F457381
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 512 | 277 | 512 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10092204|Ga0070658_100922041 |
| Length | 172 |
| Sequence | VVLCRRNLYGVKRKQTTRRPMKKAXXXPATKLDQIRARLRSSTPILPIGVHLGFRVTAVRKGRVTIELDVRPHHANAIGTLHGGVLCDIADAAMALSHATNIAAEETFTTLELKINFLKPVWEGKLRAEGRVIKQGRTIGLTECDVFDEKGSLVAHATSTCMTLRGNEAKGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 4 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 190 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 220 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 221 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 222 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 261 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0.78 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.73 |
| Rhizosphere | 96.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1012948 | 3300001978 | Unclassified | 856 |
| 2 | JGI24743J22301_10006256 | 3300001991 | Bacteria | 2021 |
| 3 | JGI26128J50194_1006590 | 3300003347 | Bacteria | 758 |
| 4 | JGI26129J50193_1010430 | 3300003349 | Bacteria | 676 |
| 5 | JGI25405J52794_10025671 | 3300003911 | Bacteria | 1208 |
| 6 | Ga0065704_10423223 | 3300005289 | Unclassified | 730 |
| 7 | Ga0065715_10136418 | 3300005293 | Bacteria | 1922 |
| 8 | Ga0065707_10262742 | 3300005295 | Bacteria | 1093 |
| 9 | Ga0070658_10092204 | 3300005327 | Bacteria | 2498 |
| 10 | Ga0070658_11064725 | 3300005327 | Unclassified | 703 |
| 11 | Ga0070676_10028309 | 3300005328 | Bacteria | 3182 |
| 12 | Ga0070683_100182271 | 3300005329 | Bacteria | 1993 |
| 13 | Ga0070670_100221723 | 3300005331 | Bacteria | 1645 |
| 14 | Ga0068869_100049617 | 3300005334 | Bacteria | 3039 |
| 15 | Ga0070666_10113694 | 3300005335 | Bacteria | 1873 |
| 16 | Ga0070680_100153174 | 3300005336 | Unclassified | 1936 |
| 17 | Ga0070680_100478016 | 3300005336 | Unclassified | 1065 |
| 18 | Ga0070682_100008051 | 3300005337 | Bacteria | 5936 |
| 19 | Ga0068868_100020426 | 3300005338 | Bacteria | 4976 |
| 20 | Ga0070660_100087160 | 3300005339 | Unclassified | 2457 |
| 21 | Ga0070689_100066217 | 3300005340 | Bacteria | 2815 |
| 22 | Ga0070689_100067085 | 3300005340 | Bacteria | 2796 |
| 23 | Ga0070691_10123081 | 3300005341 | Bacteria | 1308 |
| 24 | Ga0070687_100001840 | 3300005343 | Bacteria | 7678 |
| 25 | Ga0070687_100035503 | 3300005343 | Bacteria | 2476 |
| 26 | Ga0070661_100168682 | 3300005344 | Bacteria | 1661 |
| 27 | Ga0070669_100005119 | 3300005353 | Bacteria | 9479 |
| 28 | Ga0070675_100009409 | 3300005354 | Bacteria | 7603 |
| 29 | Ga0070671_100365827 | 3300005355 | Unclassified | 1231 |
| 30 | Ga0070674_100211449 | 3300005356 | Unclassified | 1503 |
| 31 | Ga0070673_100387537 | 3300005364 | Unclassified | 1247 |
| 32 | Ga0070659_100002666 | 3300005366 | Bacteria | 12691 |
| 33 | Ga0070659_100078244 | 3300005366 | Bacteria | 2638 |
| 34 | Ga0070709_10813392 | 3300005434 | Unclassified | 734 |
| 35 | Ga0070709_11158549 | 3300005434 | Bacteria | 620 |
| 36 | Ga0070710_10547688 | 3300005437 | Bacteria | 798 |
| 37 | Ga0070711_100000674 | 3300005439 | Bacteria | 17876 |
| 38 | Ga0070705_101455288 | 3300005440 | Unclassified | 573 |
| 39 | Ga0070694_100056884 | 3300005444 | Bacteria | 2658 |
| 40 | Ga0070694_100593872 | 3300005444 | Unclassified | 891 |
| 41 | Ga0070708_100126723 | 3300005445 | Bacteria | 2361 |
| 42 | Ga0070708_100269096 | 3300005445 | Unclassified | 1602 |
| 43 | Ga0070708_100353701 | 3300005445 | Bacteria | 1384 |
| 44 | Ga0070708_100478475 | 3300005445 | Bacteria | 1175 |
| 45 | Ga0070708_100815561 | 3300005445 | Unclassified | 877 |
| 46 | Ga0070708_100856207 | 3300005445 | Bacteria | 854 |
| 47 | Ga0070708_101005836 | 3300005445 | Bacteria | 782 |
| 48 | Ga0070663_100018203 | 3300005455 | Unclassified | 4599 |
| 49 | Ga0070663_101211066 | 3300005455 | Unclassified | 664 |
| 50 | Ga0070662_100002683 | 3300005457 | Bacteria | 10979 |
| 51 | Ga0070662_100015410 | 3300005457 | Bacteria | 5120 |
| 52 | Ga0070662_100019519 | 3300005457 | Unclassified | 4602 |
| 53 | Ga0070681_10239774 | 3300005458 | Bacteria | 1727 |
| 54 | Ga0068867_100003854 | 3300005459 | Bacteria | 10546 |
| 55 | Ga0070685_10020596 | 3300005466 | Bacteria | 3569 |
| 56 | Ga0070706_100012720 | 3300005467 | Bacteria | 7786 |
| 57 | Ga0070706_100094363 | 3300005467 | Bacteria | 2776 |
| 58 | Ga0070706_100151857 | 3300005467 | Bacteria | 2162 |
| 59 | Ga0070706_100167209 | 3300005467 | Bacteria | 2053 |
| 60 | Ga0070706_100169661 | 3300005467 | Bacteria | 2037 |
| 61 | Ga0070706_100182362 | 3300005467 | Bacteria | 1960 |
| 62 | Ga0070707_100000050 | 3300005468 | Bacteria | 102427 |
| 63 | Ga0070707_100013117 | 3300005468 | Bacteria | 7746 |
| 64 | Ga0070707_100169401 | 3300005468 | Bacteria | 2128 |
| 65 | Ga0070698_100003437 | 3300005471 | Bacteria | 17412 |
| 66 | Ga0070698_100029289 | 3300005471 | Bacteria | 5714 |
| 67 | Ga0070698_100136460 | 3300005471 | Bacteria | 2407 |
| 68 | Ga0070698_100252672 | 3300005471 | Bacteria | 1695 |
| 69 | Ga0070698_101420719 | 3300005471 | Bacteria | 645 |
| 70 | Ga0070699_100002495 | 3300005518 | Bacteria | 16526 |
| 71 | Ga0070699_100010410 | 3300005518 | Bacteria | 8048 |
| 72 | Ga0070699_100104125 | 3300005518 | Bacteria | 2489 |
| 73 | Ga0070699_100259159 | 3300005518 | Unclassified | 1555 |
| 74 | Ga0070699_100273406 | 3300005518 | Bacteria | 1513 |
| 75 | Ga0070699_100305570 | 3300005518 | Unclassified | 1427 |
| 76 | Ga0070699_100617065 | 3300005518 | Bacteria | 989 |
| 77 | Ga0070699_100661012 | 3300005518 | Bacteria | 954 |
| 78 | Ga0070699_100909890 | 3300005518 | Bacteria | 806 |
| 79 | Ga0070699_101002876 | 3300005518 | Bacteria | 766 |
| 80 | Ga0070699_101203794 | 3300005518 | Archaea | 695 |
| 81 | Ga0070699_101585877 | 3300005518 | Unclassified | 600 |
| 82 | Ga0070679_100182908 | 3300005530 | Bacteria | 2068 |
| 83 | Ga0070684_100009298 | 3300005535 | Bacteria | 7736 |
| 84 | Ga0070684_100304928 | 3300005535 | Bacteria | 1462 |
| 85 | Ga0070684_100366017 | 3300005535 | Bacteria | 1327 |
| 86 | Ga0070684_101001475 | 3300005535 | Unclassified | 784 |
| 87 | Ga0070697_100018675 | 3300005536 | Bacteria | 5470 |
| 88 | Ga0070697_100026992 | 3300005536 | Bacteria | 4592 |
| 89 | Ga0070697_100032136 | 3300005536 | Bacteria | 4222 |
| 90 | Ga0070697_100043246 | 3300005536 | Bacteria | 3646 |
| 91 | Ga0070697_100070003 | 3300005536 | Bacteria | 2875 |
| 92 | Ga0070697_100146907 | 3300005536 | Bacteria | 1985 |
| 93 | Ga0070697_100166926 | 3300005536 | Unclassified | 1861 |
| 94 | Ga0070697_100258509 | 3300005536 | Bacteria | 1490 |
| 95 | Ga0070697_100644097 | 3300005536 | Bacteria | 933 |
| 96 | Ga0070697_100646849 | 3300005536 | Unclassified | 931 |
| 97 | Ga0070697_100704675 | 3300005536 | Unclassified | 891 |
| 98 | Ga0068853_100006343 | 3300005539 | Bacteria | 9387 |
| 99 | Ga0068853_100116109 | 3300005539 | Bacteria | 2383 |
| 100 | Ga0070672_100131384 | 3300005543 | Bacteria | 2058 |
| 101 | Ga0070672_101130777 | 3300005543 | Unclassified | 696 |
| 102 | Ga0070686_100001440 | 3300005544 | Bacteria | 13445 |
| 103 | Ga0070686_100004656 | 3300005544 | Bacteria | 7566 |
| 104 | Ga0070695_100011739 | 3300005545 | Bacteria | 5244 |
| 105 | Ga0070695_100208810 | 3300005545 | Unclassified | 1400 |
| 106 | Ga0070696_100319163 | 3300005546 | Unclassified | 1195 |
| 107 | Ga0070696_100446022 | 3300005546 | Unclassified | 1020 |
| 108 | Ga0070665_100087159 | 3300005548 | Bacteria | 3127 |
| 109 | Ga0070704_100392938 | 3300005549 | Bacteria | 1181 |
| 110 | Ga0070704_100606082 | 3300005549 | Bacteria | 963 |
| 111 | Ga0070704_101333379 | 3300005549 | Unclassified | 657 |
| 112 | Ga0068855_100229287 | 3300005563 | Bacteria | 2080 |
| 113 | Ga0068855_100304257 | 3300005563 | Bacteria | 1765 |
| 114 | Ga0068855_100514410 | 3300005563 | Bacteria | 1299 |
| 115 | Ga0070664_100199625 | 3300005564 | Bacteria | 1784 |
| 116 | Ga0068857_100193153 | 3300005577 | Bacteria | 1854 |
| 117 | Ga0068857_100648008 | 3300005577 | Bacteria | 1001 |
| 118 | Ga0068854_100004621 | 3300005578 | Bacteria | 8685 |
| 119 | Ga0068854_100355855 | 3300005578 | Unclassified | 1200 |
| 120 | Ga0068854_100433188 | 3300005578 | Bacteria | 1094 |
| 121 | Ga0068854_100579220 | 3300005578 | Unclassified | 955 |
| 122 | Ga0068856_100012826 | 3300005614 | Bacteria | 8110 |
| 123 | Ga0068856_100067395 | 3300005614 | Bacteria | 3537 |
| 124 | Ga0070702_100010550 | 3300005615 | Bacteria | 4557 |
| 125 | Ga0070702_100147947 | 3300005615 | Unclassified | 1504 |
| 126 | Ga0068852_100054256 | 3300005616 | Bacteria | 3454 |
| 127 | Ga0068852_100379183 | 3300005616 | Unclassified | 1387 |
| 128 | Ga0068864_100019391 | 3300005618 | Bacteria | 5688 |
| 129 | Ga0068864_100182793 | 3300005618 | Bacteria | 1918 |
| 130 | Ga0068864_100195582 | 3300005618 | Bacteria | 1855 |
| 131 | Ga0068864_101214912 | 3300005618 | Unclassified | 753 |
