295_1212	288
298	3300041512	Ga0451853_3846431	Ga0451853_3846431_228_1142	288
299	3300042121	Ga0450919_005516	Ga0450919_005516_197_1114	288
300	3300042146	Ga0450907_009946	Ga0450907_009946_204_1121	288
301	3300042531	Ga0450918_000397	Ga0450918_000397_6802_7719	288
302	3300042876	Ga0451577_0000519	Ga0451577_0000519_44474_45469	288
303	3300042876	Ga0451577_0145316	Ga0451577_0145316_1136_2053	288
304	3300044673	Ga0453683_0069657	Ga0453683_0069657_459_1454	288
305	3300044712	Ga0453684_0000005	Ga0453684_0000005_1386136_1387131	288
306	3300044712	Ga0453684_0000296	Ga0453684_0000296_37111_38073	288
307	3300045051	Ga0451576_0087554	Ga0451576_0087554_1251_2168	288
308	3300046512	Ga0495610_0046941	Ga0495610_0046941_1187_2101	288
309	3300046522	Ga0495643_0045076	Ga0495643_0045076_894_1811	288
310	3300046542	Ga0495597_0000613	Ga0495597_0000613_1338_2252	288
311	3300046660	Ga0495625_0005656	Ga0495625_0005656_253_1167	288
312	3300050507	nmdc:mga05p37_140301_c1	nmdc:mga05p37_140301_c1_720_1643	288
313	3300053088	Ga0500644_0009747	Ga0500644_0009747_261_1175	288
314	3300053134	Ga0500658_0037385	Ga0500658_0037385_291_1205	288
315	3300053154	Ga0500619_000047	Ga0500619_000047_35154_36068	288
316	3300002704	JGI25155J39150_1000036	JGI25155J39150_100003636	289
317	3300002705	JGI25156J39149_1000047	JGI25156J39149_100004752	289
318	3300002738	JGI25154J39366_1000068	JGI25154J39366_100006852	289
319	3300002741	JGI25157J39369_1000066	JGI25157J39369_100006652	289
320	3300002987	JGI25159J45721_1002111	JGI25159J45721_10021113	289
321	3300002987	JGI25159J45721_1002272	JGI25159J45721_10022727	289
322	3300002987	JGI25159J45721_1003942	JGI25159J45721_10039426	289
323	3300003187	JGI25151J46595_10008912	JGI25151J46595_100089123	289
324	3300003187	JGI25151J46595_10025420	JGI25151J46595_100254202	289
325	3300003354	JGI25160J50197_1000331	JGI25160J50197_100033128	289
326	3300003354	JGI25160J50197_1000446	JGI25160J50197_100044628	289
327	3300003374	JGI25161J50226_1000064	JGI25161J50226_100006482	289
328	3300003773	Ga0055537_1000043	Ga0055537_100004372	289
329	3300003773	Ga0055537_1000046	Ga0055537_100004634	289
330	3300003773	Ga0055537_1008895	Ga0055537_10088952	289
331	3300003775	Ga0055524_1000012	Ga0055524_1000012185	289
332	3300003790	Ga0055528_1002287	Ga0055528_100228710	289
333	3300003791	Ga0055530_10000015	Ga0055530_1000001545	289
334	3300003791	Ga0055530_10051169	Ga0055530_100511691	289
335	3300003792	Ga0055540_1000039	Ga0055540_100003997	289
336	3300003794	Ga0055531_10021470	Ga0055531_100214702	289
337	3300004625	Ga0055543_1000284	Ga0055543_100028414	289
338	3300005262	Ga0065165_1008550	Ga0065165_10085505	289
339	3300005262	Ga0065165_1008562	Ga0065165_10085623	289
340	3300005262	Ga0065165_1026895	Ga0065165_10268952	289
341	3300005355	Ga0070671_100524901	Ga0070671_1005249011	289
342	3300005564	Ga0070664_100169949	Ga0070664_1001699492	289
343	3300006051	Ga0075364_10159228	Ga0075364_101592282	289
344	3300006195	Ga0075366_10048043	Ga0075366_100480432	289
345	3300006946	Ga0079104_1038028	Ga0079104_10380282	289
346	3300021361	Ga0213872_10000139	Ga0213872_1000013949	289
347	3300021361	Ga0213872_10000166	Ga0213872_1000016628	289
348	3300025206	Ga0209435_100001	Ga0209435_100001766	289
