F457350

General Info

Members Datasets Scaffolds Average Seq Length
511 237 1022 509

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_154256_c1|nmdc:mga05p37_154256_c1_883_2238
Length 439
Sequence MDEQVVPGDGVVAGVGRVDGRPVYAFAQDFTVFGGSLSETNAAKIVKIMDLAVKMGAPVVGLNDSGGARIQEGVLSLGGYADIFLRNTLASGVIPQISAIMGPCAGGAVYSPAITDFIVMVKQSSYMFITGPDVIKTVTHEDVSMEDLGGAMTHNEKSGVAHFAVEDDAECIALIRELLSFMPDNNLDDPPRKATTLVPASPNQPYDMLDLIHTIADEGYFLEVHQHYAKNIVVGFARLGGRPVGVVANQPAHLAGTLDINASVKGARFVRFCDAFNIPLITFEDVPGFLPGTVQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYCVMASKHIRTDFNYAWPSAEIAVMGAEGAVNILYKREIEKSADPAAMRAQKIGEFRDRFASPYVAAERGYIDEVILPRMTRAKLVQALATLDHKRDKNPPKKHGNIPL

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.13
Nodule 0
Rhizoplane 3.33
Rhizosphere 93.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_154256_c1 3300050507 Bacteria 2807
2 JGI24751J29686_10005675 3300002459 Bacteria 2543
3 JGI25406J46586_10007699 3300003203 Bacteria 4899
4 Ga0065712_10001865 3300005290 Bacteria 12263
5 Ga0065712_10068417 3300005290 Bacteria 10780
6 Ga0065712_10068680 3300005290 Bacteria 9413
7 Ga0065712_10077523 3300005290 Bacteria 3482
8 Ga0065712_10079275 3300005290 Bacteria 3238
9 Ga0065712_10089783 3300005290 Bacteria 2453
10 Ga0065712_10104388 3300005290 Bacteria 1953
11 Ga0065715_10099172 3300005293 Bacteria 3448
12 Ga0065715_10101548 3300005293 Bacteria 3193
13 Ga0065715_10107958 3300005293 Bacteria 2743
14 Ga0065707_10001522 3300005295 Bacteria 8991
15 Ga0065707_10002910 3300005295 Bacteria 9923
16 Ga0065707_10097767 3300005295 Bacteria 3144
17 Ga0065707_10105067 3300005295 Bacteria 2660
18 Ga0070676_10010750 3300005328 Bacteria 4966
19 Ga0070670_100011093 3300005331 Bacteria 7698
20 Ga0070670_100014785 3300005331 Bacteria 6698
21 Ga0070670_100017601 3300005331 Bacteria 6133
22 Ga0070670_100023960 3300005331 Bacteria 5250
23 Ga0068869_100000256 3300005334 Bacteria 28007
24 Ga0070666_10136307 3300005335 Bacteria 1708
25 Ga0070660_100013139 3300005339 Bacteria 5932
26 Ga0070689_100007394 3300005340 Bacteria 7675
27 Ga0070689_100071424 3300005340 Bacteria 2712
28 Ga0070689_100133210 3300005340 Bacteria 1994
29 Ga0070691_10012035 3300005341 Bacteria 3962
30 Ga0070687_100028003 3300005343 Bacteria 2728
31 Ga0070669_100002881 3300005353 Bacteria 12405
32 Ga0070669_100079022 3300005353 Bacteria 2446
33 Ga0070675_100000311 3300005354 Bacteria 32685
34 Ga0070675_100002200 3300005354 Bacteria 14456
35 Ga0070675_100002452 3300005354 Bacteria 13868
36 Ga0070675_100007377 3300005354 Bacteria 8493
37 Ga0070674_100000735 3300005356 Bacteria 16733
38 Ga0070674_100001848 3300005356 Bacteria 11486
39 Ga0070674_100002130 3300005356 Bacteria 10872
40 Ga0070674_100131485 3300005356 Bacteria 1866
41 Ga0070673_100018890 3300005364 Bacteria 4940
42 Ga0070673_100172743 3300005364 Bacteria 1845
43 Ga0070688_100006975 3300005365 Bacteria 6071
44 Ga0070659_100010629 3300005366 Bacteria 6778
45 Ga0070667_100028989 3300005367 Bacteria 4609
46 Ga0070667_100095032 3300005367 Bacteria 2569
47 Ga0070714_100005034 3300005435 Bacteria 10049
48 Ga0070701_10003990 3300005438 Bacteria 5910
49 Ga0070705_100079626 3300005440 Bacteria 2007
50 Ga0070708_100000002 3300005445 Bacteria 195857
51 Ga0070678_100020951 3300005456 Bacteria 4300
52 Ga0070678_100024033 3300005456 Bacteria 4072
53 Ga0070678_100030823 3300005456 Bacteria 3691
54 Ga0070662_100073925 3300005457 Bacteria 2520
55 Ga0070681_10019926 3300005458 Bacteria 6720
56 Ga0070681_10067199 3300005458 Bacteria 3553
57 Ga0068867_100011691 3300005459 Bacteria 6198
58 Ga0070706_100091154 3300005467 Bacteria 2827
59 Ga0070698_100001813 3300005471 Bacteria 23753
60 Ga0070698_100002188 3300005471 Bacteria 21703
61 Ga0070698_100006892 3300005471 Bacteria 12313
62 Ga0070698_100018706 3300005471 Bacteria 7293
63 Ga0070698_100136158 3300005471 Bacteria 2410
64 Ga0070698_100153230 3300005471 Bacteria 2251
65 Ga0070699_100000980 3300005518 Bacteria 26618
66 Ga0070699_100001754 3300005518 Bacteria 19774
67 Ga0070699_100004768 3300005518 Bacteria 11989
68 Ga0070684_100015248 3300005535 Bacteria 6252
69 Ga0070684_100024056 3300005535 Bacteria 5106
70 Ga0070684_100075794 3300005535 Bacteria 2968
71 Ga0070697_100027184 3300005536 Bacteria 4575
72 Ga0070697_100078283 3300005536 Bacteria 2720
73 Ga0070672_100015797 3300005543 Bacteria 5390
74 Ga0070672_100030420 3300005543 Bacteria 4056
75 Ga0070686_100004936 3300005544 Bacteria 7355
76 Ga0070686_100028383 3300005544 Bacteria 3394
77 Ga0070686_100066538 3300005544 Bacteria 2344
78 Ga0070686_100138756 3300005544 Bacteria 1690
79 Ga0070695_100031758 3300005545 Bacteria 3297
80 Ga0070696_100060492 3300005546 Bacteria 2648
81 Ga0070693_100021406 3300005547 Bacteria 3425
82 Ga0070665_100001061 3300005548 Bacteria 34294
83 Ga0070665_100112265 3300005548 Bacteria 2728
84 Ga0070704_100003231 3300005549 Bacteria 9316
85 Ga0070704_100036021 3300005549 Bacteria 3367