| 132 | Ga0068866_10012445 | 3300005718 | Bacteria | 3706 |
| 133 | Ga0068861_100063942 | 3300005719 | Bacteria | 2830 |
| 134 | Ga0068861_100192292 | 3300005719 | Unclassified | 1707 |
| 135 | Ga0068851_10045214 | 3300005834 | Bacteria | 2225 |
| 136 | Ga0068870_10047272 | 3300005840 | Bacteria | 2262 |
| 137 | Ga0068860_101037714 | 3300005843 | Bacteria | 838 |
| 138 | Ga0068862_100388222 | 3300005844 | Bacteria | 1304 |
| 139 | Ga0081455_10000208 | 3300005937 | Bacteria | 74660 |
| 140 | Ga0070717_10003286 | 3300006028 | Bacteria | 11565 |
| 141 | Ga0070717_10056378 | 3300006028 | Bacteria | 3246 |
| 142 | Ga0070717_10099335 | 3300006028 | Bacteria | 2469 |
| 143 | Ga0070716_100437704 | 3300006173 | Bacteria | 950 |
| 144 | Ga0070716_100845173 | 3300006173 | Unclassified | 712 |
| 145 | Ga0070712_100095581 | 3300006175 | Bacteria | 2186 |
| 146 | Ga0097621_100141888 | 3300006237 | Bacteria | 2053 |
| 147 | Ga0068871_101323297 | 3300006358 | Unclassified | 678 |
| 148 | Ga0075428_100003108 | 3300006844 | Bacteria | 18124 |
| 149 | Ga0075428_100305243 | 3300006844 | Bacteria | 1711 |
| 150 | Ga0075428_100439985 | 3300006844 | Bacteria | 1397 |
| 151 | Ga0075428_101005861 | 3300006844 | Unclassified | 882 |
| 152 | Ga0075430_100106022 | 3300006846 | Bacteria | 2345 |
| 153 | Ga0075431_100019321 | 3300006847 | Bacteria | 6946 |
| 154 | Ga0075431_100129844 | 3300006847 | Bacteria | 2600 |
| 155 | Ga0075431_100150287 | 3300006847 | Bacteria | 2399 |
| 156 | Ga0075431_100204244 | 3300006847 | Bacteria | 2021 |
| 157 | Ga0075431_100357269 | 3300006847 | Bacteria | 1468 |
| 158 | Ga0075431_100358295 | 3300006847 | Unclassified | 1466 |
| 159 | Ga0075433_10023500 | 3300006852 | Bacteria | 5190 |
| 160 | Ga0075433_10224621 | 3300006852 | Unclassified | 1668 |
| 161 | Ga0075433_10390826 | 3300006852 | Bacteria | 1228 |
| 162 | Ga0075433_10776699 | 3300006852 | Bacteria | 837 |
| 163 | Ga0075434_100007466 | 3300006871 | Bacteria | 10115 |
| 164 | Ga0075434_100043592 | 3300006871 | Bacteria | 4449 |
| 165 | Ga0075434_100055542 | 3300006871 | Bacteria | 3935 |
| 166 | Ga0075434_100114010 | 3300006871 | Unclassified | 2715 |
| 167 | Ga0075434_100263422 | 3300006871 | Unclassified | 1743 |
| 168 | Ga0075434_100274986 | 3300006871 | Bacteria | 1703 |
| 169 | Ga0068865_100008484 | 3300006881 | Bacteria | 6353 |
| 170 | Ga0075436_100007102 | 3300006914 | Bacteria | 7664 |
| 171 | Ga0075436_100022925 | 3300006914 | Bacteria | 4289 |
| 172 | Ga0075436_100097474 | 3300006914 | Unclassified | 2045 |
| 173 | Ga0075436_100151523 | 3300006914 | Unclassified | 1632 |
| 174 | Ga0075436_100235533 | 3300006914 | Bacteria | 1301 |
| 175 | Ga0075436_100971445 | 3300006914 | Bacteria | 637 |
| 176 | Ga0097620_102031266 | 3300006931 | Bacteria | 635 |
| 177 | Ga0075435_100000051 | 3300007076 | Bacteria | 59038 |
| 178 | Ga0075435_100006302 | 3300007076 | Bacteria | 8379 |
| 179 | Ga0075435_100013820 | 3300007076 | Bacteria | 6018 |
| 180 | Ga0075435_100046095 | 3300007076 | Bacteria | 3495 |
| 181 | Ga0075435_100086629 | 3300007076 | Bacteria | 2580 |
| 182 | Ga0075435_100229544 | 3300007076 | Unclassified | 1577 |
| 183 | Ga0099794_10000928 | 3300007265 | Bacteria | 9896 |
| 184 | Ga0099794_10171820 | 3300007265 | Bacteria | 1105 |
| 185 | Ga0099795_10531651 | 3300007788 | Unclassified | 552 |
| 186 | Ga0105240_10125190 | 3300009093 | Bacteria | 3090 |
| 187 | Ga0105240_10504303 | 3300009093 | Bacteria | 1345 |
| 188 | Ga0105240_11397131 | 3300009093 | Bacteria | 736 |
| 189 | Ga0111539_10055749 | 3300009094 | Bacteria | 4699 |
| 190 | Ga0111539_10160895 | 3300009094 | Unclassified | 2626 |
| 191 | Ga0111539_10840582 | 3300009094 | Unclassified | 1068 |
| 192 | Ga0105245_10090667 | 3300009098 | Bacteria | 2812 |
| 193 | Ga0105245_10091336 | 3300009098 | Bacteria | 2802 |
| 194 | Ga0105245_10807116 | 3300009098 | Unclassified | 977 |
| 195 | Ga0105247_10009761 | 3300009101 | Bacteria | 5821 |
| 196 | Ga0114129_10014630 | 3300009147 | Bacteria | 11179 |
| 197 | Ga0114129_10143182 | 3300009147 | Bacteria | 3276 |
| 198 | Ga0114129_10153466 | 3300009147 | Bacteria | 3151 |
| 199 | Ga0114129_10233436 | 3300009147 | Bacteria | 2477 |
| 200 | Ga0114129_11009622 | 3300009147 | Archaea | 1047 |
| 201 | Ga0114129_11273046 | 3300009147 | Unclassified | 913 |
| 202 | Ga0114129_11473404 | 3300009147 | Unclassified | 837 |
| 203 | Ga0114129_11740762 | 3300009147 | Unclassified | 759 |
| 204 | Ga0114129_12217173 | 3300009147 | Bacteria | 661 |
| 205 | Ga0105243_10575976 | 3300009148 | Bacteria | 1080 |
| 206 | Ga0105241_10087737 | 3300009174 | Bacteria | 2449 |
| 207 | Ga0105241_10089093 | 3300009174 | Unclassified | 2431 |
| 208 | Ga0105241_10141904 | 3300009174 | Bacteria | 1957 |
| 209 | Ga0105241_10624246 | 3300009174 | Unclassified | 976 |
| 210 | Ga0105242_10003389 | 3300009176 | Bacteria | 12406 |
| 211 | Ga0105248_10169097 | 3300009177 | Bacteria | 2464 |
| 212 | Ga0105248_10755323 | 3300009177 | Unclassified | 1097 |
| 213 | Ga0105248_11276275 | 3300009177 | Unclassified | 831 |
| 214 | Ga0105238_10175705 | 3300009551 | Bacteria | 2118 |
| 215 | Ga0105249_10039963 | 3300009553 | Bacteria | 4260 |
| 216 | Ga0105239_10231297 | 3300010375 | Bacteria | 2074 |
| 217 | Ga0105239_10595645 | 3300010375 | Unclassified | 1261 |
| 218 | Ga0105239_11225565 | 3300010375 | Bacteria | 865 |
| 219 | Ga0105246_10015894 | 3300011119 | Bacteria | 4760 |
| 220 | Ga0105246_10190138 | 3300011119 | Bacteria | 1588 |
| 221 | Ga0157315_1008082 | 3300012508 | Unclassified | 870 |
| 222 | Ga0157373_10002380 | 3300013100 | Bacteria | 14283 |
| 223 | Ga0157373_10077482 | 3300013100 | Bacteria | 2345 |
| 224 | Ga0157373_10120628 | 3300013100 | Unclassified | 1843 |
| 225 | Ga0157371_10002907 | 3300013102 | Bacteria | 16015 |
| 226 | Ga0157370_10006933 | 3300013104 | Bacteria | 12382 |
| 227 | Ga0157369_10001003 | 3300013105 | Bacteria | 35669 |
| 228 | Ga0157369_10018225 | 3300013105 | Bacteria | 7874 |
| 229 | Ga0157369_10021280 | 3300013105 | Bacteria | 7253 |
| 230 | Ga0157374_10005580 | 3300013296 | Bacteria | 10593 |
| 231 | Ga0157374_10069083 | 3300013296 | Bacteria | 3326 |
| 232 | Ga0157374_10140347 | 3300013296 | Bacteria | 2345 |
| 233 | Ga0157372_10139142 | 3300013307 | Unclassified | 2796 |
| 234 | Ga0157372_10257809 | 3300013307 | Bacteria | 2025 |
| 235 | Ga0157372_10782370 | 3300013307 | Bacteria | 1109 |
| 236 | Ga0157375_10055998 | 3300013308 | Bacteria | 3890 |
| 237 | Ga0163163_10278786 | 3300014325 | Bacteria | 1723 |
| 238 | Ga0163163_12097382 | 3300014325 | Bacteria | 625 |
| 239 | Ga0157380_10027507 | 3300014326 | Unclassified | 4325 |
| 240 | Ga0182008_10050339 | 3300014497 | Bacteria | 2067 |
| 241 | Ga0157377_10001555 | 3300014745 | Bacteria | 9979 |
| 242 | Ga0157376_10014359 | 3300014969 | Bacteria | 5943 |
| 243 | Ga0182006_1171976 | 3300015261 | Unclassified | 725 |
| 244 | Ga0163161_10007569 | 3300017792 | Bacteria | 7509 |
| 245 | Ga0197907_10788264 | 3300020069 | Unclassified | 748 |
| 246 | Ga0206354_10499979 | 3300020081 | Bacteria | 1901 |
| 247 | Ga0206354_11045861 | 3300020081 | Unclassified | 852 |
| 248 | Ga0213871_10125279 | 3300021441 | Bacteria | 768 |
| 249 | Ga0207697_10002780 | 3300025315 | Bacteria | 8929 |
| 250 | Ga0207656_10090925 | 3300025321 | Bacteria | 1385 |
| 251 | Ga0207682_10004106 | 3300025893 | Bacteria | 6177 |
| 252 | Ga0207688_10057032 | 3300025901 | Bacteria | 2195 |
| 253 | Ga0207647_10002672 | 3300025904 | Bacteria | 13456 |
| 254 | Ga0207699_10436596 | 3300025906 | Unclassified | 937 |
| 255 | Ga0207645_10001560 | 3300025907 | Bacteria | 18746 |
| 256 | Ga0207643_10000639 | 3300025908 | Bacteria | 21958 |
| 257 | Ga0207705_10149124 | 3300025909 | Bacteria | 1751 |
| 258 | Ga0207684_10006757 | 3300025910 | Bacteria | 10411 |
| 259 | Ga0207684_10026638 | 3300025910 | Bacteria | 4929 |
| 260 | Ga0207684_10094813 | 3300025910 | Bacteria | 2546 |
| 261 | Ga0207684_10100277 | 3300025910 | Bacteria | 2474 |
| 262 | Ga0207684_10122496 | 3300025910 | Bacteria | 2230 |
| 263 | Ga0207684_11105031 | 3300025910 | Bacteria | 660 |
| 264 | Ga0207695_10320351 | 3300025913 | Bacteria | 1440 |
| 265 | Ga0207695_10660441 | 3300025913 | Bacteria | 926 |
| 266 | Ga0207660_10897641 | 3300025917 | Bacteria | 723 |
| 267 | Ga0207662_10003901 | 3300025918 | Bacteria | 7770 |
| 268 | Ga0207662_10027438 | 3300025918 | Bacteria | 3286 |
| 269 | Ga0207657_10001261 | 3300025919 | Bacteria | 27065 |
| 270 | Ga0207657_10005688 | 3300025919 | Bacteria | 13006 |
| 271 | Ga0207649_10158055 | 3300025920 | Bacteria | 1568 |
| 272 | Ga0207652_10745414 | 3300025921 | Bacteria | 872 |
| 273 | Ga0207646_10000037 | 3300025922 | Bacteria | 196362 |
| 274 | Ga0207646_10037698 | 3300025922 | Bacteria | 4357 |
| 275 | Ga0207646_10045159 | 3300025922 | Bacteria | 3955 |
| 276 | Ga0207646_10544614 | 3300025922 | Bacteria | 1044 |
| 277 | Ga0207646_10771810 | 3300025922 | Bacteria | 857 |