349	3300025245	Ga0207425_1004878	Ga0207425_10048784	289
350	3300025246	Ga0209646_1000001	Ga0209646_10000011135	289
351	3300025250	Ga0209026_1000003	Ga0209026_1000003766	289
352	3300025256	Ga0209759_1000001	Ga0209759_1000001766	289
353	3300025263	Ga0209565_1000004	Ga0209565_1000004450	289
354	3300025263	Ga0209565_1001352	Ga0209565_10013529	289
355	3300025273	Ga0209673_1000221	Ga0209673_100022181	289
356	3300025284	Ga0209130_1000094	Ga0209130_1000094121	289
357	3300025284	Ga0209130_1000855	Ga0209130_100085529	289
358	3300025291	Ga0209675_1000061	Ga0209675_100006150	289
359	3300025291	Ga0209675_1002958	Ga0209675_10029584	289
360	3300025292	Ga0209676_1000007	Ga0209676_1000007985	289
361	3300025292	Ga0209676_1035655	Ga0209676_10356552	289
362	3300025294	Ga0209025_1007278	Ga0209025_10072784	289
363	3300025294	Ga0209025_1020430	Ga0209025_10204304	289
364	3300025295	Ga0209564_1000681	Ga0209564_100068115	289
365	3300025295	Ga0209564_1002295	Ga0209564_100229515	289
366	3300025298	Ga0209050_1000003	Ga0209050_1000003522	289
367	3300025298	Ga0209050_1006588	Ga0209050_10065884	289
368	3300025298	Ga0209050_1012967	Ga0209050_10129673	289
369	3300025299	Ga0209256_1000001	Ga0209256_1000001517	289
370	3300025299	Ga0209256_1050478	Ga0209256_10504781	289
371	3300025302	Ga0207426_1000025	Ga0207426_1000025438	289
372	3300025303	Ga0209051_1000003	Ga0209051_1000003522	289
373	3300025304	Ga0209257_1000018	Ga0209257_1000018522	289
374	3300025304	Ga0209257_1010481	Ga0209257_10104813	289
375	3300026142	Ga0207698_10050447	Ga0207698_100504473	289
376	3300028794	Ga0307515_10001095	Ga0307515_1000109534	289
377	3300031456	Ga0307513_10001949	Ga0307513_1000194911	289
378	3300031456	Ga0307513_10072473	Ga0307513_100724732	289
379	3300031548	Ga0307408_100000924	Ga0307408_1000009241	289
380	3300031649	Ga0307514_10000528	Ga0307514_1000052840	289
381	3300031712	Ga0265342_10011592	Ga0265342_100115927	289
382	3300031731	Ga0307405_10000872	Ga0307405_100008724	289
383	3300031824	Ga0307413_10012831	Ga0307413_100128313	289
384	3300031901	Ga0307406_10005288	Ga0307406_100052887	289
385	3300031911	Ga0307412_10013358	Ga0307412_100133584	289
386	3300032002	Ga0307416_100011331	Ga0307416_1000113314	289
387	3300032004	Ga0307414_10378675	Ga0307414_103786751	289
388	3300032005	Ga0307411_10004430	Ga0307411_100044306	289
389	3300032126	Ga0307415_100016450	Ga0307415_1000164502	289
390	3300037471	Ga0395905_0000613	Ga0395905_0000613_31221_32138	289
391	3300037471	Ga0395905_0121111	Ga0395905_0121111_44_961	289
392	3300039447	Ga0436361_0062004	Ga0436361_0062004_16889_17812	289
393	3300039447	Ga0436361_0657731	Ga0436361_0657731_14996_15955	289
394	3300039447	Ga0436361_1013719	Ga0436361_1013719_628_1551	289
395	3300039447	Ga0436361_1052276	Ga0436361_1052276_301_1269	289
396	3300041512	Ga0451853_3715129	Ga0451853_3715129_668_1585	289
397	3300042876	Ga0451577_0010627	Ga0451577_0010627_1410_2345	289
398	3300047472	Ga0495686_0009040	Ga0495686_0009040_1046_1963	289
399	3300048090	Ga0495615_0001284	Ga0495615_0001284_371_1288	289
400	3300048912	Ga0496109_0128900	Ga0496109_0128900_860_1783	289
401	3300049568	Ga0501031_0001710	Ga0501031_0001710_1769_2692	289
402	3300049573	Ga0501037_0123772	Ga0501037_0123772_441_1361	289
403	3300049581	Ga0501047_0471586	Ga0501047_0471586_84_1001	289