86 Ga0068855_100040709 3300005563 Bacteria 5513
87 Ga0070664_100000832 3300005564 Bacteria 23806
88 Ga0070664_100031404 3300005564 Bacteria 4438
89 Ga0070664_100048400 3300005564 Bacteria 3593
90 Ga0070664_100155113 3300005564 Bacteria 2023
91 Ga0068857_100029433 3300005577 Bacteria 4847
92 Ga0068854_100002437 3300005578 Bacteria 11500
93 Ga0068854_100006157 3300005578 Bacteria 7616
94 Ga0070702_100050355 3300005615 Bacteria 2379
95 Ga0068859_100013874 3300005617 Bacteria 8081
96 Ga0068859_100018112 3300005617 Bacteria 7079
97 Ga0068859_100029054 3300005617 Bacteria 5547
98 Ga0068864_100009517 3300005618 Bacteria 8019
99 Ga0068864_100030550 3300005618 Bacteria 4567
100 Ga0068866_10002372 3300005718 Bacteria 7813
101 Ga0068861_100028062 3300005719 Bacteria 4105
102 Ga0068861_100161312 3300005719 Bacteria 1850
103 Ga0068851_10008332 3300005834 Bacteria 4793
104 Ga0068863_100031041 3300005841 Bacteria 5102
105 Ga0068863_100044292 3300005841 Bacteria 4225
106 Ga0068863_100067747 3300005841 Bacteria 3377
107 Ga0068858_100006773 3300005842 Bacteria 11149
108 Ga0068858_100132773 3300005842 Bacteria 2335
109 Ga0068860_100064216 3300005843 Bacteria 3487
110 Ga0068862_100044485 3300005844 Bacteria 3787
111 Ga0068862_100048217 3300005844 Bacteria 3636
112 Ga0081539_10000110 3300005985 Bacteria 190555
113 Ga0075365_10011620 3300006038 Bacteria 5187
114 Ga0075365_10044558 3300006038 Bacteria 2908
115 Ga0075368_10032959 3300006042 Bacteria 2014
116 Ga0075362_10001435 3300006177 Bacteria 7610
117 Ga0075367_10001698 3300006178 Bacteria 9630
118 Ga0075366_10045956 3300006195 Bacteria 2587
119 Ga0097621_100016903 3300006237 Bacteria 5530
120 Ga0068871_100001984 3300006358 Bacteria 13869
121 Ga0068871_100132725 3300006358 Bacteria 2112
122 Ga0075428_100000030 3300006844 Bacteria 119551
123 Ga0075428_100000673 3300006844 Bacteria 35072
124 Ga0075428_100000931 3300006844 Bacteria 30952
125 Ga0075428_100006014 3300006844 Bacteria 13480
126 Ga0075428_100008375 3300006844 Bacteria 11464
127 Ga0075428_100008632 3300006844 Bacteria 11301
128 Ga0075428_100026750 3300006844 Bacteria 6388
129 Ga0075428_100038724 3300006844 Bacteria 5246
130 Ga0075428_100112270 3300006844 Bacteria 2968
131 Ga0075430_100000398 3300006846 Bacteria 32154
132 Ga0075430_100002425 3300006846 Bacteria 15524
133 Ga0075430_100009976 3300006846 Bacteria 8035
134 Ga0075431_100001977 3300006847 Bacteria 19558
135 Ga0075431_100012354 3300006847 Bacteria 8618
136 Ga0075431_100016547 3300006847 Bacteria 7485
137 Ga0075431_100018355 3300006847 Bacteria 7123
138 Ga0075431_100112615 3300006847 Bacteria 2808
139 Ga0075433_10044987 3300006852 Bacteria 3836
140 Ga0075434_100002491 3300006871 Bacteria 16225
141 Ga0075434_100003288 3300006871 Bacteria 14448
142 Ga0075434_100108317 3300006871 Bacteria 2789
143 Ga0075429_100004255 3300006880 Bacteria 12272
144 Ga0075429_100005123 3300006880 Bacteria 11271
145 Ga0075429_100006190 3300006880 Bacteria 10349
146 Ga0075429_100030035 3300006880 Bacteria 4721
147 Ga0068865_100073067 3300006881 Bacteria 2438
148 Ga0075436_100002164 3300006914 Bacteria 13538
149 Ga0075436_100038228 3300006914 Bacteria 3312
150 Ga0097620_100013874 3300006931 Bacteria 8081
151 Ga0097620_100018112 3300006931 Bacteria 7079
152 Ga0097620_100029055 3300006931 Bacteria 5547
153 Ga0075435_100000034 3300007076 Bacteria 70048
154 Ga0075435_100000542 3300007076 Bacteria 23134
155 Ga0075435_100012725 3300007076 Bacteria 6234
156 Ga0075435_100030226 3300007076 Bacteria 4257
157 Ga0075435_100039586 3300007076 Bacteria 3762
158 Ga0075435_100106714 3300007076 Bacteria 2326
159 Ga0111539_10000015 3300009094 Bacteria 296576
160 Ga0111539_10000174 3300009094 Bacteria 74442
161 Ga0111539_10000657 3300009094 Bacteria 44621
162 Ga0111539_10002052 3300009094 Bacteria 26949
163 Ga0111539_10002159 3300009094 Bacteria 26325
164 Ga0111539_10042646 3300009094 Bacteria 5446
165 Ga0111539_10108842 3300009094 Bacteria 3252
166 Ga0111539_10116685 3300009094 Bacteria 3130
167 Ga0105245_10043479 3300009098 Bacteria 4007
168 Ga0105245_10147065 3300009098 Bacteria 2224
169 Ga0114129_10000288 3300009147 Bacteria 58119
170 Ga0114129_10000581 3300009147 Bacteria 45128
171 Ga0114129_10001174 3300009147 Bacteria 34722
172 Ga0114129_10006497 3300009147 Bacteria 16580
173 Ga0114129_10058684 3300009147 Bacteria 5382
174 Ga0114129_10095275 3300009147 Bacteria 4122
175 Ga0105243_10013558 3300009148 Bacteria 6166
176 Ga0105243_10049415 3300009148 Bacteria 3318
177 Ga0105242_10006802 3300009176 Bacteria 8818
178 Ga0105242_10007503 3300009176 Bacteria 8391
179 Ga0105248_10019397 3300009177 Bacteria 7523
180 Ga0105248_10143370 3300009177 Bacteria 2695
181 Ga0105237_10081662 3300009545 Bacteria 3223
182 Ga0105238_10002716 3300009551 Bacteria 17617
183 Ga0105249_10001257 3300009553 Bacteria 22240
184 Ga0105249_10052897 3300009553 Bacteria 3710
185 Ga0157374_10087859 3300013296 Bacteria 2960