| 278 | Ga0207681_10640794 | 3300025923 | Unclassified | 880 |
| 279 | Ga0207694_10146809 | 3300025924 | Unclassified | 1899 |
| 280 | Ga0207694_10240161 | 3300025924 | Bacteria | 1480 |
| 281 | Ga0207650_10000177 | 3300025925 | Bacteria | 75244 |
| 282 | Ga0207650_10040788 | 3300025925 | Bacteria | 3399 |
| 283 | Ga0207659_10071638 | 3300025926 | Bacteria | 2531 |
| 284 | Ga0207687_10049613 | 3300025927 | Bacteria | 2919 |
| 285 | Ga0207700_10002698 | 3300025928 | Bacteria | 10229 |
| 286 | Ga0207644_10192432 | 3300025931 | Unclassified | 1604 |
| 287 | Ga0207644_10903988 | 3300025931 | Unclassified | 740 |
| 288 | Ga0207690_10402101 | 3300025932 | Unclassified | 1092 |
| 289 | Ga0207690_10745309 | 3300025932 | Unclassified | 807 |
| 290 | Ga0207706_10002495 | 3300025933 | Bacteria | 17927 |
| 291 | Ga0207706_10050747 | 3300025933 | Unclassified | 3666 |
| 292 | Ga0207706_10363744 | 3300025933 | Bacteria | 1257 |
| 293 | Ga0207706_10703718 | 3300025933 | Unclassified | 863 |
| 294 | Ga0207670_10011311 | 3300025936 | Bacteria | 5174 |
| 295 | Ga0207670_10066416 | 3300025936 | Bacteria | 2478 |
| 296 | Ga0207669_10251467 | 3300025937 | Unclassified | 1316 |
| 297 | Ga0207665_10218441 | 3300025939 | Unclassified | 1396 |
| 298 | Ga0207665_10862196 | 3300025939 | Archaea | 717 |
| 299 | Ga0207691_10001447 | 3300025940 | Bacteria | 23651 |
| 300 | Ga0207711_10157713 | 3300025941 | Unclassified | 2052 |
| 301 | Ga0207711_10180516 | 3300025941 | Bacteria | 1919 |
| 302 | Ga0207711_10238366 | 3300025941 | Unclassified | 1668 |
| 303 | Ga0207689_10002307 | 3300025942 | Bacteria | 17863 |
| 304 | Ga0207689_10157922 | 3300025942 | Bacteria | 1869 |
| 305 | Ga0207661_10016213 | 3300025944 | Bacteria | 5494 |
| 306 | Ga0207661_10031498 | 3300025944 | Bacteria | 4098 |
| 307 | Ga0207679_10000143 | 3300025945 | Bacteria | 59141 |
| 308 | Ga0207679_10723538 | 3300025945 | Unclassified | 904 |
| 309 | Ga0207667_10031734 | 3300025949 | Bacteria | 5701 |
| 310 | Ga0207667_11292411 | 3300025949 | Bacteria | 706 |
| 311 | Ga0207651_10043637 | 3300025960 | Bacteria | 2994 |
| 312 | Ga0207668_10059933 | 3300025972 | Bacteria | 2669 |
| 313 | Ga0207640_10004709 | 3300025981 | Bacteria | 7409 |
| 314 | Ga0207640_10232365 | 3300025981 | Unclassified | 1419 |
| 315 | Ga0207640_10791981 | 3300025981 | Unclassified | 820 |
| 316 | Ga0207658_10005160 | 3300025986 | Bacteria | 8995 |
| 317 | Ga0207658_10295432 | 3300025986 | Bacteria | 1394 |
| 318 | Ga0207677_10020934 | 3300026023 | Bacteria | 3985 |
| 319 | Ga0207703_11424508 | 3300026035 | Unclassified | 667 |
| 320 | Ga0207639_10017818 | 3300026041 | Bacteria | 5037 |
| 321 | Ga0207678_10001668 | 3300026067 | Bacteria | 20376 |
| 322 | Ga0207678_10926136 | 3300026067 | Unclassified | 771 |
| 323 | Ga0207708_10337425 | 3300026075 | Unclassified | 1233 |
| 324 | Ga0207702_10071365 | 3300026078 | Bacteria | 2990 |
| 325 | Ga0207702_10187998 | 3300026078 | Bacteria | 1906 |
| 326 | Ga0207641_10003028 | 3300026088 | Bacteria | 15142 |
| 327 | Ga0207641_11375059 | 3300026088 | Unclassified | 707 |
| 328 | Ga0207648_10003457 | 3300026089 | Bacteria | 16564 |
| 329 | Ga0207676_10001159 | 3300026095 | Bacteria | 19817 |
| 330 | Ga0207676_10011008 | 3300026095 | Bacteria | 6457 |
| 331 | Ga0207676_10936926 | 3300026095 | Unclassified | 851 |
| 332 | Ga0207676_11910967 | 3300026095 | Unclassified | 592 |
| 333 | Ga0207674_10000195 | 3300026116 | Bacteria | 75067 |
| 334 | Ga0207674_10498715 | 3300026116 | Bacteria | 1176 |
| 335 | Ga0207674_10744573 | 3300026116 | Unclassified | 946 |
| 336 | Ga0207674_11128874 | 3300026116 | Unclassified | 753 |
| 337 | Ga0207675_100165589 | 3300026118 | Unclassified | 2111 |
| 338 | Ga0207675_100283608 | 3300026118 | Bacteria | 1610 |
| 339 | Ga0207683_10003688 | 3300026121 | Bacteria | 13306 |
| 340 | Ga0207683_10856109 | 3300026121 | Bacteria | 844 |
| 341 | Ga0207698_10260595 | 3300026142 | Unclassified | 1592 |
| 342 | Ga0207698_11255616 | 3300026142 | Bacteria | 755 |
| 343 | Ga0209969_1000819 | 3300027360 | Bacteria | 4180 |
| 344 | Ga0209967_1011141 | 3300027364 | Bacteria | 1258 |
| 345 | Ga0209996_1011764 | 3300027395 | Bacteria | 1171 |
| 346 | Ga0209995_1000526 | 3300027471 | Bacteria | 5798 |
| 347 | Ga0209968_1001120 | 3300027526 | Bacteria | 4084 |
| 348 | Ga0209999_1002816 | 3300027543 | Bacteria | 3080 |
| 349 | Ga0209970_1014279 | 3300027614 | Bacteria | 1319 |
| 350 | Ga0209983_1003507 | 3300027665 | Bacteria | 3342 |
| 351 | Ga0209588_1050130 | 3300027671 | Bacteria | 1351 |
| 352 | Ga0209971_1000031 | 3300027682 | Bacteria | 50315 |
| 353 | Ga0209966_1000020 | 3300027695 | Bacteria | 68386 |
| 354 | Ga0209998_10000024 | 3300027717 | Bacteria | 64123 |
| 355 | Ga0209974_10009769 | 3300027876 | Bacteria | 3252 |
| 356 | Ga0207428_10028705 | 3300027907 | Bacteria | 4620 |
| 357 | Ga0207428_10097852 | 3300027907 | Bacteria | 2271 |
| 358 | Ga0268266_10003235 | 3300028379 | Bacteria | 16447 |
| 359 | Ga0268266_10213480 | 3300028379 | Bacteria | 1771 |
| 360 | Ga0268266_10596101 | 3300028379 | Unclassified | 1061 |
| 361 | Ga0268265_10010967 | 3300028380 | Bacteria | 6120 |
| 362 | Ga0268264_10112259 | 3300028381 | Bacteria | 2389 |
| 363 | Ga0268264_10997612 | 3300028381 | Bacteria | 844 |
| 364 | Ga0265762_1001102 | 3300030760 | Bacteria | 4860 |
| 365 | Ga0307409_101043717 | 3300031995 | Unclassified | 837 |
| 366 | Ga0307416_101195075 | 3300032002 | Unclassified | 866 |
| 367 | Ga0307415_100688471 | 3300032126 | Unclassified | 921 |
| 368 | Ga0316212_1000829 | 3300033547 | Bacteria | 4000 |
| 369 | Ga0373930_0018331 | 3300034816 | Bacteria | 1344 |
| 370 | Ga0373948_0049372 | 3300034817 | Unclassified | 900 |
| 371 | Ga0373959_0001464 | 3300034820 | Bacteria | 3770 |
| 372 | Ga0373938_0000524 | 3300034957 | Bacteria | 6232 |
| 373 | Ga0373928_0010312 | 3300035084 | Bacteria | 1835 |
| 374 | Ga0373929_0001741 | 3300035085 | Bacteria | 4091 |
| 375 | Ga0373949_0026594 | 3300035090 | Bacteria | 1356 |
| 376 | Ga0373949_0030222 | 3300035090 | Bacteria | 1287 |
| 377 | Ga0373951_0011661 | 3300035091 | Bacteria | 1975 |
| 378 | Ga0373952_0000806 | 3300035092 | Bacteria | 5635 |
| 379 | Ga0373932_0025789 | 3300035112 | Bacteria | 1594 |
| 380 | Ga0373939_0000138 | 3300035114 | Bacteria | 20969 |
| 381 | Ga0373941_0000086 | 3300035115 | Bacteria | 15129 |
| 382 | Ga0373960_0008180 | 3300035121 | Bacteria | 2499 |
| 383 | Ga0373942_0001119 | 3300035207 | Bacteria | 7120 |
| 384 | Ga0373961_0006481 | 3300035241 | Bacteria | 2810 |
| 385 | Ga0373962_0014123 | 3300035242 | Bacteria | 2031 |
| 386 | Ga0373931_0002913 | 3300035691 | Bacteria | 7634 |
| 387 | Ga0373933_0249035 | 3300035724 | Bacteria | 1144 |
| 388 | Ga0373937_1251851 | 3300036401 | Bacteria | 690 |
| 389 | Ga0395900_0006116 | 3300037418 | Bacteria | 12551 |
| 390 | Ga0395898_0004956 | 3300037466 | Bacteria | 14452 |
| 391 | Ga0395898_1252723 | 3300037466 | Unclassified | 672 |
| 392 | Ga0395905_0116356 | 3300037471 | Bacteria | 2513 |
| 393 | Ga0395905_0261199 | 3300037471 | Unclassified | 1617 |
| 394 | Ga0395905_0374369 | 3300037471 | Bacteria | 1318 |
| 395 | Ga0395905_0890661 | 3300037471 | Bacteria | 793 |
| 396 | Ga0436364_0910392 | 3300037853 | Bacteria | 658 |
| 397 | Ga0395901_0000893 | 3300038443 | Bacteria | 32764 |
| 398 | Ga0395901_0689782 | 3300038443 | Bacteria | 1020 |
| 399 | Ga0242422_00891 | 3300038699 | Unclassified | 2023 |
| 400 | Ga0436365_0524461 | 3300039437 | Bacteria | 1620 |
| 401 | Ga0436365_1738066 | 3300039437 | Bacteria | 103785 |
| 402 | Ga0436360_0729932 | 3300039438 | Bacteria | 1461 |
| 403 | Ga0436361_0068265 | 3300039447 | Unclassified | 603 |
| 404 | Ga0436363_0606919 | 3300039450 | Unclassified | 546 |
| 405 | Ga0439431_0258607 | 3300041997 | Unclassified | 518 |
| 406 | Ga0439448_0018809 | 3300042005 | Unclassified | 2121 |
| 407 | Ga0439435_0021051 | 3300042436 | Unclassified | 1689 |
| 408 | Ga0439460_0034586 | 3300042461 | Unclassified | 1457 |
| 409 | Ga0451577_0106161 | 3300042876 | Bacteria | 2510 |
| 410 | Ga0451577_0108922 | 3300042876 | Bacteria | 2477 |
| 411 | Ga0439440_0009259 | 3300042993 | Unclassified | 2039 |
| 412 | Ga0453683_0002445 | 3300044673 | Bacteria | 14394 |
| 413 | Ga0453683_0129805 | 3300044673 | Bacteria | 1587 |
| 414 | Ga0453684_1121112 | 3300044712 | Bacteria | 830 |
| 415 | Ga0451576_0010342 | 3300045051 | Bacteria | 10713 |
| 416 | Ga0451576_0110810 | 3300045051 | Bacteria | 2856 |
| 417 | Ga0451576_1085668 | 3300045051 | Bacteria | 838 |
| 418 | Ga0451576_1921342 | 3300045051 | Unclassified | 610 |
| 419 | Ga0495669_0597777 | 3300046684 | Unclassified | 537 |
| 420 | Ga0496100_0088097 | 3300048903 | Bacteria | 2112 |
| 421 | Ga0496101_0475260 | 3300048904 | Unclassified | 987 |
| 422 | Ga0496102_0212725 | 3300048905 | Bacteria | 1823 |
| 423 | Ga0496102_0231649 | 3300048905 | Bacteria | 1741 |
| 424 | Ga0496103_0046092 | 3300048906 | Bacteria | 2691 |