404	3300049686	Ga0501257_016016	Ga0501257_016016_89_1006	289
405	3300050493	nmdc:mga0k408_148755_c1	nmdc:mga0k408_148755_c1_391_1305	289
406	3300053088	Ga0500644_0003670	Ga0500644_0003670_1446_2369	289
407	3300053117	Ga0500593_028848	Ga0500593_028848_1352_2275	289
408	3300053730	Ga0500645_000155	Ga0500645_000155_33114_34031	289
409	3300053730	Ga0500645_012193	Ga0500645_012193_618_1541	289
410	3300003759	Ga0055525_1000013	Ga0055525_1000013107	290
411	3300003794	Ga0055531_10000536	Ga0055531_100005367	290
412	3300021361	Ga0213872_10000396	Ga0213872_1000039622	290
413	3300025230	Ga0209563_100025	Ga0209563_100025479	290
414	3300025273	Ga0209673_1021563	Ga0209673_10215633	290
415	3300025303	Ga0209051_1000491	Ga0209051_100049134	290
416	3300025304	Ga0209257_1000137	Ga0209257_1000137185	290
417	3300025942	Ga0207689_10411540	Ga0207689_104115401	290
418	3300039447	Ga0436361_0908337	Ga0436361_0908337_25700_26656	290
419	iso_pu_bacteria	2513237150	2513955035	290
420	iso_pu_bacteria	2513237165	2514041389	290
421	iso_pu_bacteria	2901300506	2901302314	290
422	iso_pu_bacteria	644736347	644748168	290
423	3300025245	Ga0207425_1010381	Ga0207425_10103811	292
424	3300025294	Ga0209025_1010711	Ga0209025_10107116	292
425	3300025303	Ga0209051_1021640	Ga0209051_10216402	292
426	3300042876	Ga0451577_0034908	Ga0451577_0034908_2302_3279	292
427	3300044712	Ga0453684_0185789	Ga0453684_0185789_964_1941	292
428	3300003187	JGI25151J46595_10002855	JGI25151J46595_100028558	293
429	3300003771	Ga0055526_1004256	Ga0055526_10042568	293
430	3300003771	Ga0055526_1011734	Ga0055526_10117344	293
431	3300003781	Ga0055536_1000060	Ga0055536_100006066	293
432	3300003784	Ga0055534_1001551	Ga0055534_10015518	293
433	3300006948	Ga0099826_10000020	Ga0099826_1000002092	293
434	3300009011	Ga0105251_10012131	Ga0105251_100121313	293
435	3300025263	Ga0209565_1002772	Ga0209565_10027726	293
436	3300025291	Ga0209675_1000317	Ga0209675_100031732	293
437	3300025291	Ga0209675_1011600	Ga0209675_10116004	293
438	3300025292	Ga0209676_1000012	Ga0209676_100001241	293
439	3300025294	Ga0209025_1001987	Ga0209025_100198717	293
440	3300025294	Ga0209025_1002566	Ga0209025_100256610	293
441	3300025295	Ga0209564_1001788	Ga0209564_100178811	293
442	3300025295	Ga0209564_1002691	Ga0209564_10026919	293
443	3300025303	Ga0209051_1006234	Ga0209051_10062344	293
444	3300025735	Ga0207713_1032461	Ga0207713_10324612	293
445	3300027666	Ga0209282_1000053	Ga0209282_1000053114	293
446	3300046474	Ga0495605_0010223	Ga0495605_0010223_1575_2489	293
447	3300046500	Ga0495596_0001460	Ga0495596_0001460_1532_2446	293
448	3300046501	Ga0495607_0009479	Ga0495607_0009479_1413_2327	293
449	3300046512	Ga0495610_0027509	Ga0495610_0027509_491_1405	293
450	3300046513	Ga0495616_0035353	Ga0495616_0035353_1529_2443	293
451	3300046524	Ga0495648_0070416	Ga0495648_0070416_293_1207	293
452	3300046538	Ga0495609_0018892	Ga0495609_0018892_1232_2146	293
453	3300046665	Ga0495661_0074175	Ga0495661_0074175_403_1317	293
454	3300046684	Ga0495669_0067935	Ga0495669_0067935_208_1122	293
455	3300046692	Ga0495671_0002872	Ga0495671_0002872_8826_9740	293
456	3300047469	Ga0495673_0071077	Ga0495673_0071077_41_955	293
457	3300048919	Ga0496116_0015160	Ga0496116_0015160_1531_2445	293