186 Ga0163162_10024574 3300013306 Bacteria 5950
187 Ga0163163_10000005 3300014325 Bacteria 369548
188 Ga0163163_10015247 3300014325 Bacteria 7100
189 Ga0163163_10033344 3300014325 Bacteria 4981
190 Ga0163163_10041293 3300014325 Bacteria 4510
191 Ga0157380_10000415 3300014326 Bacteria 25998
192 Ga0157380_10000549 3300014326 Bacteria 23122
193 Ga0157380_10031476 3300014326 Bacteria 4073
194 Ga0157380_10040295 3300014326 Bacteria 3637
195 Ga0157380_10081845 3300014326 Bacteria 2642
196 Ga0157377_10058027 3300014745 Bacteria 2203
197 Ga0157376_10074275 3300014969 Bacteria 2898
198 Ga0206356_11870653 3300020070 Bacteria 1974
199 Ga0207697_10008950 3300025315 Bacteria 4349
200 Ga0207656_10005665 3300025321 Bacteria 4435
201 Ga0207682_10013055 3300025893 Bacteria 3239
202 Ga0207682_10024964 3300025893 Bacteria 2369
203 Ga0207642_10004075 3300025899 Bacteria 4681
204 Ga0207688_10016857 3300025901 Bacteria 3967
205 Ga0207680_10037340 3300025903 Bacteria 2804
206 Ga0207645_10005378 3300025907 Bacteria 9299
207 Ga0207684_10008593 3300025910 Bacteria 9079
208 Ga0207684_10067468 3300025910 Bacteria 3040
209 Ga0207707_10016097 3300025912 Bacteria 6521
210 Ga0207707_10029951 3300025912 Bacteria 4759
211 Ga0207707_10055167 3300025912 Bacteria 3457
212 Ga0207695_10141094 3300025913 Bacteria 2358
213 Ga0207671_10068672 3300025914 Bacteria 2641
214 Ga0207662_10003753 3300025918 Bacteria 7875
215 Ga0207657_10008592 3300025919 Bacteria 10343
216 Ga0207652_10021929 3300025921 Bacteria 5277
217 Ga0207646_10092831 3300025922 Bacteria 2702
218 Ga0207681_10062183 3300025923 Bacteria 2569
219 Ga0207681_10104325 3300025923 Bacteria 2050
220 Ga0207694_10004377 3300025924 Bacteria 11026
221 Ga0207694_10165195 3300025924 Bacteria 1790
222 Ga0207650_10011044 3300025925 Bacteria 6210
223 Ga0207650_10097992 3300025925 Bacteria 2252
224 Ga0207659_10000975 3300025926 Bacteria 17069
225 Ga0207659_10008248 3300025926 Bacteria 6456
226 Ga0207659_10013544 3300025926 Bacteria 5228
227 Ga0207659_10020371 3300025926 Bacteria 4383
228 Ga0207659_10059162 3300025926 Bacteria 2753
229 Ga0207687_10039424 3300025927 Bacteria 3234
230 Ga0207687_10068596 3300025927 Bacteria 2526
231 Ga0207644_10021961 3300025931 Bacteria 4354
232 Ga0207644_10023772 3300025931 Bacteria 4201
233 Ga0207690_10057404 3300025932 Bacteria 2630
234 Ga0207686_10002593 3300025934 Bacteria 9810
235 Ga0207686_10006503 3300025934 Bacteria 6292
236 Ga0207686_10018478 3300025934 Bacteria 3948
237 Ga0207709_10007528 3300025935 Bacteria 6052
238 Ga0207709_10022240 3300025935 Bacteria 3595
239 Ga0207670_10009719 3300025936 Bacteria 5505
240 Ga0207670_10051061 3300025936 Bacteria 2775
241 Ga0207669_10000576 3300025937 Bacteria 15967
242 Ga0207669_10020315 3300025937 Bacteria 3480
243 Ga0207704_10008141 3300025938 Bacteria 4993
244 Ga0207704_10010027 3300025938 Bacteria 4599
245 Ga0207704_10061764 3300025938 Bacteria 2326
246 Ga0207691_10004280 3300025940 Bacteria 13865
247 Ga0207691_10005737 3300025940 Bacteria 12008
248 Ga0207691_10035559 3300025940 Bacteria 4622
249 Ga0207691_10078308 3300025940 Bacteria 2976
250 Ga0207711_10113018 3300025941 Bacteria 2418
251 Ga0207689_10000674 3300025942 Bacteria 32586
252 Ga0207689_10071885 3300025942 Bacteria 2842
253 Ga0207689_10085545 3300025942 Bacteria 2592
254 Ga0207689_10119829 3300025942 Bacteria 2165
255 Ga0207661_10102254 3300025944 Bacteria 2409
256 Ga0207679_10025199 3300025945 Bacteria 4088
257 Ga0207679_10034123 3300025945 Bacteria 3587
258 Ga0207667_10056520 3300025949 Bacteria 4122
259 Ga0207651_10015926 3300025960 Bacteria 4387
260 Ga0207651_10030871 3300025960 Bacteria 3418
261 Ga0207712_10004150 3300025961 Bacteria 9149
262 Ga0207640_10007641 3300025981 Bacteria 5971
263 Ga0207658_10028480 3300025986 Bacteria 3934
264 Ga0207703_10159847 3300026035 Bacteria 1972
265 Ga0207678_10012995 3300026067 Bacteria 7306
266 Ga0207678_10045519 3300026067 Bacteria 3794
267 Ga0207708_10001495 3300026075 Bacteria 17422
268 Ga0207708_10006720 3300026075 Bacteria 8509
269 Ga0207708_10014468 3300026075 Bacteria 5906
270 Ga0207708_10069070 3300026075 Bacteria 2705
271 Ga0207641_10183273 3300026088 Bacteria 1919
272 Ga0207648_10001691 3300026089 Bacteria 24165
273 Ga0207676_10102496 3300026095 Bacteria 2376
274 Ga0207675_100025629 3300026118 Bacteria 5488
275 Ga0207675_100044351 3300026118 Bacteria 4155
276 Ga0207675_100093292 3300026118 Bacteria 2831
277 Ga0207683_10018524 3300026121 Bacteria 5942
278 Ga0207683_10022945 3300026121 Bacteria 5364
279 Ga0207683_10046565 3300026121 Bacteria 3796
280 Ga0207683_10089956 3300026121 Bacteria 2733
281 Ga0207683_10112448 3300026121 Bacteria 2439
282 Ga0207683_10135021 3300026121 Bacteria 2221
283 Ga0207428_10000048 3300027907 Bacteria 180760
284 Ga0207428_10001403 3300027907 Bacteria 25443
285 Ga0207428_10002183 3300027907 Bacteria 19663
286 Ga0207428_10015984 3300027907 Bacteria 6470
287 Ga0268266_10002445 3300028379 Bacteria 19927