| 425 | Ga0496106_0058178 | 3300048909 | Bacteria | 2926 |
| 426 | Ga0496106_0191571 | 3300048909 | Unclassified | 1626 |
| 427 | Ga0496106_0737713 | 3300048909 | Unclassified | 784 |
| 428 | Ga0496107_0046578 | 3300048910 | Bacteria | 3121 |
| 429 | Ga0496107_0529349 | 3300048910 | Unclassified | 874 |
| 430 | Ga0496108_0000689 | 3300048911 | Bacteria | 26147 |
| 431 | Ga0496109_0001300 | 3300048912 | Bacteria | 20670 |
| 432 | Ga0496110_0043918 | 3300048913 | Bacteria | 3902 |
| 433 | Ga0496115_0428869 | 3300048918 | Bacteria | 1070 |
| 434 | Ga0501032_0228077 | 3300049569 | Unclassified | 1211 |
| 435 | Ga0501033_0072748 | 3300049570 | Bacteria | 2524 |
| 436 | Ga0501036_0272373 | 3300049572 | Bacteria | 1417 |
| 437 | Ga0501038_0038405 | 3300049574 | Bacteria | 4193 |
| 438 | Ga0501039_0006276 | 3300049575 | Bacteria | 9027 |
| 439 | Ga0501040_0002281 | 3300049576 | Bacteria | 12329 |
| 440 | Ga0501041_0034373 | 3300049577 | Bacteria | 3068 |
| 441 | Ga0501042_0022078 | 3300049578 | Bacteria | 4443 |
| 442 | Ga0501043_0093359 | 3300049579 | Bacteria | 2366 |
| 443 | Ga0501046_0000607 | 3300049580 | Bacteria | 35214 |
| 444 | Ga0501046_0459772 | 3300049580 | Bacteria | 915 |
| 445 | Ga0501047_0053799 | 3300049581 | Bacteria | 3894 |
| 446 | Ga0501067_0327527 | 3300049583 | Bacteria | 853 |
| 447 | Ga0501068_0068188 | 3300049584 | Bacteria | 2168 |
| 448 | Ga0501068_0177681 | 3300049584 | Bacteria | 1345 |
| 449 | Ga0501069_0058008 | 3300049585 | Bacteria | 2159 |
| 450 | Ga0501070_0025641 | 3300049586 | Bacteria | 4945 |
| 451 | Ga0501072_0049358 | 3300049588 | Bacteria | 3313 |
| 452 | Ga0501073_0004686 | 3300049589 | Bacteria | 10276 |
| 453 | Ga0501073_0662468 | 3300049589 | Bacteria | 720 |
| 454 | Ga0501074_0007780 | 3300049590 | Bacteria | 7758 |
| 455 | Ga0501074_0088465 | 3300049590 | Bacteria | 2218 |
| 456 | Ga0501074_1140211 | 3300049590 | Unclassified | 547 |
| 457 | Ga0501075_0005460 | 3300049591 | Bacteria | 8691 |
| 458 | Ga0501076_0053357 | 3300049592 | Bacteria | 3203 |
| 459 | Ga0501077_0134496 | 3300049593 | Unclassified | 1568 |
| 460 | Ga0501217_026373 | 3300049661 | Bacteria | 1404 |
| 461 | Ga0501079_0000976 | 3300049741 | Bacteria | 19702 |
| 462 | Ga0501080_0046004 | 3300049742 | Bacteria | 4065 |
| 463 | Ga0501080_0131268 | 3300049742 | Bacteria | 2319 |
| 464 | Ga0501081_0017810 | 3300049743 | Bacteria | 4708 |
| 465 | Ga0501081_0911785 | 3300049743 | Bacteria | 663 |
| 466 | Ga0501083_0058995 | 3300049744 | Bacteria | 2567 |
| 467 | Ga0501083_0071395 | 3300049744 | Unclassified | 2308 |
| 468 | Ga0501045_0003234 | 3300049824 | Bacteria | 11126 |
| 469 | Ga0501045_0201339 | 3300049824 | Unclassified | 1483 |
| 470 | nmdc:mga05p37_1090256_c1 | 3300050507 | Bacteria | 837 |
| 471 | nmdc:mga05p37_1153359_c1 | 3300050507 | Bacteria | 806 |
| 472 | nmdc:mga05p37_1195207_c1 | 3300050507 | Bacteria | 786 |
| 473 | nmdc:mga05p37_133931_c1 | 3300050507 | Bacteria | 3040 |
| 474 | nmdc:mga05p37_1580043_c1 | 3300050507 | Bacteria | 648 |
| 475 | nmdc:mga05p37_479355_c1 | 3300050507 | Bacteria | 1433 |
| 476 | nmdc:mga05p37_594168_c1 | 3300050507 | Unclassified | 1251 |
| 477 | nmdc:mga09592_1558590_c1 | 3300050508 | Bacteria | 536 |
| 478 | nmdc:mga09592_965702_c1 | 3300050508 | Unclassified | 714 |
| 479 | nmdc:mga0qj67_172933_c1 | 3300050509 | Bacteria | 1754 |
| 480 | nmdc:mga06r32_159581_c1 | 3300050510 | Bacteria | 2237 |
| 481 | nmdc:mga06r32_162149_c1 | 3300050510 | Bacteria | 2218 |
| 482 | nmdc:mga06r32_268647_c1 | 3300050510 | Unclassified | 1693 |
| 483 | nmdc:mga06r32_345464_c1 | 3300050510 | Bacteria | 1472 |
| 484 | nmdc:mga06r32_54016_c1 | 3300050510 | Unclassified | 3851 |
| 485 | nmdc:mga06r32_722177_c1 | 3300050510 | Bacteria | 961 |
| 486 | nmdc:mga06r32_85049_c1 | 3300050510 | Bacteria | 3084 |
| 487 | nmdc:mga08y16_64803_c1 | 3300050511 | Unclassified | 3815 |
| 488 | nmdc:mga08y16_814776_c1 | 3300050511 | Unclassified | 925 |
| 489 | nmdc:mga08y16_945711_c1 | 3300050511 | Unclassified | 845 |
| 490 | nmdc:mga0n895_1329251_c1 | 3300050512 | Unclassified | 689 |
| 491 | nmdc:mga0n895_137297_c1 | 3300050512 | Unclassified | 2472 |
| 492 | nmdc:mga0n895_362992_c1 | 3300050512 | Bacteria | 1466 |
| 493 | nmdc:mga0n895_41798_c1 | 3300050512 | Bacteria | 4458 |
| 494 | nmdc:mga0n895_4_c1 | 3300050512 | Bacteria | 133851 |
| 495 | nmdc:mga0n895_50053_c1 | 3300050512 | Bacteria | 4096 |
| 496 | nmdc:mga0n895_80538_c1 | 3300050512 | Bacteria | 3245 |
| 497 | nmdc:mga0rr50_168177_c1 | 3300050513 | Unclassified | 1784 |
| 498 | nmdc:mga0rr50_221644_c1 | 3300050513 | Unclassified | 1562 |
| 499 | nmdc:mga0rr50_43462_c1 | 3300050513 | Unclassified | 3289 |
| 500 | nmdc:mga0rr50_4_c1 | 3300050513 | Bacteria | 338870 |
| 501 | nmdc:mga08x19_137781_c1 | 3300050514 | Unclassified | 1646 |
| 502 | nmdc:mga08x19_228025_c1 | 3300050514 | Unclassified | 1282 |
| 503 | nmdc:mga08x19_48137_c1 | 3300050514 | Bacteria | 2730 |
| 504 | nmdc:mga08x19_5253_c1 | 3300050514 | Bacteria | 7664 |
| 505 | nmdc:mga0a205_196177_c1 | 3300050515 | Bacteria | 1910 |
| 506 | nmdc:mga0a205_30717_c1 | 3300050515 | Bacteria | 5146 |
| 507 | nmdc:mga0a205_311286_c1 | 3300050515 | Bacteria | 1447 |
| 508 | nmdc:mga0a205_697575_c1 | 3300050515 | Bacteria | 865 |
| 509 | Ga0501084_0010953 | 3300054114 | Bacteria | 7511 |
| 510 | Ga0501082_0001321 | 3300060353 | Bacteria | 21707 |
| 511 | Ga0501082_0012651 | 3300060353 | Bacteria | 7253 |
| 512 | Ga0530510_0062847 | 3300061734 | Bacteria | 2688 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006844 | Ga0075428_100003108 | Ga0075428_10000310814 | 136 |
| 2 | 3300006914 | Ga0075436_100097474 | Ga0075436_1000974743 | 138 |
| 3 | 3300027671 | Ga0209588_1050130 | Ga0209588_10501302 | 138 |
| 4 | 3300005327 | Ga0070658_11064725 | Ga0070658_110647251 | 139 |
| 5 | 3300005343 | Ga0070687_100035503 | Ga0070687_1000355031 | 139 |
| 6 | 3300005364 | Ga0070673_100387537 | Ga0070673_1003875372 | 139 |
| 7 | 3300005366 | Ga0070659_100078244 | Ga0070659_1000782444 | 139 |
| 8 | 3300005539 | Ga0068853_100116109 | Ga0068853_1001161092 | 139 |
| 9 | 3300005543 | Ga0070672_101130777 | Ga0070672_1011307771 | 139 |
| 10 | 3300005544 | Ga0070686_100004656 | Ga0070686_1000046566 | 139 |
| 11 | 3300005546 | Ga0070696_100319163 | Ga0070696_1003191632 | 139 |
| 12 | 3300005563 | Ga0068855_100229287 | Ga0068855_1002292872 | 139 |
| 13 | 3300005578 | Ga0068854_100355855 | Ga0068854_1003558552 | 139 |
| 14 | 3300005616 | Ga0068852_100379183 | Ga0068852_1003791832 | 139 |
| 15 | 3300005719 | Ga0068861_100192292 | Ga0068861_1001922922 | 139 |
| 16 | 3300006871 | Ga0075434_100007466 | Ga0075434_1000074667 | 139 |
| 17 | 3300006914 | Ga0075436_100007102 | Ga0075436_1000071026 | 139 |
| 18 | 3300006914 | Ga0075436_100151523 | Ga0075436_1001515233 | 139 |
| 19 | 3300007076 | Ga0075435_100000051 | Ga0075435_10000005144 | 139 |
| 20 | 3300007076 | Ga0075435_100006302 | Ga0075435_1000063024 | 139 |
| 21 | 3300025913 | Ga0207695_10320351 | Ga0207695_103203511 | 139 |
| 22 | 3300025931 | Ga0207644_10903988 | Ga0207644_109039881 | 139 |
| 23 | 3300025941 | Ga0207711_10238366 | Ga0207711_102383662 | 139 |
| 24 | 3300025981 | Ga0207640_10791981 | Ga0207640_107919811 | 139 |
| 25 | 3300034816 | Ga0373930_0018331 | Ga0373930_0018331_197_616 | 139 |
| 26 | 3300034817 | Ga0373948_0049372 | Ga0373948_0049372_461_880 | 139 |
| 27 | 3300034820 | Ga0373959_0001464 | Ga0373959_0001464_3247_3666 | 139 |
| 28 | 3300034957 | Ga0373938_0000524 | Ga0373938_0000524_3501_3920 | 139 |
| 29 | 3300035084 | Ga0373928_0010312 | Ga0373928_0010312_342_761 | 139 |
| 30 | 3300035085 | Ga0373929_0001741 | Ga0373929_0001741_3476_3895 | 139 |
| 31 | 3300035090 | Ga0373949_0026594 | Ga0373949_0026594_586_1005 | 139 |
| 32 | 3300035091 | Ga0373951_0011661 | Ga0373951_0011661_143_562 | 139 |
| 33 | 3300035092 | Ga0373952_0000806 | Ga0373952_0000806_2075_2494 | 139 |
| 34 | 3300035112 | Ga0373932_0025789 | Ga0373932_0025789_77_496 | 139 |
| 35 | 3300035114 | Ga0373939_0000138 | Ga0373939_0000138_6695_7114 | 139 |
| 36 | 3300035115 | Ga0373941_0000086 | Ga0373941_0000086_3327_3746 | 139 |
| 37 | 3300035121 | Ga0373960_0008180 | Ga0373960_0008180_1651_2070 | 139 |
| 38 | 3300035207 | Ga0373942_0001119 | Ga0373942_0001119_6546_6965 | 139 |
| 39 | 3300035241 | Ga0373961_0006481 | Ga0373961_0006481_1981_2400 | 139 |
| 40 | 3300035242 | Ga0373962_0014123 | Ga0373962_0014123_1103_1522 | 139 |
| 41 | 3300035691 | Ga0373931_0002913 | Ga0373931_0002913_5418_5837 | 139 |
| 42 | 3300045051 | Ga0451576_0010342 | Ga0451576_0010342_10157_10576 | 139 |
| 43 | 3300050512 | nmdc:mga0n895_4_c1 | nmdc:mga0n895_4_c1_19259_19678 | 139 |
| 44 | 3300050513 | nmdc:mga0rr50_4_c1 | nmdc:mga0rr50_4_c1_165420_165839 | 139 |
| 45 | 3300050514 | nmdc:mga08x19_5253_c1 | nmdc:mga08x19_5253_c1_3835_4254 | 139 |
| 46 | 3300033547 | Ga0316212_1000829 | Ga0316212_10008294 | 140 |
| 47 | 3300005437 | Ga0070710_10547688 | Ga0070710_105476881 | 141 |