458	3300048924	Ga0496121_0020387	Ga0496121_0020387_1221_2135	293
459	3300048926	Ga0496123_0007738	Ga0496123_0007738_5843_6757	293
460	3300048928	Ga0496125_0133765	Ga0496125_0133765_680_1594	293
461	3300003187	JGI25151J46595_10003262	JGI25151J46595_100032627	294
462	3300003773	Ga0055537_1005962	Ga0055537_10059624	294
463	3300003775	Ga0055524_1000664	Ga0055524_100066411	294
464	3300003784	Ga0055534_1001444	Ga0055534_10014446	294
465	3300025263	Ga0209565_1000092	Ga0209565_100009298	294
466	3300025273	Ga0209673_1015266	Ga0209673_10152664	294
467	3300025291	Ga0209675_1001536	Ga0209675_100153610	294
468	3300025294	Ga0209025_1004250	Ga0209025_10042507	294
469	3300001915	JGI24741J21665_1000619	JGI24741J21665_100061910	296
470	3300001979	JGI24740J21852_10001129	JGI24740J21852_1000112910	296
471	3300003752	Ga0055539_1000247	Ga0055539_100024710	296
472	3300003756	Ga0055533_1002919	Ga0055533_10029195	296
473	3300003758	Ga0055532_1000002	Ga0055532_100000267	296
474	3300003758	Ga0055532_1000029	Ga0055532_1000029114	296
475	3300003759	Ga0055525_1000496	Ga0055525_100049610	296
476	3300003760	Ga0055527_1000309	Ga0055527_10003099	296
477	3300003763	Ga0055529_1000062	Ga0055529_100006283	296
478	3300003841	Ga0055541_1000312	Ga0055541_10003122	296
479	3300005344	Ga0070661_100000077	Ga0070661_10000007722	296
480	3300005455	Ga0070663_100000011	Ga0070663_10000001140	296
481	3300005564	Ga0070664_100000002	Ga0070664_10000000219	296
482	3300005577	Ga0068857_100005940	Ga0068857_1000059408	296
483	3300005578	Ga0068854_100000043	Ga0068854_10000004367	296
484	3300005614	Ga0068856_100000009	Ga0068856_10000000916	296
485	3300013102	Ga0157371_10000068	Ga0157371_1000006822	296
486	3300013104	Ga0157370_10001168	Ga0157370_100011689	296
487	3300013105	Ga0157369_10006584	Ga0157369_100065849	296
488	3300013307	Ga0157372_10001313	Ga0157372_1000131311	296
489	3300015261	Ga0182006_1002380	Ga0182006_10023809	296
490	3300020610	Ga0154015_1189915	Ga0154015_118991520	296
491	3300025224	Ga0209784_100003	Ga0209784_100003644	296
492	3300025225	Ga0209566_100002	Ga0209566_1000021686	296
493	3300025225	Ga0209566_100824	Ga0209566_1008247	296
494	3300025226	Ga0209674_100008	Ga0209674_100008502	296
495	3300025228	Ga0209672_100052	Ga0209672_10005264	296
496	3300025229	Ga0209147_100002	Ga0209147_1000021599	296
497	3300025230	Ga0209563_100004	Ga0209563_1000041100	296
498	3300025242	Ga0209258_100002	Ga0209258_1000021599	296
499	3300025253	Ga0209677_100009	Ga0209677_100009532	296
500	3300025254	Ga0209148_1002335	Ga0209148_10023352	296
501	3300025256	Ga0209759_1011304	Ga0209759_10113044	296
502	3300025272	Ga0209455_1000021	Ga0209455_1000021186	296
503	3300025913	Ga0207695_10000829	Ga0207695_1000082925	296
504	3300025920	Ga0207649_10000533	Ga0207649_100005332	296
505	3300025945	Ga0207679_10000001	Ga0207679_10000001192	296
506	3300025981	Ga0207640_10000035	Ga0207640_10000035122	296
507	3300026067	Ga0207678_10000001	Ga0207678_10000001241	296
508	3300026078	Ga0207702_10000301	Ga0207702_1000030138	296
509	3300026116	Ga0207674_10004681	Ga0207674_1000468110	296
510	3300037418	Ga0395900_0012927	Ga0395900_0012927_77_1000	296
511	3300048928	Ga0496125_0065401	Ga0496125_0065401_1306_2229	296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14715