288 Ga0268266_10098920 3300028379 Bacteria 2567
289 Ga0268266_10235430 3300028379 Bacteria 1688
290 Ga0268264_10011433 3300028381 Bacteria 7331
291 Ga0307513_10009939 3300031456 Bacteria 11999
292 Ga0307408_100005017 3300031548 Bacteria 8878
293 Ga0307408_100009904 3300031548 Bacteria 6279
294 Ga0307408_100024339 3300031548 Bacteria 4133
295 Ga0307408_100048717 3300031548 Bacteria 3040
296 Ga0307405_10073182 3300031731 Bacteria 2211
297 Ga0307413_10008047 3300031824 Bacteria 4947
298 Ga0307413_10024351 3300031824 Bacteria 3299
299 Ga0307410_10009285 3300031852 Bacteria 5509
300 Ga0307410_10036675 3300031852 Bacteria 3195
301 Ga0307410_10082640 3300031852 Bacteria 2260
302 Ga0307407_10021381 3300031903 Bacteria 3335
303 Ga0307407_10039358 3300031903 Bacteria 2629
304 Ga0307412_10012962 3300031911 Bacteria 4874
305 Ga0307412_10048355 3300031911 Bacteria 2797
306 Ga0307409_100000402 3300031995 Bacteria 18423
307 Ga0307409_100020749 3300031995 Bacteria 4486
308 Ga0307409_100045657 3300031995 Bacteria 3309
309 Ga0307409_100056397 3300031995 Bacteria 3038
310 Ga0307409_100242837 3300031995 Bacteria 1641
311 Ga0307416_100038785 3300032002 Bacteria 3679
312 Ga0307416_100041405 3300032002 Bacteria 3587
313 Ga0307416_100044313 3300032002 Bacteria 3492
314 Ga0307416_100060127 3300032002 Bacteria 3092
315 Ga0307416_100079312 3300032002 Bacteria 2766
316 Ga0307416_100097160 3300032002 Bacteria 2550
317 Ga0307416_100119525 3300032002 Bacteria 2344
318 Ga0307411_10008127 3300032005 Bacteria 5411
319 Ga0307411_10028199 3300032005 Bacteria 3410
320 Ga0307411_10046951 3300032005 Bacteria 2788
321 Ga0307415_100009010 3300032126 Bacteria 5566
322 Ga0373934_0000606 3300035086 Bacteria 12643
323 Ga0373941_0001687 3300035115 Bacteria 4729
324 Ga0373956_0003542 3300035119 Bacteria 6293
325 Ga0373955_0003243 3300035172 Bacteria 7126
326 Ga0373935_0087192 3300035692 Bacteria 2038
327 Ga0373937_0000387 3300036401 Bacteria 41007
328 Ga0373925_0006974 3300037068 Bacteria 8262
329 Ga0439446_0019092 3300042156 Bacteria 1926
330 Ga0439434_0006671 3300042435 Bacteria 3373
331 Ga0439464_0030765 3300042439 Bacteria 1504
332 Ga0451576_0003740 3300045051 Bacteria 20566
333 Ga0451576_0009851 3300045051 Bacteria 11041
334 Ga0451576_0049993 3300045051 Bacteria 4386
335 Ga0451576_0053012 3300045051 Bacteria 4250
336 Ga0451576_0106536 3300045051 Bacteria 2917
337 Ga0495603_0011818 3300046455 Bacteria 5284
338 Ga0495629_0008227 3300046459 Bacteria 7668
339 Ga0495584_0033012 3300046491 Bacteria 2618
340 Ga0495594_0006783 3300046499 Bacteria 5888
341 Ga0495628_0072683 3300046516 Bacteria 2680
342 Ga0495643_0011558 3300046522 Bacteria 5370
343 Ga0495621_0001796 3300046539 Bacteria 5638
344 Ga0495621_0021083 3300046539 Bacteria 2145
345 Ga0495634_0156804 3300046642 Bacteria 1437
346 Ga0495588_0011078 3300046674 Bacteria 4221
347 Ga0495599_0083031 3300046678 Bacteria 2001
348 Ga0495658_0018058 3300046683 Bacteria 3660
349 Ga0495613_0110108 3300046689 Bacteria 1985
350 Ga0495604_0108915 3300047317 Bacteria 2023
351 Ga0496102_0161896 3300048905 Bacteria 2105
352 Ga0496104_0001099 3300048907 Bacteria 23136
353 Ga0496104_0080281 3300048907 Bacteria 3110
354 Ga0496106_0198942 3300048909 Bacteria 1594
355 Ga0496108_0078403 3300048911 Bacteria 2796
356 Ga0496108_0091880 3300048911 Bacteria 2580
357 Ga0496109_0079324 3300048912 Bacteria 3024
358 Ga0496109_0128755 3300048912 Bacteria 2362
359 Ga0496110_0003707 3300048913 Bacteria 11764
360 Ga0496110_0020594 3300048913 Bacteria 5571
361 Ga0496111_0088149 3300048914 Bacteria 2272
362 Ga0496112_0068255 3300048915 Bacteria 3510
363 Ga0496112_0076860 3300048915 Bacteria 3302
364 Ga0496112_0182968 3300048915 Bacteria 2059
365 Ga0496113_0147357 3300048916 Bacteria 1855
366 Ga0496114_0119760 3300048917 Bacteria 2263
367 Ga0496114_0154663 3300048917 Bacteria 1991
368 Ga0501031_0012441 3300049568 Bacteria 5552
369 Ga0501031_0077778 3300049568 Bacteria 2161
370 Ga0501032_0021792 3300049569 Bacteria 4450
371 Ga0501034_0001388 3300049571 Bacteria 32580
372 Ga0501034_0001525 3300049571 Bacteria 30418
373 Ga0501034_0053414 3300049571 Bacteria 4068
374 Ga0501036_0047532 3300049572 Bacteria 3634
375 Ga0501036_0076137 3300049572 Bacteria 2839
376 Ga0501038_0025399 3300049574 Bacteria 5281
377 Ga0501038_0102636 3300049574 Bacteria 2379
378 Ga0501039_0078018 3300049575 Bacteria 2576
379 Ga0501040_0002796 3300049576 Bacteria 11246
380 Ga0501040_0067942 3300049576 Bacteria 2457
381 Ga0501041_0008737 3300049577 Bacteria 5964
382 Ga0501041_0067277 3300049577 Bacteria 2196
383 Ga0501042_0001976 3300049578 Bacteria 12358
384 Ga0501043_0000899 3300049579 Bacteria 26386
385 Ga0501043_0044925 3300049579 Bacteria 3475
386 Ga0501043_0085432 3300049579 Bacteria 2480
387 Ga0501046_0006626 3300049580 Bacteria 10226
388 Ga0501046_0154569 3300049580 Bacteria 1729
389 Ga0501047_0001422 3300049581 Bacteria 23491