| 48 | 3300005439 | Ga0070711_100000674 | Ga0070711_1000006742 | 141 |
| 49 | 3300005467 | Ga0070706_100169661 | Ga0070706_1001696613 | 141 |
| 50 | 3300005467 | Ga0070706_100182362 | Ga0070706_1001823622 | 141 |
| 51 | 3300005471 | Ga0070698_100252672 | Ga0070698_1002526722 | 141 |
| 52 | 3300005536 | Ga0070697_100026992 | Ga0070697_1000269925 | 141 |
| 53 | 3300006028 | Ga0070717_10003286 | Ga0070717_1000328612 | 141 |
| 54 | 3300006028 | Ga0070717_10056378 | Ga0070717_100563783 | 141 |
| 55 | 3300006028 | Ga0070717_10099335 | Ga0070717_100993353 | 141 |
| 56 | 3300006175 | Ga0070712_100095581 | Ga0070712_1000955813 | 141 |
| 57 | 3300006914 | Ga0075436_100235533 | Ga0075436_1002355331 | 141 |
| 58 | 3300007788 | Ga0099795_10531651 | Ga0099795_105316511 | 141 |
| 59 | 3300014325 | Ga0163163_12097382 | Ga0163163_120973822 | 141 |
| 60 | 3300025910 | Ga0207684_10122496 | Ga0207684_101224962 | 141 |
| 61 | 3300025928 | Ga0207700_10002698 | Ga0207700_100026987 | 141 |
| 62 | 3300030760 | Ga0265762_1001102 | Ga0265762_10011021 | 141 |
| 63 | 3300050512 | nmdc:mga0n895_1329251_c1 | nmdc:mga0n895_1329251_c1_182_625 | 141 |
| 64 | 3300050514 | nmdc:mga08x19_48137_c1 | nmdc:mga08x19_48137_c1_107_550 | 141 |
| 65 | 3300005293 | Ga0065715_10136418 | Ga0065715_101364182 | 142 |
| 66 | 3300005329 | Ga0070683_100182271 | Ga0070683_1001822712 | 142 |
| 67 | 3300005336 | Ga0070680_100478016 | Ga0070680_1004780162 | 142 |
| 68 | 3300005340 | Ga0070689_100066217 | Ga0070689_1000662173 | 142 |
| 69 | 3300005341 | Ga0070691_10123081 | Ga0070691_101230812 | 142 |
| 70 | 3300005445 | Ga0070708_100815561 | Ga0070708_1008155612 | 142 |
| 71 | 3300005458 | Ga0070681_10239774 | Ga0070681_102397741 | 142 |
| 72 | 3300005518 | Ga0070699_100273406 | Ga0070699_1002734062 | 142 |
| 73 | 3300005518 | Ga0070699_100661012 | Ga0070699_1006610121 | 142 |
| 74 | 3300005530 | Ga0070679_100182908 | Ga0070679_1001829082 | 142 |
| 75 | 3300005535 | Ga0070684_101001475 | Ga0070684_1010014752 | 142 |
| 76 | 3300005844 | Ga0068862_100388222 | Ga0068862_1003882221 | 142 |
| 77 | 3300009147 | Ga0114129_10014630 | Ga0114129_100146302 | 142 |
| 78 | 3300009147 | Ga0114129_10143182 | Ga0114129_101431822 | 142 |
| 79 | 3300009147 | Ga0114129_10153466 | Ga0114129_101534663 | 142 |
| 80 | 3300009551 | Ga0105238_10175705 | Ga0105238_101757052 | 142 |
| 81 | 3300020069 | Ga0197907_10788264 | Ga0197907_107882641 | 142 |
| 82 | 3300020081 | Ga0206354_11045861 | Ga0206354_110458611 | 142 |
| 83 | 3300021441 | Ga0213871_10125279 | Ga0213871_101252792 | 142 |
| 84 | 3300025921 | Ga0207652_10745414 | Ga0207652_107454142 | 142 |
| 85 | 3300025924 | Ga0207694_10240161 | Ga0207694_102401612 | 142 |
| 86 | 3300025939 | Ga0207665_10862196 | Ga0207665_108621961 | 142 |
| 87 | 3300025944 | Ga0207661_10031498 | Ga0207661_100314982 | 142 |
| 88 | 3300026116 | Ga0207674_11128874 | Ga0207674_111288741 | 142 |
| 89 | 3300035724 | Ga0373933_0249035 | Ga0373933_0249035_366_800 | 142 |
| 90 | 3300037471 | Ga0395905_0116356 | Ga0395905_0116356_1794_2222 | 142 |
| 91 | 3300037471 | Ga0395905_0261199 | Ga0395905_0261199_838_1266 | 142 |
| 92 | 3300037471 | Ga0395905_0890661 | Ga0395905_0890661_19_447 | 142 |
| 93 | 3300038443 | Ga0395901_0689782 | Ga0395901_0689782_68_496 | 142 |
| 94 | 3300039437 | Ga0436365_1738066 | Ga0436365_1738066_81205_81633 | 142 |
| 95 | 3300044673 | Ga0453683_0002445 | Ga0453683_0002445_2345_2773 | 142 |
| 96 | 3300049580 | Ga0501046_0459772 | Ga0501046_0459772_318_758 | 142 |
| 97 | 3300049589 | Ga0501073_0004686 | Ga0501073_0004686_8158_8604 | 142 |
| 98 | 3300049589 | Ga0501073_0662468 | Ga0501073_0662468_61_507 | 142 |
| 99 | 3300050507 | nmdc:mga05p37_1153359_c1 | nmdc:mga05p37_1153359_c1_121_573 | 142 |
| 100 | 3300050507 | nmdc:mga05p37_133931_c1 | nmdc:mga05p37_133931_c1_1315_1743 | 142 |
| 101 | 3300050507 | nmdc:mga05p37_1580043_c1 | nmdc:mga05p37_1580043_c1_154_582 | 142 |
| 102 | 3300050512 | nmdc:mga0n895_362992_c1 | nmdc:mga0n895_362992_c1_657_1091 | 142 |
| 103 | 3300050512 | nmdc:mga0n895_41798_c1 | nmdc:mga0n895_41798_c1_3729_4157 | 142 |
| 104 | 3300050515 | nmdc:mga0a205_30717_c1 | nmdc:mga0a205_30717_c1_3602_4030 | 142 |
| 105 | 3300050515 | nmdc:mga0a205_311286_c1 | nmdc:mga0a205_311286_c1_667_1095 | 142 |
| 106 | 3300050515 | nmdc:mga0a205_697575_c1 | nmdc:mga0a205_697575_c1_182_610 | 142 |
| 107 | 3300042005 | Ga0439448_0018809 | Ga0439448_0018809_1182_1613 | 143 |
| 108 | 3300005444 | Ga0070694_100593872 | Ga0070694_1005938722 | 144 |
| 109 | 3300005535 | Ga0070684_100304928 | Ga0070684_1003049282 | 144 |
| 110 | 3300005618 | Ga0068864_100019391 | Ga0068864_1000193915 | 144 |
| 111 | 3300006852 | Ga0075433_10390826 | Ga0075433_103908262 | 144 |
| 112 | 3300006871 | Ga0075434_100274986 | Ga0075434_1002749863 | 144 |
| 113 | 3300009093 | Ga0105240_10125190 | Ga0105240_101251902 | 144 |
| 114 | 3300009093 | Ga0105240_10504303 | Ga0105240_105043032 | 144 |
| 115 | 3300009094 | Ga0111539_10160895 | Ga0111539_101608952 | 144 |
| 116 | 3300013104 | Ga0157370_10006933 | Ga0157370_100069339 | 144 |
| 117 | 3300013105 | Ga0157369_10001003 | Ga0157369_1000100316 | 144 |
| 118 | 3300020081 | Ga0206354_10499979 | Ga0206354_104999792 | 144 |
| 119 | 3300026095 | Ga0207676_10011008 | Ga0207676_100110086 | 144 |
| 120 | 3300045051 | Ga0451576_1085668 | Ga0451576_1085668_336_770 | 144 |
| 121 | 3300050515 | nmdc:mga0a205_196177_c1 | nmdc:mga0a205_196177_c1_646_1080 | 144 |
| 122 | 3300003347 | JGI26128J50194_1006590 | JGI26128J50194_10065902 | 145 |
| 123 | 3300003349 | JGI26129J50193_1010430 | JGI26129J50193_10104302 | 145 |
| 124 | 3300003911 | JGI25405J52794_10025671 | JGI25405J52794_100256711 | 145 |
| 125 | 3300005295 | Ga0065707_10262742 | Ga0065707_102627422 | 145 |
| 126 | 3300005434 | Ga0070709_10813392 | Ga0070709_108133921 | 145 |
| 127 | 3300005434 | Ga0070709_11158549 | Ga0070709_111585491 | 145 |
| 128 | 3300005440 | Ga0070705_101455288 | Ga0070705_1014552881 | 145 |
| 129 | 3300005444 | Ga0070694_100056884 | Ga0070694_1000568842 | 145 |
| 130 | 3300005445 | Ga0070708_100126723 | Ga0070708_1001267232 | 145 |
| 131 | 3300005445 | Ga0070708_100269096 | Ga0070708_1002690963 | 145 |
| 132 | 3300005445 | Ga0070708_100353701 | Ga0070708_1003537012 | 145 |
| 133 | 3300005445 | Ga0070708_100478475 | Ga0070708_1004784752 | 145 |
| 134 | 3300005445 | Ga0070708_100856207 | Ga0070708_1008562071 | 145 |
| 135 | 3300005445 | Ga0070708_101005836 | Ga0070708_1010058362 | 145 |
| 136 | 3300005457 | Ga0070662_100015410 | Ga0070662_1000154103 | 145 |
| 137 | 3300005467 | Ga0070706_100012720 | Ga0070706_1000127202 | 145 |
| 138 | 3300005467 | Ga0070706_100094363 | Ga0070706_1000943634 | 145 |
| 139 | 3300005467 | Ga0070706_100151857 | Ga0070706_1001518572 | 145 |
| 140 | 3300005467 | Ga0070706_100167209 | Ga0070706_1001672092 | 145 |
| 141 | 3300005468 | Ga0070707_100000050 | Ga0070707_10000005022 | 145 |
| 142 | 3300005468 | Ga0070707_100013117 | Ga0070707_1000131172 | 145 |
| 143 | 3300005468 | Ga0070707_100169401 | Ga0070707_1001694013 | 145 |
| 144 | 3300005471 | Ga0070698_100003437 | Ga0070698_1000034379 | 145 |
| 145 | 3300005471 | Ga0070698_100029289 | Ga0070698_1000292895 | 145 |
| 146 | 3300005471 | Ga0070698_100136460 | Ga0070698_1001364602 | 145 |
| 147 | 3300005471 | Ga0070698_101420719 | Ga0070698_1014207191 | 145 |
| 148 | 3300005518 | Ga0070699_100002495 | Ga0070699_10000249515 | 145 |
| 149 | 3300005518 | Ga0070699_100010410 | Ga0070699_1000104106 | 145 |
| 150 | 3300005518 | Ga0070699_100104125 | Ga0070699_1001041253 | 145 |
| 151 | 3300005518 | Ga0070699_100259159 | Ga0070699_1002591593 | 145 |
| 152 | 3300005518 | Ga0070699_100305570 | Ga0070699_1003055702 | 145 |
| 153 | 3300005518 | Ga0070699_100617065 | Ga0070699_1006170652 | 145 |
| 154 | 3300005518 | Ga0070699_100909890 | Ga0070699_1009098902 | 145 |
| 155 | 3300005518 | Ga0070699_101203794 | Ga0070699_1012037941 | 145 |
| 156 | 3300005518 | Ga0070699_101585877 | Ga0070699_1015858771 | 145 |
| 157 | 3300005536 | Ga0070697_100018675 | Ga0070697_1000186757 | 145 |
| 158 | 3300005536 | Ga0070697_100043246 | Ga0070697_1000432463 | 145 |
| 159 | 3300005536 | Ga0070697_100070003 | Ga0070697_1000700032 | 145 |
| 160 | 3300005536 | Ga0070697_100146907 | Ga0070697_1001469074 | 145 |
| 161 | 3300005536 | Ga0070697_100166926 | Ga0070697_1001669262 | 145 |
| 162 | 3300005536 | Ga0070697_100258509 | Ga0070697_1002585091 | 145 |
| 163 | 3300005536 | Ga0070697_100644097 | Ga0070697_1006440972 | 145 |
| 164 | 3300005536 | Ga0070697_100646849 | Ga0070697_1006468492 | 145 |
| 165 | 3300005536 | Ga0070697_100704675 | Ga0070697_1007046752 | 145 |
| 166 | 3300005545 | Ga0070695_100011739 | Ga0070695_1000117392 | 145 |
| 167 | 3300005545 | Ga0070695_100208810 | Ga0070695_1002088102 | 145 |
| 168 | 3300005546 | Ga0070696_100446022 | Ga0070696_1004460222 | 145 |
| 169 | 3300005548 | Ga0070665_100087159 | Ga0070665_1000871592 | 145 |