FixP_N

N-terminal domain of cytochrome oxidase-cbb3, FixP

43

91

0.96 PF00034

Cytochrom_C

Cytochrome c

136

214

0.9 PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

133

210

0.86 PF00034

Cytochrom_C

Cytochrome c

223

301

0.82 PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

222

298

0.79 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2zoo-assembly1.cif.gz_A	crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125	0.829	122	177
5obo-assembly1.cif.gz_A	crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii	0.8108	126	177
2c8s-assembly1.cif.gz_A	cytochrome cl from methylobacterium extorquens	0.8017	106	169
3zbm-assembly1.cif.gz_A	structure of m92a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii	0.8014	126	178
6qpz-assembly2.cif.gz_I	crystal structure of as isolated y323e mutant of haem-cu containing nitrite reductase from ralstonia pickettii	0.8	126	178

ID	Description	Score	Start	End	Superfamily
3mk7C02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.9279	86	288	1.10.760.10
3mk7M03	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.917	177	258	1.10.760.10
3mk7C02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.9128	86	288	1.10.760.10
2zooA02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.829	122	177	1.10.760.10
3mk7M03	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.8224	177	258	1.10.760.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2P7P329-F1-model_v4	deleted	0.993	190	289
AF-A0A7Y2UED4-F1-model_v4	C-type cytochrome	0.9857	156	287	GO:0009055 GO:0020037 GO:0046872
AF-A0A3A0EZQ6-F1-model_v4	Cytochrome C oxidase Cbb3	0.9789	149	290	GO:0009055 GO:0020037 GO:0046872
AF-A0A0B8Q7J7-F1-model_v4	Cytochrome c oxidase subunit ccoP (EC 1.9.3.1)	0.9747	130	289	GO:0005506 GO:0009055 GO:0016491 GO:0020037
AF-A0A3M1IWX6-F1-model_v4	Cytochrome C oxidase Cbb3	0.9742	195	290	GO:0005506 GO:0009055 GO:0020037

Feature Viewer

pLDDT	pTM	Quality
82.46	0.67	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F457320

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF14715

FixP_N

N-terminal domain of cytochrome oxidase-cbb3, FixP

43

91

0.96

PF00034

Cytochrom_C

Cytochrome c

136

214

0.9

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

133

210

0.86

PF00034

Cytochrom_C

Cytochrome c

223

301

0.82

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

222

298

0.79

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map