390 Ga0501047_0001540 3300049581 Bacteria 22545
391 Ga0501047_0063885 3300049581 Bacteria 3551
392 Ga0501048_0008042 3300049582 Bacteria 7988
393 Ga0501048_0025998 3300049582 Bacteria 4264
394 Ga0501067_0076716 3300049583 Bacteria 1852
395 Ga0501069_0005956 3300049585 Bacteria 6361
396 Ga0501069_0022519 3300049585 Bacteria 3428
397 Ga0501070_0187038 3300049586 Bacteria 1703
398 Ga0501071_0008680 3300049587 Bacteria 6723
399 Ga0501071_0037904 3300049587 Bacteria 3444
400 Ga0501072_0023678 3300049588 Bacteria 4771
401 Ga0501072_0045285 3300049588 Bacteria 3459
402 Ga0501072_0045289 3300049588 Bacteria 3458
403 Ga0501073_0081209 3300049589 Bacteria 2255
404 Ga0501074_0032845 3300049590 Bacteria 3760
405 Ga0501074_0046671 3300049590 Bacteria 3132
406 Ga0501074_0074202 3300049590 Bacteria 2443
407 Ga0501074_0153747 3300049590 Bacteria 1644
408 Ga0501075_0001452 3300049591 Bacteria 15416
409 Ga0501076_0002028 3300049592 Bacteria 13861
410 Ga0501076_0002929 3300049592 Bacteria 11836
411 Ga0501076_0053990 3300049592 Bacteria 3185
412 Ga0501076_0073132 3300049592 Bacteria 2744
413 Ga0501076_0091562 3300049592 Bacteria 2446
414 Ga0501076_0145623 3300049592 Bacteria 1926
415 Ga0501077_0020923 3300049593 Bacteria 4141
416 Ga0501077_0023625 3300049593 Bacteria 3898
417 Ga0501077_0050840 3300049593 Bacteria 2634
418 Ga0501077_0064615 3300049593 Bacteria 2321
419 Ga0501077_0115013 3300049593 Bacteria 1705
420 Ga0501079_0001840 3300049741 Bacteria 15189
421 Ga0501079_0029581 3300049741 Bacteria 4206
422 Ga0501079_0050125 3300049741 Bacteria 3223
423 Ga0501079_0132836 3300049741 Bacteria 1937
424 Ga0501079_0135330 3300049741 Bacteria 1918
425 Ga0501080_0012848 3300049742 Bacteria 7682
426 Ga0501081_0033058 3300049743 Bacteria 3512
427 Ga0501083_0044099 3300049744 Bacteria 3019
428 Ga0501035_0021878 3300049822 Bacteria 5875
429 Ga0501044_0007926 3300049823 Bacteria 11673
430 Ga0501044_0012726 3300049823 Bacteria 9112
431 Ga0501044_0046001 3300049823 Bacteria 4520
432 Ga0501045_0000979 3300049824 Bacteria 18694
433 Ga0501045_0123847 3300049824 Bacteria 1920
434 nmdc:mga03683_719_c1 3300050489 Bacteria 9504
435 nmdc:mga00v17_27098_c1 3300050491 Bacteria 3343
436 nmdc:mga0yw44_4529_c1 3300050492 Bacteria 6393
437 nmdc:mga0k408_51708_c1 3300050493 Bacteria 2381
438 nmdc:mga0k408_92373_c1 3300050493 Bacteria 1779
439 nmdc:mga06z11_24730_c1 3300050494 Bacteria 2838
440 nmdc:mga06z11_47833_c1 3300050494 Bacteria 2174
441 nmdc:mga05p37_129088_c1 3300050507 Bacteria 3103
442 nmdc:mga05p37_29662_c1 3300050507 Bacteria 6675
443 nmdc:mga05p37_4830_c1 3300050507 Bacteria 15760
444 nmdc:mga05p37_5552_c1 3300050507 Bacteria 14822
445 nmdc:mga05p37_5913_c1 3300050507 Bacteria 14391
446 nmdc:mga05p37_6192_c1 3300050507 Bacteria 14087
447 nmdc:mga05p37_66131_c1 3300050507 Bacteria 4447
448 nmdc:mga05p37_66250_c2 3300050507 Bacteria 4075
449 nmdc:mga05p37_8223_c1 3300050507 Bacteria 11601
450 nmdc:mga05p37_832_c1 3300050507 Bacteria 34564
451 nmdc:mga05p37_85623_c1 3300050507 Bacteria 3884
452 nmdc:mga05p37_92704_c1 3300050507 Bacteria 3722
453 nmdc:mga09592_1002_c1 3300050508 Bacteria 22398
454 nmdc:mga09592_11816_c1 3300050508 Bacteria 7101
455 nmdc:mga09592_7154_c1 3300050508 Bacteria 9070
456 nmdc:mga09592_8692_c1 3300050508 Bacteria 8261
457 nmdc:mga0qj67_1417_c1 3300050509 Bacteria 16782
458 nmdc:mga0qj67_16701_c1 3300050509 Bacteria 5572
459 nmdc:mga06r32_116436_c1 3300050510 Bacteria 2633
460 nmdc:mga06r32_13806_c1 3300050510 Bacteria 7327
461 nmdc:mga06r32_22840_c1 3300050510 Bacteria 5786
462 nmdc:mga06r32_4238_c1 3300050510 Bacteria 12849
463 nmdc:mga06r32_6938_c1 3300050510 Bacteria 10186
464 nmdc:mga08y16_18417_c1 3300050511 Bacteria 7360
465 nmdc:mga08y16_226_c1 3300050511 Bacteria 50561
466 nmdc:mga08y16_26216_c1 3300050511 Bacteria 6147
467 nmdc:mga08y16_3818_c1 3300050511 Bacteria 15671
468 nmdc:mga08y16_527_c1 3300050511 Bacteria 35360
469 nmdc:mga08y16_69084_c1 3300050511 Bacteria 3683
470 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
471 nmdc:mga0n895_10512_c1 3300050512 Bacteria 8186
472 nmdc:mga0n895_11_c1 3300050512 Bacteria 112540
473 nmdc:mga0n895_68981_c1 3300050512 Bacteria 3502
474 nmdc:mga0n895_71366_c1 3300050512 Bacteria 3443
475 nmdc:mga0n895_7773_c1 3300050512 Bacteria 9236
476 nmdc:mga0n895_93694_c1 3300050512 Bacteria 3007
477 nmdc:mga0rr50_104213_c1 3300050513 Bacteria 2234
478 nmdc:mga0rr50_11772_c1 3300050513 Bacteria 5615
479 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
480 nmdc:mga0rr50_326_c1 3300050513 Bacteria 25897
481 nmdc:mga0rr50_5246_c1 3300050513 Bacteria 7710
482 nmdc:mga08x19_1476_c1 3300050514 Bacteria 14566
483 nmdc:mga08x19_23388_c1 3300050514 Bacteria 3834
484 nmdc:mga08x19_79423_c1 3300050514 Bacteria 2152
485 nmdc:mga0a205_13380_c1 3300050515 Bacteria 7638
486 nmdc:mga0a205_13986_c2 3300050515 Bacteria 5103
487 Ga0495601_0136829 3300053077 Bacteria 1597
488 Ga0495619_0076176 3300053085 Bacteria 2252
489 Ga0495619_0102612 3300053085 Bacteria 1948
490 Ga0500555_002706 3300053103 Bacteria 5099
491 Ga0500616_0003153 3300053153 Bacteria 12863
492 Ga0500645_000514 3300053730 Bacteria 25995
493 Ga0501084_0006120 3300054114 Bacteria 9892
494 Ga0501084_0010694 3300054114 Bacteria 7595
495 Ga0501084_0033139 3300054114 Bacteria 4321
496 Ga0501084_0093528 3300054114 Bacteria 2524
497 Ga0590071_000152 3300059421 Bacteria 19812
498 Ga0590071_001725 3300059421 Bacteria 5642
499 Ga0590071_002572 3300059421 Bacteria 4564
500 Ga0590071_003768 3300059421 Bacteria 3720
501 Ga0590071_005352 3300059421 Bacteria 3089
502 Ga0590074_000017 3300059423 Bacteria 20687
503 Ga0590075_002020 3300059424 Bacteria 4890
504 Ga0590075_003519 3300059424 Bacteria 3719
505 Ga0590075_019609 3300059424 Bacteria 1679
506 Ga0590077_000362 3300059426 Bacteria 12805
507 Ga0501082_0001004 3300060353 Bacteria 24909
508 Ga0501082_0056378 3300060353 Bacteria 3384
509 Ga0530510_0000888 3300061734 Bacteria 19730
510 Ga0530510_0019754 3300061734 Bacteria 4786
511 Ga0530510_0063973 3300061734 Bacteria 2664
512 nmdc:mga05p37_154256_c1
513 JGI24751J29686_10005675
514 JGI25406J46586_10007699
515 Ga0065712_10001865
516 Ga0065712_10068417
517 Ga0065712_10068680
518 Ga0065712_10077523
519 Ga0065712_10079275
520 Ga0065712_10089783
521 Ga0065712_10104388
522 Ga0065715_10099172
523 Ga0065715_10101548
524 Ga0065715_10107958
525 Ga0065707_10001522
526 Ga0065707_10002910
527 Ga0065707_10097767
528 Ga0065707_10105067
529 Ga0070676_10010750
530 Ga0070670_100011093
531 Ga0070670_100014785
532 Ga0070670_100017601
533 Ga0070670_100023960
534 Ga0068869_100000256
535 Ga0070666_10136307
536 Ga0070660_100013139
537 Ga0070689_100007394
538 Ga0070689_100071424
539 Ga0070689_100133210
540 Ga0070691_10012035
541 Ga0070687_100028003
542 Ga0070669_100002881
543 Ga0070669_100079022
544 Ga0070675_100000311
545 Ga0070675_100002200
546 Ga0070675_100002452
547 Ga0070675_100007377
548 Ga0070674_100000735
549 Ga0070674_100001848
550 Ga0070674_100002130
551 Ga0070674_100131485
552 Ga0070673_100018890
553 Ga0070673_100172743
554 Ga0070688_100006975
555 Ga0070659_100010629
556 Ga0070667_100028989
557 Ga0070667_100095032
558 Ga0070714_100005034
559 Ga0070701_10003990
560 Ga0070705_100079626
561 Ga0070708_100000002
562 Ga0070678_100020951
563 Ga0070678_100024033
564 Ga0070678_100030823
565 Ga0070662_100073925
566 Ga0070681_10019926
567 Ga0070681_10067199
568 Ga0068867_100011691
569 Ga0070706_100091154
570 Ga0070698_100001813
571 Ga0070698_100002188
572 Ga0070698_100006892
573 Ga0070698_100018706
574 Ga0070698_100136158
575 Ga0070698_100153230
576 Ga0070699_100000980
577 Ga0070699_100001754
578 Ga0070699_100004768
579 Ga0070684_100015248
580 Ga0070684_100024056
581 Ga0070684_100075794
582 Ga0070697_100027184
583 Ga0070697_100078283
584 Ga0070672_100015797
585 Ga0070672_100030420
586 Ga0070686_100004936
587 Ga0070686_100028383
588 Ga0070686_100066538
589 Ga0070686_100138756
590 Ga0070695_100031758
591 Ga0070696_100060492
592 Ga0070693_100021406
593 Ga0070665_100001061
594 Ga0070665_100112265
595 Ga0070704_100003231
596 Ga0070704_100036021
597 Ga0068855_100040709
598 Ga0070664_100000832
599 Ga0070664_100031404
600 Ga0070664_100048400
601 Ga0070664_100155113
602 Ga0068857_100029433
603 Ga0068854_100002437
604 Ga0068854_100006157
605 Ga0070702_100050355
606 Ga0068859_100013874
607 Ga0068859_100018112
608 Ga0068859_100029054
609 Ga0068864_100009517
610 Ga0068864_100030550
611 Ga0068866_10002372
612 Ga0068861_100028062
613 Ga0068861_100161312
614 Ga0068851_10008332
615 Ga0068863_100031041
616 Ga0068863_100044292
617 Ga0068863_100067747
618 Ga0068858_100006773
619 Ga0068858_100132773
620 Ga0068860_100064216
621 Ga0068862_100044485
622 Ga0068862_100048217
623 Ga0081539_10000110
624 Ga0075365_10011620
625 Ga0075365_10044558
626 Ga0075368_10032959
627 Ga0075362_10001435
628 Ga0075367_10001698
629 Ga0075366_10045956
630 Ga0097621_100016903
631 Ga0068871_100001984
632 Ga0068871_100132725
633 Ga0075428_100000030
634 Ga0075428_100000673
635 Ga0075428_100000931
636 Ga0075428_100006014
637 Ga0075428_100008375
638 Ga0075428_100008632
639 Ga0075428_100026750
640 Ga0075428_100038724
641 Ga0075428_100112270
642 Ga0075430_100000398
643 Ga0075430_100002425
644 Ga0075430_100009976
645 Ga0075431_100001977
646 Ga0075431_100012354
647 Ga0075431_100016547
648 Ga0075431_100018355
649 Ga0075431_100112615
650 Ga0075433_10044987
651 Ga0075434_100002491
652 Ga0075434_100003288
653 Ga0075434_100108317
654 Ga0075429_100004255
655 Ga0075429_100005123
656 Ga0075429_100006190
657 Ga0075429_100030035
658 Ga0068865_100073067
659 Ga0075436_100002164
660 Ga0075436_100038228
661 Ga0097620_100013874
662 Ga0097620_100018112
663 Ga0097620_100029055
664 Ga0075435_100000034
665 Ga0075435_100000542
666 Ga0075435_100012725
667 Ga0075435_100030226
668 Ga0075435_100039586
669 Ga0075435_100106714
670 Ga0111539_10000015
671 Ga0111539_10000174
672 Ga0111539_10000657
673 Ga0111539_10002052
674 Ga0111539_10002159
675 Ga0111539_10042646
676 Ga0111539_10108842
677 Ga0111539_10116685
678 Ga0105245_10043479
679 Ga0105245_10147065
680 Ga0114129_10000288
681 Ga0114129_10000581
682 Ga0114129_10001174
683 Ga0114129_10006497
684 Ga0114129_10058684
685 Ga0114129_10095275
686 Ga0105243_10013558
687 Ga0105243_10049415
688 Ga0105242_10006802
689 Ga0105242_10007503
690 Ga0105248_10019397
691 Ga0105248_10143370
692 Ga0105237_10081662
693 Ga0105238_10002716
694 Ga0105249_10001257
695 Ga0105249_10052897
696 Ga0157374_10087859
697 Ga0163162_10024574
698 Ga0163163_10000005
699 Ga0163163_10015247
700 Ga0163163_10033344
701 Ga0163163_10041293
702 Ga0157380_10000415
703 Ga0157380_10000549
704 Ga0157380_10031476
705 Ga0157380_10040295
706 Ga0157380_10081845
707 Ga0157377_10058027
708 Ga0157376_10074275
709 Ga0206356_11870653
710 Ga0207697_10008950
711 Ga0207656_10005665
712 Ga0207682_10013055
713 Ga0207682_10024964
714 Ga0207642_10004075
715 Ga0207688_10016857
716 Ga0207680_10037340
717 Ga0207645_10005378
718 Ga0207684_10008593
719 Ga0207684_10067468
720 Ga0207707_10016097
721 Ga0207707_10029951
722 Ga0207707_10055167
723 Ga0207695_10141094
724 Ga0207671_10068672
725 Ga0207662_10003753
726 Ga0207657_10008592
727 Ga0207652_10021929
728 Ga0207646_10092831
729 Ga0207681_10062183
730 Ga0207681_10104325
731 Ga0207694_10004377
732 Ga0207694_10165195
733 Ga0207650_10011044
734 Ga0207650_10097992
735 Ga0207659_10000975
736 Ga0207659_10008248
737 Ga0207659_10013544
738 Ga0207659_10020371
739 Ga0207659_10059162
740 Ga0207687_10039424
741 Ga0207687_10068596
742 Ga0207644_10021961
743 Ga0207644_10023772
744 Ga0207690_10057404
745 Ga0207686_10002593
746 Ga0207686_10006503
747 Ga0207686_10018478
748 Ga0207709_10007528
749 Ga0207709_10022240
750 Ga0207670_10009719
751 Ga0207670_10051061
752 Ga0207669_10000576
753 Ga0207669_10020315
754 Ga0207704_10008141
755 Ga0207704_10010027
756 Ga0207704_10061764
757 Ga0207691_10004280
758 Ga0207691_10005737
759 Ga0207691_10035559
760 Ga0207691_10078308
761 Ga0207711_10113018
762 Ga0207689_10000674
763 Ga0207689_10071885
764 Ga0207689_10085545
765 Ga0207689_10119829
766 Ga0207661_10102254
767 Ga0207679_10025199
768 Ga0207679_10034123
769 Ga0207667_10056520
770 Ga0207651_10015926
771 Ga0207651_10030871
772 Ga0207712_10004150
773 Ga0207640_10007641
774 Ga0207658_10028480
775 Ga0207703_10159847
776 Ga0207678_10012995
777 Ga0207678_10045519
778 Ga0207708_10001495
779 Ga0207708_10006720
780 Ga0207708_10014468
781 Ga0207708_10069070
782 Ga0207641_10183273
783 Ga0207648_10001691
784 Ga0207676_10102496
785 Ga0207675_100025629
786 Ga0207675_100044351
787 Ga0207675_100093292
788 Ga0207683_10018524
789 Ga0207683_10022945
790 Ga0207683_10046565
791 Ga0207683_10089956
792 Ga0207683_10112448
793 Ga0207683_10135021
794 Ga0207428_10000048
795 Ga0207428_10001403
796 Ga0207428_10002183
797 Ga0207428_10015984
798 Ga0268266_10002445
799 Ga0268266_10098920
800 Ga0268266_10235430
801 Ga0268264_10011433
802 Ga0307513_10009939
803 Ga0307408_100005017
804 Ga0307408_100009904
805 Ga0307408_100024339
806 Ga0307408_100048717
807 Ga0307405_10073182
808 Ga0307413_10008047
809 Ga0307413_10024351
810 Ga0307410_10009285
811 Ga0307410_10036675
812 Ga0307410_10082640
813 Ga0307407_10021381
814 Ga0307407_10039358
815 Ga0307412_10012962
816 Ga0307412_10048355
817 Ga0307409_100000402
818 Ga0307409_100020749
819 Ga0307409_100045657
820 Ga0307409_100056397
821 Ga0307409_100242837
822 Ga0307416_100038785
823 Ga0307416_100041405
824 Ga0307416_100044313
825 Ga0307416_100060127
826 Ga0307416_100079312
827 Ga0307416_100097160
828 Ga0307416_100119525
829 Ga0307411_10008127
830 Ga0307411_10028199
831 Ga0307411_10046951
832 Ga0307415_100009010
833 Ga0373934_0000606
834 Ga0373941_0001687
835 Ga0373956_0003542
836 Ga0373955_0003243
837 Ga0373935_0087192
838 Ga0373937_0000387
839 Ga0373925_0006974
840 Ga0439446_0019092
841 Ga0439434_0006671
842 Ga0439464_0030765
843 Ga0451576_0003740
844 Ga0451576_0009851
845 Ga0451576_0049993
846 Ga0451576_0053012
847 Ga0451576_0106536
848 Ga0495603_0011818
849 Ga0495629_0008227
850 Ga0495584_0033012
851 Ga0495594_0006783
852 Ga0495628_0072683
853 Ga0495643_0011558
854 Ga0495621_0001796
855 Ga0495621_0021083
856 Ga0495634_0156804
857 Ga0495588_0011078
858 Ga0495599_0083031
859 Ga0495658_0018058
860 Ga0495613_0110108
861 Ga0495604_0108915
862 Ga0496102_0161896
863 Ga0496104_0001099
864 Ga0496104_0080281
865 Ga0496106_0198942
866 Ga0496108_0078403
867 Ga0496108_0091880
868 Ga0496109_0079324
869 Ga0496109_0128755
870 Ga0496110_0003707
871 Ga0496110_0020594
872 Ga0496111_0088149
873 Ga0496112_0068255
874 Ga0496112_0076860
875 Ga0496112_0182968
876 Ga0496113_0147357
877 Ga0496114_0119760
878 Ga0496114_0154663
879 Ga0501031_0012441
880 Ga0501031_0077778
881 Ga0501032_0021792
882 Ga0501034_0001388
883 Ga0501034_0001525
884 Ga0501034_0053414
885 Ga0501036_0047532
886 Ga0501036_0076137
887 Ga0501038_0025399
888 Ga0501038_0102636
889 Ga0501039_0078018
890 Ga0501040_0002796
891 Ga0501040_0067942
892 Ga0501041_0008737
893 Ga0501041_0067277
894 Ga0501042_0001976
895 Ga0501043_0000899
896 Ga0501043_0044925
897 Ga0501043_0085432
898 Ga0501046_0006626
899 Ga0501046_0154569
900 Ga0501047_0001422
901 Ga0501047_0001540
902 Ga0501047_0063885
903 Ga0501048_0008042
904 Ga0501048_0025998
905 Ga0501067_0076716
906 Ga0501069_0005956
907 Ga0501069_0022519
908 Ga0501070_0187038
909 Ga0501071_0008680
910 Ga0501071_0037904
911 Ga0501072_0023678
912 Ga0501072_0045285
913 Ga0501072_0045289
914 Ga0501073_0081209
915 Ga0501074_0032845
916 Ga0501074_0046671
917 Ga0501074_0074202
918 Ga0501074_0153747
919 Ga0501075_0001452
920 Ga0501076_0002028
921 Ga0501076_0002929
922 Ga0501076_0053990
923 Ga0501076_0073132
924 Ga0501076_0091562
925 Ga0501076_0145623
926 Ga0501077_0020923
927 Ga0501077_0023625
928 Ga0501077_0050840
929 Ga0501077_0064615
930 Ga0501077_0115013
931 Ga0501079_0001840
932 Ga0501079_0029581
933 Ga0501079_0050125
934 Ga0501079_0132836
935 Ga0501079_0135330
936 Ga0501080_0012848
937 Ga0501081_0033058
938 Ga0501083_0044099
939 Ga0501035_0021878
940 Ga0501044_0007926
941 Ga0501044_0012726
942 Ga0501044_0046001
943 Ga0501045_0000979
944 Ga0501045_0123847
945 nmdc:mga03683_719_c1
946 nmdc:mga00v17_27098_c1
947 nmdc:mga0yw44_4529_c1
948 nmdc:mga0k408_51708_c1
949 nmdc:mga0k408_92373_c1
950 nmdc:mga06z11_24730_c1
951 nmdc:mga06z11_47833_c1
952 nmdc:mga05p37_129088_c1
953 nmdc:mga05p37_29662_c1
954 nmdc:mga05p37_4830_c1
955 nmdc:mga05p37_5552_c1
956 nmdc:mga05p37_5913_c1
957 nmdc:mga05p37_6192_c1
958 nmdc:mga05p37_66131_c1
959 nmdc:mga05p37_66250_c2
960 nmdc:mga05p37_8223_c1
961 nmdc:mga05p37_832_c1
962 nmdc:mga05p37_85623_c1
963 nmdc:mga05p37_92704_c1
964 nmdc:mga09592_1002_c1
965 nmdc:mga09592_11816_c1
966 nmdc:mga09592_7154_c1
967 nmdc:mga09592_8692_c1
968 nmdc:mga0qj67_1417_c1
969 nmdc:mga0qj67_16701_c1
970 nmdc:mga06r32_116436_c1
971 nmdc:mga06r32_13806_c1
972 nmdc:mga06r32_22840_c1
973 nmdc:mga06r32_4238_c1
974 nmdc:mga06r32_6938_c1
975 nmdc:mga08y16_18417_c1
976 nmdc:mga08y16_226_c1
977 nmdc:mga08y16_26216_c1
978 nmdc:mga08y16_3818_c1
979 nmdc:mga08y16_527_c1
980 nmdc:mga08y16_69084_c1
981 nmdc:mga08y16_8_c1
982 nmdc:mga0n895_10512_c1
983 nmdc:mga0n895_11_c1
984 nmdc:mga0n895_68981_c1
985 nmdc:mga0n895_71366_c1
986 nmdc:mga0n895_7773_c1
987 nmdc:mga0n895_93694_c1
988 nmdc:mga0rr50_104213_c1
989 nmdc:mga0rr50_11772_c1
990 nmdc:mga0rr50_19_c1
991 nmdc:mga0rr50_326_c1
992 nmdc:mga0rr50_5246_c1
993 nmdc:mga08x19_1476_c1
994 nmdc:mga08x19_23388_c1
995 nmdc:mga08x19_79423_c1
996 nmdc:mga0a205_13380_c1
997 nmdc:mga0a205_13986_c2
998 Ga0495601_0136829
999 Ga0495619_0076176
1000 Ga0495619_0102612
1001 Ga0500555_002706
1002 Ga0500616_0003153
1003 Ga0500645_000514
1004 Ga0501084_0006120
1005 Ga0501084_0010694
1006 Ga0501084_0033139
1007 Ga0501084_0093528
1008 Ga0590071_000152
1009 Ga0590071_001725
1010 Ga0590071_002572
1011 Ga0590071_003768
1012 Ga0590071_005352
1013 Ga0590074_000017
1014 Ga0590075_002020
1015 Ga0590075_003519
1016 Ga0590075_019609
1017 Ga0590077_000362
1018 Ga0501082_0001004
1019 Ga0501082_0056378
1020 Ga0530510_0000888
1021 Ga0530510_0019754
1022 Ga0530510_0063973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

1

437

0.98

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

192

387

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pn8-assembly1.cif.gz_F engineered glycolyl-coa carboxylase (l100n variant) with bound coa 0.9027 5 492
3n6r-assembly1.cif.gz_L crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) 0.9024 6 492
8pn7-assembly1.cif.gz_E engineered glycolyl-coa carboxylase (g20r variant) with bound coa 0.9015 5 492
1vrg-assembly1.cif.gz_F crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution 0.8995 1 492
1on3-assembly1.cif.gz_E transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) 0.8985 5 492
ID Description Score Start End Superfamily
af_Q20676_22_285_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8982 4 234 3.90.226.10
4l6wA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8892 240 473 3.90.226.10
4fb8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8888 75 219 3.90.226.10
5fifB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8882 247 473 3.90.226.10
3h0sB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8776 75 226 3.90.226.10
ID Description Score Start End GO Terms
AF-X1VRZ5-F1-model_v4 CoA carboxyltransferase C-terminal domain-containing protein 0.9981 245 339 GO:0004658
AF-H1QFV4-F1-model_v4 deleted 0.9938 254 341
AF-M9TIK7-F1-model_v4 Acetyl-CoA carboxylase alpha subunit 0.9936 155 304 GO:0004658
AF-A0A4Q0IVL7-F1-model_v4 deleted 0.9907 187 316
AF-A8YPL3-F1-model_v4 Acetyl-CoA carboxylase alpha subunit (EC 6.4.1.2) 0.9856 155 274 GO:0003989
GO:0004658

Map