| 170 | 3300005549 | Ga0070704_100392938 | Ga0070704_1003929381 | 145 |
| 171 | 3300005549 | Ga0070704_100606082 | Ga0070704_1006060822 | 145 |
| 172 | 3300005549 | Ga0070704_101333379 | Ga0070704_1013333792 | 145 |
| 173 | 3300005577 | Ga0068857_100648008 | Ga0068857_1006480082 | 145 |
| 174 | 3300005578 | Ga0068854_100004621 | Ga0068854_1000046214 | 145 |
| 175 | 3300005615 | Ga0070702_100147947 | Ga0070702_1001479472 | 145 |
| 176 | 3300005618 | Ga0068864_100182793 | Ga0068864_1001827933 | 145 |
| 177 | 3300005618 | Ga0068864_101214912 | Ga0068864_1012149121 | 145 |
| 178 | 3300005937 | Ga0081455_10000208 | Ga0081455_1000020870 | 145 |
| 179 | 3300006844 | Ga0075428_100305243 | Ga0075428_1003052433 | 145 |
| 180 | 3300006844 | Ga0075428_100439985 | Ga0075428_1004399852 | 145 |
| 181 | 3300006844 | Ga0075428_101005861 | Ga0075428_1010058611 | 145 |
| 182 | 3300006846 | Ga0075430_100106022 | Ga0075430_1001060222 | 145 |
| 183 | 3300006847 | Ga0075431_100019321 | Ga0075431_1000193213 | 145 |
| 184 | 3300006847 | Ga0075431_100129844 | Ga0075431_1001298443 | 145 |
| 185 | 3300006847 | Ga0075431_100150287 | Ga0075431_1001502873 | 145 |
| 186 | 3300006847 | Ga0075431_100204244 | Ga0075431_1002042442 | 145 |
| 187 | 3300006847 | Ga0075431_100357269 | Ga0075431_1003572691 | 145 |
| 188 | 3300006847 | Ga0075431_100358295 | Ga0075431_1003582952 | 145 |
| 189 | 3300006852 | Ga0075433_10224621 | Ga0075433_102246213 | 145 |
| 190 | 3300006852 | Ga0075433_10776699 | Ga0075433_107766992 | 145 |
| 191 | 3300006871 | Ga0075434_100043592 | Ga0075434_1000435923 | 145 |
| 192 | 3300006871 | Ga0075434_100114010 | Ga0075434_1001140104 | 145 |
| 193 | 3300006871 | Ga0075434_100263422 | Ga0075434_1002634223 | 145 |
| 194 | 3300006914 | Ga0075436_100022925 | Ga0075436_1000229253 | 145 |
| 195 | 3300006914 | Ga0075436_100971445 | Ga0075436_1009714451 | 145 |
| 196 | 3300006931 | Ga0097620_102031266 | Ga0097620_1020312661 | 145 |
| 197 | 3300007076 | Ga0075435_100013820 | Ga0075435_1000138207 | 145 |
| 198 | 3300007076 | Ga0075435_100046095 | Ga0075435_1000460952 | 145 |
| 199 | 3300007076 | Ga0075435_100086629 | Ga0075435_1000866294 | 145 |
| 200 | 3300007076 | Ga0075435_100229544 | Ga0075435_1002295442 | 145 |
| 201 | 3300007265 | Ga0099794_10000928 | Ga0099794_100009285 | 145 |
| 202 | 3300007265 | Ga0099794_10171820 | Ga0099794_101718202 | 145 |
| 203 | 3300009093 | Ga0105240_11397131 | Ga0105240_113971312 | 145 |
| 204 | 3300009094 | Ga0111539_10055749 | Ga0111539_100557491 | 145 |
| 205 | 3300009098 | Ga0105245_10807116 | Ga0105245_108071162 | 145 |
| 206 | 3300009147 | Ga0114129_10233436 | Ga0114129_102334361 | 145 |
| 207 | 3300009147 | Ga0114129_11009622 | Ga0114129_110096222 | 145 |
| 208 | 3300009147 | Ga0114129_11273046 | Ga0114129_112730461 | 145 |
| 209 | 3300009147 | Ga0114129_11473404 | Ga0114129_114734041 | 145 |
| 210 | 3300009147 | Ga0114129_11740762 | Ga0114129_117407622 | 145 |
| 211 | 3300009147 | Ga0114129_12217173 | Ga0114129_122171732 | 145 |
| 212 | 3300009148 | Ga0105243_10575976 | Ga0105243_105759763 | 145 |
| 213 | 3300009174 | Ga0105241_10141904 | Ga0105241_101419042 | 145 |
| 214 | 3300009174 | Ga0105241_10624246 | Ga0105241_106242461 | 145 |
| 215 | 3300009177 | Ga0105248_10169097 | Ga0105248_101690973 | 145 |
| 216 | 3300009177 | Ga0105248_10755323 | Ga0105248_107553232 | 145 |
| 217 | 3300010375 | Ga0105239_10595645 | Ga0105239_105956452 | 145 |
| 218 | 3300011119 | Ga0105246_10190138 | Ga0105246_101901381 | 145 |
| 219 | 3300013100 | Ga0157373_10120628 | Ga0157373_101206282 | 145 |
| 220 | 3300013307 | Ga0157372_10139142 | Ga0157372_101391422 | 145 |
| 221 | 3300013307 | Ga0157372_10257809 | Ga0157372_102578092 | 145 |
| 222 | 3300025906 | Ga0207699_10436596 | Ga0207699_104365962 | 145 |
| 223 | 3300025910 | Ga0207684_10006757 | Ga0207684_100067576 | 145 |
| 224 | 3300025910 | Ga0207684_10026638 | Ga0207684_100266383 | 145 |
| 225 | 3300025910 | Ga0207684_10094813 | Ga0207684_100948134 | 145 |
| 226 | 3300025910 | Ga0207684_10100277 | Ga0207684_101002772 | 145 |
| 227 | 3300025910 | Ga0207684_11105031 | Ga0207684_111050312 | 145 |
| 228 | 3300025913 | Ga0207695_10660441 | Ga0207695_106604411 | 145 |
| 229 | 3300025918 | Ga0207662_10027438 | Ga0207662_100274383 | 145 |
| 230 | 3300025922 | Ga0207646_10000037 | Ga0207646_1000003754 | 145 |
| 231 | 3300025922 | Ga0207646_10037698 | Ga0207646_100376982 | 145 |
| 232 | 3300025922 | Ga0207646_10045159 | Ga0207646_100451593 | 145 |
| 233 | 3300025922 | Ga0207646_10544614 | Ga0207646_105446142 | 145 |
| 234 | 3300025922 | Ga0207646_10771810 | Ga0207646_107718102 | 145 |
| 235 | 3300025932 | Ga0207690_10402101 | Ga0207690_104021012 | 145 |
| 236 | 3300025933 | Ga0207706_10363744 | Ga0207706_103637442 | 145 |
| 237 | 3300025933 | Ga0207706_10703718 | Ga0207706_107037182 | 145 |
| 238 | 3300025936 | Ga0207670_10066416 | Ga0207670_100664163 | 145 |
| 239 | 3300025941 | Ga0207711_10157713 | Ga0207711_101577133 | 145 |
| 240 | 3300025981 | Ga0207640_10004709 | Ga0207640_100047097 | 145 |
| 241 | 3300026035 | Ga0207703_11424508 | Ga0207703_114245082 | 145 |
| 242 | 3300026095 | Ga0207676_10936926 | Ga0207676_109369262 | 145 |
| 243 | 3300026095 | Ga0207676_11910967 | Ga0207676_119109671 | 145 |
| 244 | 3300026116 | Ga0207674_10498715 | Ga0207674_104987152 | 145 |
| 245 | 3300026116 | Ga0207674_10744573 | Ga0207674_107445732 | 145 |
| 246 | 3300026118 | Ga0207675_100165589 | Ga0207675_1001655893 | 145 |
| 247 | 3300026142 | Ga0207698_10260595 | Ga0207698_102605952 | 145 |
| 248 | 3300027360 | Ga0209969_1000819 | Ga0209969_10008192 | 145 |
| 249 | 3300027364 | Ga0209967_1011141 | Ga0209967_10111412 | 145 |
| 250 | 3300027395 | Ga0209996_1011764 | Ga0209996_10117643 | 145 |
| 251 | 3300027471 | Ga0209995_1000526 | Ga0209995_10005264 | 145 |
| 252 | 3300027526 | Ga0209968_1001120 | Ga0209968_10011204 | 145 |
| 253 | 3300027543 | Ga0209999_1002816 | Ga0209999_10028162 | 145 |
| 254 | 3300027614 | Ga0209970_1014279 | Ga0209970_10142793 | 145 |
| 255 | 3300027665 | Ga0209983_1003507 | Ga0209983_10035074 | 145 |
| 256 | 3300027682 | Ga0209971_1000031 | Ga0209971_100003138 | 145 |
| 257 | 3300027695 | Ga0209966_1000020 | Ga0209966_10000207 | 145 |
| 258 | 3300027717 | Ga0209998_10000024 | Ga0209998_1000002411 | 145 |
| 259 | 3300027876 | Ga0209974_10009769 | Ga0209974_100097694 | 145 |
| 260 | 3300027907 | Ga0207428_10028705 | Ga0207428_100287054 | 145 |
| 261 | 3300027907 | Ga0207428_10097852 | Ga0207428_100978522 | 145 |
| 262 | 3300028379 | Ga0268266_10596101 | Ga0268266_105961012 | 145 |
| 263 | 3300031995 | Ga0307409_101043717 | Ga0307409_1010437171 | 145 |
| 264 | 3300032002 | Ga0307416_101195075 | Ga0307416_1011950752 | 145 |
| 265 | 3300032126 | Ga0307415_100688471 | Ga0307415_1006884711 | 145 |
| 266 | 3300035090 | Ga0373949_0030222 | Ga0373949_0030222_334_771 | 145 |
| 267 | 3300036401 | Ga0373937_1251851 | Ga0373937_1251851_172_609 | 145 |
| 268 | 3300037418 | Ga0395900_0006116 | Ga0395900_0006116_11396_11833 | 145 |
| 269 | 3300037466 | Ga0395898_0004956 | Ga0395898_0004956_12745_13182 | 145 |
| 270 | 3300037471 | Ga0395905_0374369 | Ga0395905_0374369_374_811 | 145 |
| 271 | 3300037853 | Ga0436364_0910392 | Ga0436364_0910392_59_496 | 145 |
| 272 | 3300038443 | Ga0395901_0000893 | Ga0395901_0000893_5905_6342 | 145 |
| 273 | 3300038699 | Ga0242422_00891 | Ga0242422_00891_395_832 | 145 |
| 274 | 3300039437 | Ga0436365_0524461 | Ga0436365_0524461_43_480 | 145 |
| 275 | 3300041997 | Ga0439431_0258607 | Ga0439431_0258607_53_490 | 145 |
| 276 | 3300042436 | Ga0439435_0021051 | Ga0439435_0021051_650_1087 | 145 |
| 277 | 3300042461 | Ga0439460_0034586 | Ga0439460_0034586_937_1374 | 145 |
| 278 | 3300042876 | Ga0451577_0106161 | Ga0451577_0106161_82_519 | 145 |
| 279 | 3300042876 | Ga0451577_0108922 | Ga0451577_0108922_624_1061 | 145 |
| 280 | 3300042993 | Ga0439440_0009259 | Ga0439440_0009259_772_1209 | 145 |
| 281 | 3300044673 | Ga0453683_0129805 | Ga0453683_0129805_17_454 | 145 |
| 282 | 3300044712 | Ga0453684_1121112 | Ga0453684_1121112_216_653 | 145 |
| 283 | 3300045051 | Ga0451576_0110810 | Ga0451576_0110810_1091_1528 | 145 |
| 284 | 3300045051 | Ga0451576_1921342 | Ga0451576_1921342_99_536 | 145 |
| 285 | 3300048904 | Ga0496101_0475260 | Ga0496101_0475260_429_866 | 145 |
| 286 | 3300048909 | Ga0496106_0191571 | Ga0496106_0191571_716_1153 | 145 |
| 287 | 3300048909 | Ga0496106_0737713 | Ga0496106_0737713_202_639 | 145 |
| 288 | 3300048910 | Ga0496107_0529349 | Ga0496107_0529349_344_781 | 145 |
| 289 | 3300049569 | Ga0501032_0228077 | Ga0501032_0228077_628_1065 | 145 |
| 290 | 3300049570 | Ga0501033_0072748 | Ga0501033_0072748_1610_2047 | 145 |
| 291 | 3300049572 | Ga0501036_0272373 | Ga0501036_0272373_439_876 | 145 |
| 292 | 3300049574 | Ga0501038_0038405 | Ga0501038_0038405_660_1097 | 145 |
| 293 | 3300049575 | Ga0501039_0006276 | Ga0501039_0006276_3240_3677 | 145 |
| 294 | 3300049576 | Ga0501040_0002281 | Ga0501040_0002281_3126_3563 | 145 |
| 295 | 3300049577 | Ga0501041_0034373 | Ga0501041_0034373_1708_2145 | 145 |
| 296 | 3300049578 | Ga0501042_0022078 | Ga0501042_0022078_2879_3316 | 145 |
| 297 | 3300049579 | Ga0501043_0093359 | Ga0501043_0093359_1105_1542 | 145 |
| 298 | 3300049580 | Ga0501046_0000607 | Ga0501046_0000607_8443_8880 | 145 |
| 299 | 3300049581 | Ga0501047_0053799 | Ga0501047_0053799_485_922 | 145 |
| 300 | 3300049584 | Ga0501068_0068188 | Ga0501068_0068188_1178_1615 | 145 |
| 301 | 3300049585 | Ga0501069_0058008 | Ga0501069_0058008_641_1078 | 145 |
| 302 | 3300049588 | Ga0501072_0049358 | Ga0501072_0049358_1624_2061 | 145 |
| 303 | 3300049590 | Ga0501074_0007780 | Ga0501074_0007780_2421_2858 | 145 |
| 304 | 3300049590 | Ga0501074_1140211 | Ga0501074_1140211_29_466 | 145 |
| 305 | 3300049591 | Ga0501075_0005460 | Ga0501075_0005460_6424_6861 | 145 |
| 306 | 3300049592 | Ga0501076_0053357 | Ga0501076_0053357_1818_2255 | 145 |
| 307 | 3300049593 | Ga0501077_0134496 | Ga0501077_0134496_795_1232 | 145 |
| 308 | 3300049661 | Ga0501217_026373 | Ga0501217_026373_401_838 | 145 |
| 309 | 3300049741 | Ga0501079_0000976 | Ga0501079_0000976_2728_3165 | 145 |
| 310 | 3300049742 | Ga0501080_0046004 | Ga0501080_0046004_2503_2940 | 145 |
| 311 | 3300049743 | Ga0501081_0017810 | Ga0501081_0017810_2780_3217 | 145 |
| 312 | 3300049744 | Ga0501083_0058995 | Ga0501083_0058995_142_579 | 145 |
| 313 | 3300049824 | Ga0501045_0003234 | Ga0501045_0003234_3515_3952 | 145 |
| 314 | 3300049824 | Ga0501045_0201339 | Ga0501045_0201339_845_1282 | 145 |
| 315 | 3300050507 | nmdc:mga05p37_1090256_c1 | nmdc:mga05p37_1090256_c1_90_539 | 145 |
| 316 | 3300050507 | nmdc:mga05p37_1195207_c1 | nmdc:mga05p37_1195207_c1_159_596 | 145 |
| 317 | 3300050507 | nmdc:mga05p37_479355_c1 | nmdc:mga05p37_479355_c1_596_1045 | 145 |
| 318 | 3300050507 | nmdc:mga05p37_594168_c1 | nmdc:mga05p37_594168_c1_554_991 | 145 |
| 319 | 3300050508 | nmdc:mga09592_1558590_c1 | nmdc:mga09592_1558590_c1_50_487 | 145 |
| 320 | 3300050508 | nmdc:mga09592_965702_c1 | nmdc:mga09592_965702_c1_61_498 | 145 |
| 321 | 3300050509 | nmdc:mga0qj67_172933_c1 | nmdc:mga0qj67_172933_c1_637_1074 | 145 |
| 322 | 3300050510 | nmdc:mga06r32_159581_c1 | nmdc:mga06r32_159581_c1_1271_1708 | 145 |
| 323 | 3300050510 | nmdc:mga06r32_162149_c1 | nmdc:mga06r32_162149_c1_542_991 | 145 |
| 324 | 3300050510 | nmdc:mga06r32_268647_c1 | nmdc:mga06r32_268647_c1_517_954 | 145 |
| 325 | 3300050510 | nmdc:mga06r32_345464_c1 | nmdc:mga06r32_345464_c1_987_1424 | 145 |
| 326 | 3300050510 | nmdc:mga06r32_54016_c1 | nmdc:mga06r32_54016_c1_143_580 | 145 |
| 327 | 3300050510 | nmdc:mga06r32_722177_c1 | nmdc:mga06r32_722177_c1_64_522 | 145 |
| 328 | 3300050510 | nmdc:mga06r32_85049_c1 | nmdc:mga06r32_85049_c1_1126_1563 | 145 |
| 329 | 3300050511 | nmdc:mga08y16_64803_c1 | nmdc:mga08y16_64803_c1_830_1267 | 145 |
| 330 | 3300050511 | nmdc:mga08y16_945711_c1 | nmdc:mga08y16_945711_c1_349_786 | 145 |
| 331 | 3300050512 | nmdc:mga0n895_137297_c1 | nmdc:mga0n895_137297_c1_1072_1509 | 145 |
| 332 | 3300050512 | nmdc:mga0n895_50053_c1 | nmdc:mga0n895_50053_c1_1894_2331 | 145 |
| 333 | 3300050512 | nmdc:mga0n895_80538_c1 | nmdc:mga0n895_80538_c1_1554_1991 | 145 |
| 334 | 3300050513 | nmdc:mga0rr50_168177_c1 | nmdc:mga0rr50_168177_c1_839_1276 | 145 |
| 335 | 3300050513 | nmdc:mga0rr50_221644_c1 | nmdc:mga0rr50_221644_c1_558_995 | 145 |
| 336 | 3300050513 | nmdc:mga0rr50_43462_c1 | nmdc:mga0rr50_43462_c1_1195_1632 | 145 |
| 337 | 3300050514 | nmdc:mga08x19_137781_c1 | nmdc:mga08x19_137781_c1_1060_1497 | 145 |
| 338 | 3300050514 | nmdc:mga08x19_228025_c1 | nmdc:mga08x19_228025_c1_89_526 | 145 |
| 339 | 3300054114 | Ga0501084_0010953 | Ga0501084_0010953_6328_6765 | 145 |
| 340 | 3300060353 | Ga0501082_0001321 | Ga0501082_0001321_8166_8603 | 145 |
| 341 | 3300061734 | Ga0530510_0062847 | Ga0530510_0062847_1577_2014 | 145 |
| 342 | 3300049584 | Ga0501068_0177681 | Ga0501068_0177681_838_1284 | 146 |
| 343 | 3300049586 | Ga0501070_0025641 | Ga0501070_0025641_3698_4144 | 146 |
| 344 | 3300049590 | Ga0501074_0088465 | Ga0501074_0088465_773_1219 | 146 |
| 345 | 3300049742 | Ga0501080_0131268 | Ga0501080_0131268_427_873 | 146 |
| 346 | 3300049743 | Ga0501081_0911785 | Ga0501081_0911785_173_619 | 146 |
| 347 | 3300049744 | Ga0501083_0071395 | Ga0501083_0071395_1242_1688 | 146 |
| 348 | 3300060353 | Ga0501082_0012651 | Ga0501082_0012651_1247_1693 | 146 |
| 349 | 3300037466 | Ga0395898_1252723 | Ga0395898_1252723_13_456 | 147 |
| 350 | 3300015261 | Ga0182006_1171976 | Ga0182006_11719762 | 149 |
| 351 | 3300028379 | Ga0268266_10213480 | Ga0268266_102134803 | 150 |
| 352 | 3300005331 | Ga0070670_100221723 | Ga0070670_1002217232 | 151 |
| 353 | 3300005339 | Ga0070660_100087160 | Ga0070660_1000871602 | 151 |
| 354 | 3300005344 | Ga0070661_100168682 | Ga0070661_1001686821 | 151 |
| 355 | 3300005455 | Ga0070663_101211066 | Ga0070663_1012110661 | 151 |
| 356 | 3300005457 | Ga0070662_100019519 | Ga0070662_1000195195 | 151 |
| 357 | 3300005535 | Ga0070684_100366017 | Ga0070684_1003660173 | 151 |
| 358 | 3300005563 | Ga0068855_100514410 | Ga0068855_1005144103 | 151 |
| 359 | 3300005564 | Ga0070664_100199625 | Ga0070664_1001996252 | 151 |
| 360 | 3300005578 | Ga0068854_100433188 | Ga0068854_1004331882 | 151 |
| 361 | 3300005614 | Ga0068856_100067395 | Ga0068856_1000673955 | 151 |
| 362 | 3300005843 | Ga0068860_101037714 | Ga0068860_1010377142 | 151 |
| 363 | 3300006173 | Ga0070716_100437704 | Ga0070716_1004377041 | 151 |
| 364 | 3300009174 | Ga0105241_10089093 | Ga0105241_100890931 | 151 |
| 365 | 3300009177 | Ga0105248_11276275 | Ga0105248_112762751 | 151 |
| 366 | 3300010375 | Ga0105239_10231297 | Ga0105239_102312971 | 151 |
| 367 | 3300013100 | Ga0157373_10077482 | Ga0157373_100774821 | 151 |
| 368 | 3300013105 | Ga0157369_10018225 | Ga0157369_100182258 | 151 |
| 369 | 3300013296 | Ga0157374_10069083 | Ga0157374_100690832 | 151 |
| 370 | 3300013307 | Ga0157372_10782370 | Ga0157372_107823703 | 151 |
| 371 | 3300014325 | Ga0163163_10278786 | Ga0163163_102787863 | 151 |
| 372 | 3300014497 | Ga0182008_10050339 | Ga0182008_100503392 | 151 |
| 373 | 3300014969 | Ga0157376_10014359 | Ga0157376_100143596 | 151 |
| 374 | 3300025321 | Ga0207656_10090925 | Ga0207656_100909251 | 151 |
| 375 | 3300025909 | Ga0207705_10149124 | Ga0207705_101491241 | 151 |
| 376 | 3300025917 | Ga0207660_10897641 | Ga0207660_108976411 | 151 |
| 377 | 3300025919 | Ga0207657_10005688 | Ga0207657_1000568813 | 151 |
| 378 | 3300025920 | Ga0207649_10158055 | Ga0207649_101580552 | 151 |
| 379 | 3300025924 | Ga0207694_10146809 | Ga0207694_101468091 | 151 |
| 380 | 3300025933 | Ga0207706_10050747 | Ga0207706_100507473 | 151 |
| 381 | 3300025945 | Ga0207679_10723538 | Ga0207679_107235381 | 151 |
| 382 | 3300025949 | Ga0207667_11292411 | Ga0207667_112924112 | 151 |
| 383 | 3300025986 | Ga0207658_10295432 | Ga0207658_102954321 | 151 |
| 384 | 3300026067 | Ga0207678_10926136 | Ga0207678_109261362 | 151 |
| 385 | 3300026078 | Ga0207702_10187998 | Ga0207702_101879983 | 151 |
| 386 | 3300026118 | Ga0207675_100283608 | Ga0207675_1002836082 | 151 |
| 387 | 3300026121 | Ga0207683_10856109 | Ga0207683_108561092 | 151 |
| 388 | 3300026142 | Ga0207698_11255616 | Ga0207698_112556161 | 151 |
| 389 | 3300028381 | Ga0268264_10997612 | Ga0268264_109976122 | 151 |
| 390 | 3300048905 | Ga0496102_0231649 | Ga0496102_0231649_714_1172 | 151 |
| 391 | 3300001978 | JGI24747J21853_1012948 | JGI24747J21853_10129482 | 152 |
| 392 | 3300001991 | JGI24743J22301_10006256 | JGI24743J22301_100062561 | 152 |
| 393 | 3300005289 | Ga0065704_10423223 | Ga0065704_104232231 | 152 |
| 394 | 3300005327 | Ga0070658_10092204 | Ga0070658_100922041 | 152 |
| 395 | 3300005328 | Ga0070676_10028309 | Ga0070676_100283093 | 152 |
| 396 | 3300005334 | Ga0068869_100049617 | Ga0068869_1000496172 | 152 |
| 397 | 3300005335 | Ga0070666_10113694 | Ga0070666_101136942 | 152 |
| 398 | 3300005336 | Ga0070680_100153174 | Ga0070680_1001531743 | 152 |
| 399 | 3300005337 | Ga0070682_100008051 | Ga0070682_1000080518 | 152 |
| 400 | 3300005338 | Ga0068868_100020426 | Ga0068868_1000204264 | 152 |
| 401 | 3300005340 | Ga0070689_100067085 | Ga0070689_1000670854 | 152 |
| 402 | 3300005343 | Ga0070687_100001840 | Ga0070687_1000018405 | 152 |
| 403 | 3300005353 | Ga0070669_100005119 | Ga0070669_1000051194 | 152 |
| 404 | 3300005354 | Ga0070675_100009409 | Ga0070675_1000094099 | 152 |
| 405 | 3300005355 | Ga0070671_100365827 | Ga0070671_1003658272 | 152 |
| 406 | 3300005356 | Ga0070674_100211449 | Ga0070674_1002114492 | 152 |
| 407 | 3300005366 | Ga0070659_100002666 | Ga0070659_10000266611 | 152 |
| 408 | 3300005455 | Ga0070663_100018203 | Ga0070663_1000182032 | 152 |
| 409 | 3300005457 | Ga0070662_100002683 | Ga0070662_1000026834 | 152 |
| 410 | 3300005459 | Ga0068867_100003854 | Ga0068867_1000038549 | 152 |
| 411 | 3300005466 | Ga0070685_10020596 | Ga0070685_100205963 | 152 |
| 412 | 3300005518 | Ga0070699_101002876 | Ga0070699_1010028761 | 152 |
| 413 | 3300005535 | Ga0070684_100009298 | Ga0070684_1000092983 | 152 |
| 414 | 3300005536 | Ga0070697_100032136 | Ga0070697_1000321362 | 152 |
| 415 | 3300005539 | Ga0068853_100006343 | Ga0068853_1000063439 | 152 |
| 416 | 3300005543 | Ga0070672_100131384 | Ga0070672_1001313842 | 152 |
| 417 | 3300005544 | Ga0070686_100001440 | Ga0070686_10000144013 | 152 |
| 418 | 3300005563 | Ga0068855_100304257 | Ga0068855_1003042572 | 152 |
| 419 | 3300005577 | Ga0068857_100193153 | Ga0068857_1001931532 | 152 |
| 420 | 3300005578 | Ga0068854_100579220 | Ga0068854_1005792201 | 152 |
| 421 | 3300005614 | Ga0068856_100012826 | Ga0068856_1000128269 | 152 |
| 422 | 3300005615 | Ga0070702_100010550 | Ga0070702_1000105506 | 152 |
| 423 | 3300005616 | Ga0068852_100054256 | Ga0068852_1000542563 | 152 |
| 424 | 3300005618 | Ga0068864_100195582 | Ga0068864_1001955822 | 152 |
| 425 | 3300005718 | Ga0068866_10012445 | Ga0068866_100124453 | 152 |
| 426 | 3300005719 | Ga0068861_100063942 | Ga0068861_1000639422 | 152 |
| 427 | 3300005834 | Ga0068851_10045214 | Ga0068851_100452142 | 152 |
| 428 | 3300005840 | Ga0068870_10047272 | Ga0068870_100472722 | 152 |
| 429 | 3300006173 | Ga0070716_100845173 | Ga0070716_1008451732 | 152 |
| 430 | 3300006237 | Ga0097621_100141888 | Ga0097621_1001418882 | 152 |
| 431 | 3300006358 | Ga0068871_101323297 | Ga0068871_1013232971 | 152 |
| 432 | 3300006852 | Ga0075433_10023500 | Ga0075433_100235002 | 152 |
| 433 | 3300006871 | Ga0075434_100055542 | Ga0075434_1000555422 | 152 |
| 434 | 3300006881 | Ga0068865_100008484 | Ga0068865_1000084844 | 152 |
| 435 | 3300009094 | Ga0111539_10840582 | Ga0111539_108405822 | 152 |
| 436 | 3300009098 | Ga0105245_10090667 | Ga0105245_100906671 | 152 |
| 437 | 3300009098 | Ga0105245_10091336 | Ga0105245_100913362 | 152 |
| 438 | 3300009101 | Ga0105247_10009761 | Ga0105247_100097616 | 152 |
| 439 | 3300009174 | Ga0105241_10087737 | Ga0105241_100877372 | 152 |
| 440 | 3300009176 | Ga0105242_10003389 | Ga0105242_1000338913 | 152 |
| 441 | 3300009553 | Ga0105249_10039963 | Ga0105249_100399633 | 152 |
| 442 | 3300010375 | Ga0105239_11225565 | Ga0105239_112255652 | 152 |
| 443 | 3300011119 | Ga0105246_10015894 | Ga0105246_100158944 | 152 |
| 444 | 3300012508 | Ga0157315_1008082 | Ga0157315_10080822 | 152 |
| 445 | 3300013100 | Ga0157373_10002380 | Ga0157373_100023805 | 152 |
| 446 | 3300013102 | Ga0157371_10002907 | Ga0157371_100029073 | 152 |
| 447 | 3300013105 | Ga0157369_10021280 | Ga0157369_100212806 | 152 |
| 448 | 3300013296 | Ga0157374_10005580 | Ga0157374_100055806 | 152 |
| 449 | 3300013296 | Ga0157374_10140347 | Ga0157374_101403471 | 152 |
| 450 | 3300013308 | Ga0157375_10055998 | Ga0157375_100559983 | 152 |
| 451 | 3300014326 | Ga0157380_10027507 | Ga0157380_100275072 | 152 |
| 452 | 3300014745 | Ga0157377_10001555 | Ga0157377_100015556 | 152 |
| 453 | 3300017792 | Ga0163161_10007569 | Ga0163161_100075695 | 152 |
| 454 | 3300025315 | Ga0207697_10002780 | Ga0207697_100027802 | 152 |
| 455 | 3300025893 | Ga0207682_10004106 | Ga0207682_100041063 | 152 |
| 456 | 3300025901 | Ga0207688_10057032 | Ga0207688_100570322 | 152 |
| 457 | 3300025904 | Ga0207647_10002672 | Ga0207647_100026724 | 152 |
| 458 | 3300025907 | Ga0207645_10001560 | Ga0207645_1000156017 | 152 |
| 459 | 3300025908 | Ga0207643_10000639 | Ga0207643_1000063914 | 152 |
| 460 | 3300025918 | Ga0207662_10003901 | Ga0207662_100039016 | 152 |
| 461 | 3300025919 | Ga0207657_10001261 | Ga0207657_1000126116 | 152 |
| 462 | 3300025923 | Ga0207681_10640794 | Ga0207681_106407941 | 152 |
| 463 | 3300025925 | Ga0207650_10000177 | Ga0207650_100001774 | 152 |
| 464 | 3300025925 | Ga0207650_10040788 | Ga0207650_100407883 | 152 |
| 465 | 3300025926 | Ga0207659_10071638 | Ga0207659_100716383 | 152 |
| 466 | 3300025927 | Ga0207687_10049613 | Ga0207687_100496134 | 152 |
| 467 | 3300025931 | Ga0207644_10192432 | Ga0207644_101924322 | 152 |
| 468 | 3300025932 | Ga0207690_10745309 | Ga0207690_107453092 | 152 |
| 469 | 3300025933 | Ga0207706_10002495 | Ga0207706_100024954 | 152 |
| 470 | 3300025936 | Ga0207670_10011311 | Ga0207670_100113115 | 152 |
| 471 | 3300025937 | Ga0207669_10251467 | Ga0207669_102514672 | 152 |
| 472 | 3300025939 | Ga0207665_10218441 | Ga0207665_102184412 | 152 |
| 473 | 3300025940 | Ga0207691_10001447 | Ga0207691_1000144710 | 152 |
| 474 | 3300025941 | Ga0207711_10180516 | Ga0207711_101805162 | 152 |
| 475 | 3300025942 | Ga0207689_10002307 | Ga0207689_100023073 | 152 |
| 476 | 3300025942 | Ga0207689_10157922 | Ga0207689_101579223 | 152 |
| 477 | 3300025944 | Ga0207661_10016213 | Ga0207661_100162134 | 152 |
| 478 | 3300025945 | Ga0207679_10000143 | Ga0207679_1000014345 | 152 |
| 479 | 3300025949 | Ga0207667_10031734 | Ga0207667_100317342 | 152 |
| 480 | 3300025960 | Ga0207651_10043637 | Ga0207651_100436374 | 152 |
| 481 | 3300025972 | Ga0207668_10059933 | Ga0207668_100599332 | 152 |
| 482 | 3300025981 | Ga0207640_10232365 | Ga0207640_102323652 | 152 |
| 483 | 3300025986 | Ga0207658_10005160 | Ga0207658_1000516012 | 152 |
| 484 | 3300026023 | Ga0207677_10020934 | Ga0207677_100209344 | 152 |
| 485 | 3300026041 | Ga0207639_10017818 | Ga0207639_100178185 | 152 |
| 486 | 3300026067 | Ga0207678_10001668 | Ga0207678_1000166817 | 152 |
| 487 | 3300026075 | Ga0207708_10337425 | Ga0207708_103374252 | 152 |
| 488 | 3300026078 | Ga0207702_10071365 | Ga0207702_100713654 | 152 |
| 489 | 3300026088 | Ga0207641_10003028 | Ga0207641_100030285 | 152 |
| 490 | 3300026088 | Ga0207641_11375059 | Ga0207641_113750592 | 152 |
| 491 | 3300026089 | Ga0207648_10003457 | Ga0207648_1000345718 | 152 |
| 492 | 3300026095 | Ga0207676_10001159 | Ga0207676_1000115914 | 152 |
| 493 | 3300026116 | Ga0207674_10000195 | Ga0207674_100001954 | 152 |
| 494 | 3300026121 | Ga0207683_10003688 | Ga0207683_100036886 | 152 |
| 495 | 3300028379 | Ga0268266_10003235 | Ga0268266_1000323516 | 152 |
| 496 | 3300028380 | Ga0268265_10010967 | Ga0268265_100109672 | 152 |
| 497 | 3300028381 | Ga0268264_10112259 | Ga0268264_101122592 | 152 |
| 498 | 3300039438 | Ga0436360_0729932 | Ga0436360_0729932_207_665 | 152 |
| 499 | 3300039447 | Ga0436361_0068265 | Ga0436361_0068265_11_469 | 152 |
| 500 | 3300039450 | Ga0436363_0606919 | Ga0436363_0606919_68_526 | 152 |
| 501 | 3300046684 | Ga0495669_0597777 | Ga0495669_0597777_58_516 | 152 |
| 502 | 3300048903 | Ga0496100_0088097 | Ga0496100_0088097_146_604 | 152 |
| 503 | 3300048905 | Ga0496102_0212725 | Ga0496102_0212725_1111_1569 | 152 |
| 504 | 3300048906 | Ga0496103_0046092 | Ga0496103_0046092_577_1035 | 152 |
| 505 | 3300048909 | Ga0496106_0058178 | Ga0496106_0058178_639_1097 | 152 |
| 506 | 3300048910 | Ga0496107_0046578 | Ga0496107_0046578_2028_2486 | 152 |
| 507 | 3300048911 | Ga0496108_0000689 | Ga0496108_0000689_2260_2718 | 152 |
| 508 | 3300048912 | Ga0496109_0001300 | Ga0496109_0001300_2449_2907 | 152 |
| 509 | 3300048913 | Ga0496110_0043918 | Ga0496110_0043918_79_537 | 152 |
| 510 | 3300048918 | Ga0496115_0428869 | Ga0496115_0428869_539_997 | 152 |
| 511 | 3300049583 | Ga0501067_0327527 | Ga0501067_0327527_86_604 | 152 |
| 512 | 3300050511 | nmdc:mga08y16_814776_c1 | nmdc:mga08y16_814776_c1_245_703 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ep5-assembly1.cif.gz_B | the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. | 0.963 | 28 | 144 |
| 2dsl-assembly1.cif.gz_A | mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 | 0.9607 | 26 | 142 |
| 5hmb-assembly1.cif.gz_A | crystal structure of s. sahachiroi azig | 0.9568 | 24 | 146 |
| 4ybv-assembly1.cif.gz_D | crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 | 0.9568 | 26 | 143 |
| 1zki-assembly1.cif.gz_B | structure of conserved protein pa5202 from pseudomonas aeruginosa | 0.9562 | 25 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4m20A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9618 | 26 | 143 | 3.10.129.10 |
| af_Q9M2E4_49_183_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9577 | 34 | 144 | 3.10.129.10 |
| 1wluA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9517 | 24 | 142 | 3.10.129.10 |
| 1zkiB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9404 | 25 | 144 | 3.10.129.10 |
| 4m20A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9312 | 26 | 143 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D7HDP7-F1-model_v4 | Thioesterase | 0.9926 | 33 | 146 |
GO:0047617
|
| AF-A0A1F7P700-F1-model_v4 | Thioesterase domain-containing protein | 0.9924 | 29 | 152 |
GO:0005829
GO:0061522 |
| AF-A0A831Y662-F1-model_v4 | PaaI family thioesterase | 0.9871 | 23 | 152 |
GO:0005829
GO:0061522 |
| AF-A0A7W0G0I7-F1-model_v4 | PaaI family thioesterase | 0.9868 | 35 | 144 |
GO:0047617
|
| AF-A0A2V8WJJ9-F1-model_v4 | PaaI family thioesterase | 0.9845 | 25 | 152 |
GO:0005829
GO:0061522 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar