F457381

General Info

Members Datasets Scaffolds Average Seq Length
512 277 512 149

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10092204|Ga0070658_100922041
Length 172
Sequence VVLCRRNLYGVKRKQTTRRPMKKAXXXPATKLDQIRARLRSSTPILPIGVHLGFRVTAVRKGRVTIELDVRPHHANAIGTLHGGVLCDIADAAMALSHATNIAAEETFTTLELKINFLKPVWEGKLRAEGRVIKQGRTIGLTECDVFDEKGSLVAHATSTCMTLRGNEAKGR

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
4 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
195 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.73
Rhizosphere 96.29
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1012948 3300001978 Unclassified 856
2 JGI24743J22301_10006256 3300001991 Bacteria 2021
3 JGI26128J50194_1006590 3300003347 Bacteria 758
4 JGI26129J50193_1010430 3300003349 Bacteria 676
5 JGI25405J52794_10025671 3300003911 Bacteria 1208
6 Ga0065704_10423223 3300005289 Unclassified 730
7 Ga0065715_10136418 3300005293 Bacteria 1922
8 Ga0065707_10262742 3300005295 Bacteria 1093
9 Ga0070658_10092204 3300005327 Bacteria 2498
10 Ga0070658_11064725 3300005327 Unclassified 703
11 Ga0070676_10028309 3300005328 Bacteria 3182
12 Ga0070683_100182271 3300005329 Bacteria 1993
13 Ga0070670_100221723 3300005331 Bacteria 1645
14 Ga0068869_100049617 3300005334 Bacteria 3039
15 Ga0070666_10113694 3300005335 Bacteria 1873
16 Ga0070680_100153174 3300005336 Unclassified 1936
17 Ga0070680_100478016 3300005336 Unclassified 1065
18 Ga0070682_100008051 3300005337 Bacteria 5936
19 Ga0068868_100020426 3300005338 Bacteria 4976
20 Ga0070660_100087160 3300005339 Unclassified 2457
21 Ga0070689_100066217 3300005340 Bacteria 2815
22 Ga0070689_100067085 3300005340 Bacteria 2796
23 Ga0070691_10123081 3300005341 Bacteria 1308
24 Ga0070687_100001840 3300005343 Bacteria 7678
25 Ga0070687_100035503 3300005343 Bacteria 2476
26 Ga0070661_100168682 3300005344 Bacteria 1661
27 Ga0070669_100005119 3300005353 Bacteria 9479
28 Ga0070675_100009409 3300005354 Bacteria 7603
29 Ga0070671_100365827 3300005355 Unclassified 1231
30 Ga0070674_100211449 3300005356 Unclassified 1503
31 Ga0070673_100387537 3300005364 Unclassified 1247
32 Ga0070659_100002666 3300005366 Bacteria 12691
33 Ga0070659_100078244 3300005366 Bacteria 2638
34 Ga0070709_10813392 3300005434 Unclassified 734
35 Ga0070709_11158549 3300005434 Bacteria 620
36 Ga0070710_10547688 3300005437 Bacteria 798
37 Ga0070711_100000674 3300005439 Bacteria 17876
38 Ga0070705_101455288 3300005440 Unclassified 573
39 Ga0070694_100056884 3300005444 Bacteria 2658
40 Ga0070694_100593872 3300005444 Unclassified 891
41 Ga0070708_100126723 3300005445 Bacteria 2361
42 Ga0070708_100269096 3300005445 Unclassified 1602
43 Ga0070708_100353701 3300005445 Bacteria 1384
44 Ga0070708_100478475 3300005445 Bacteria 1175
45 Ga0070708_100815561 3300005445 Unclassified 877
46 Ga0070708_100856207 3300005445 Bacteria 854
47 Ga0070708_101005836 3300005445 Bacteria 782
48 Ga0070663_100018203 3300005455 Unclassified 4599
49 Ga0070663_101211066 3300005455 Unclassified 664
50 Ga0070662_100002683 3300005457 Bacteria 10979
51 Ga0070662_100015410 3300005457 Bacteria 5120
52 Ga0070662_100019519 3300005457 Unclassified 4602
53 Ga0070681_10239774 3300005458 Bacteria 1727
54 Ga0068867_100003854 3300005459 Bacteria 10546
55 Ga0070685_10020596 3300005466 Bacteria 3569
56 Ga0070706_100012720 3300005467 Bacteria 7786
57 Ga0070706_100094363 3300005467 Bacteria 2776
58 Ga0070706_100151857 3300005467 Bacteria 2162
59 Ga0070706_100167209 3300005467 Bacteria 2053
60 Ga0070706_100169661 3300005467 Bacteria 2037
61 Ga0070706_100182362 3300005467 Bacteria 1960
62 Ga0070707_100000050 3300005468 Bacteria 102427
63 Ga0070707_100013117 3300005468 Bacteria 7746
64 Ga0070707_100169401 3300005468 Bacteria 2128
65 Ga0070698_100003437 3300005471 Bacteria 17412
66 Ga0070698_100029289 3300005471 Bacteria 5714
67 Ga0070698_100136460 3300005471 Bacteria 2407
68 Ga0070698_100252672 3300005471 Bacteria 1695
69 Ga0070698_101420719 3300005471 Bacteria 645
70 Ga0070699_100002495 3300005518 Bacteria 16526
71 Ga0070699_100010410 3300005518 Bacteria 8048
72 Ga0070699_100104125 3300005518 Bacteria 2489
73 Ga0070699_100259159 3300005518 Unclassified 1555
74 Ga0070699_100273406 3300005518 Bacteria 1513
75 Ga0070699_100305570 3300005518 Unclassified 1427
76 Ga0070699_100617065 3300005518 Bacteria 989
77 Ga0070699_100661012 3300005518 Bacteria 954
78 Ga0070699_100909890 3300005518 Bacteria 806
79 Ga0070699_101002876 3300005518 Bacteria 766
80 Ga0070699_101203794 3300005518 Archaea 695
81 Ga0070699_101585877 3300005518 Unclassified 600
82 Ga0070679_100182908 3300005530 Bacteria 2068
83 Ga0070684_100009298 3300005535 Bacteria 7736
84 Ga0070684_100304928 3300005535 Bacteria 1462
85 Ga0070684_100366017 3300005535 Bacteria 1327
86 Ga0070684_101001475 3300005535 Unclassified 784
87 Ga0070697_100018675 3300005536 Bacteria 5470
88 Ga0070697_100026992 3300005536 Bacteria 4592
89 Ga0070697_100032136 3300005536 Bacteria 4222
90 Ga0070697_100043246 3300005536 Bacteria 3646
91 Ga0070697_100070003 3300005536 Bacteria 2875
92 Ga0070697_100146907 3300005536 Bacteria 1985
93 Ga0070697_100166926 3300005536 Unclassified 1861
94 Ga0070697_100258509 3300005536 Bacteria 1490
95 Ga0070697_100644097 3300005536 Bacteria 933
96 Ga0070697_100646849 3300005536 Unclassified 931
97 Ga0070697_100704675 3300005536 Unclassified 891
98 Ga0068853_100006343 3300005539 Bacteria 9387
99 Ga0068853_100116109 3300005539 Bacteria 2383
100 Ga0070672_100131384 3300005543 Bacteria 2058
101 Ga0070672_101130777 3300005543 Unclassified 696
102 Ga0070686_100001440 3300005544 Bacteria 13445
103 Ga0070686_100004656 3300005544 Bacteria 7566
104 Ga0070695_100011739 3300005545 Bacteria 5244
105 Ga0070695_100208810 3300005545 Unclassified 1400
106 Ga0070696_100319163 3300005546 Unclassified 1195
107 Ga0070696_100446022 3300005546 Unclassified 1020
108 Ga0070665_100087159 3300005548 Bacteria 3127
109 Ga0070704_100392938 3300005549 Bacteria 1181
110 Ga0070704_100606082 3300005549 Bacteria 963
111 Ga0070704_101333379 3300005549 Unclassified 657
112 Ga0068855_100229287 3300005563 Bacteria 2080
113 Ga0068855_100304257 3300005563 Bacteria 1765
114 Ga0068855_100514410 3300005563 Bacteria 1299
115 Ga0070664_100199625 3300005564 Bacteria 1784
116 Ga0068857_100193153 3300005577 Bacteria 1854
117 Ga0068857_100648008 3300005577 Bacteria 1001
118 Ga0068854_100004621 3300005578 Bacteria 8685
119 Ga0068854_100355855 3300005578 Unclassified 1200
120 Ga0068854_100433188 3300005578 Bacteria 1094
121 Ga0068854_100579220 3300005578 Unclassified 955
122 Ga0068856_100012826 3300005614 Bacteria 8110
123 Ga0068856_100067395 3300005614 Bacteria 3537
124 Ga0070702_100010550 3300005615 Bacteria 4557
125 Ga0070702_100147947 3300005615 Unclassified 1504
126 Ga0068852_100054256 3300005616 Bacteria 3454
127 Ga0068852_100379183 3300005616 Unclassified 1387
128 Ga0068864_100019391 3300005618 Bacteria 5688
129 Ga0068864_100182793 3300005618 Bacteria 1918
130 Ga0068864_100195582 3300005618 Bacteria 1855
131 Ga0068864_101214912 3300005618 Unclassified 753
132 Ga0068866_10012445 3300005718 Bacteria 3706
133 Ga0068861_100063942 3300005719 Bacteria 2830
134 Ga0068861_100192292 3300005719 Unclassified 1707
135 Ga0068851_10045214 3300005834 Bacteria 2225
136 Ga0068870_10047272 3300005840 Bacteria 2262
137 Ga0068860_101037714 3300005843 Bacteria 838
138 Ga0068862_100388222 3300005844 Bacteria 1304
139 Ga0081455_10000208 3300005937 Bacteria 74660
140 Ga0070717_10003286 3300006028 Bacteria 11565
141 Ga0070717_10056378 3300006028 Bacteria 3246
142 Ga0070717_10099335 3300006028 Bacteria 2469
143 Ga0070716_100437704 3300006173 Bacteria 950
144 Ga0070716_100845173 3300006173 Unclassified 712
145 Ga0070712_100095581 3300006175 Bacteria 2186
146 Ga0097621_100141888 3300006237 Bacteria 2053
147 Ga0068871_101323297 3300006358 Unclassified 678
148 Ga0075428_100003108 3300006844 Bacteria 18124
149 Ga0075428_100305243 3300006844 Bacteria 1711
150 Ga0075428_100439985 3300006844 Bacteria 1397
151 Ga0075428_101005861 3300006844 Unclassified 882
152 Ga0075430_100106022 3300006846 Bacteria 2345
153 Ga0075431_100019321 3300006847 Bacteria 6946
154 Ga0075431_100129844 3300006847 Bacteria 2600
155 Ga0075431_100150287 3300006847 Bacteria 2399
156 Ga0075431_100204244 3300006847 Bacteria 2021
157 Ga0075431_100357269 3300006847 Bacteria 1468
158 Ga0075431_100358295 3300006847 Unclassified 1466
159 Ga0075433_10023500 3300006852 Bacteria 5190
160 Ga0075433_10224621 3300006852 Unclassified 1668
161 Ga0075433_10390826 3300006852 Bacteria 1228
162 Ga0075433_10776699 3300006852 Bacteria 837
163 Ga0075434_100007466 3300006871 Bacteria 10115
164 Ga0075434_100043592 3300006871 Bacteria 4449
165 Ga0075434_100055542 3300006871 Bacteria 3935
166 Ga0075434_100114010 3300006871 Unclassified 2715
167 Ga0075434_100263422 3300006871 Unclassified 1743
168 Ga0075434_100274986 3300006871 Bacteria 1703
169 Ga0068865_100008484 3300006881 Bacteria 6353
170 Ga0075436_100007102 3300006914 Bacteria 7664
171 Ga0075436_100022925 3300006914 Bacteria 4289
172 Ga0075436_100097474 3300006914 Unclassified 2045
173 Ga0075436_100151523 3300006914 Unclassified 1632
174 Ga0075436_100235533 3300006914 Bacteria 1301
175 Ga0075436_100971445 3300006914 Bacteria 637
176 Ga0097620_102031266 3300006931 Bacteria 635
177 Ga0075435_100000051 3300007076 Bacteria 59038
178 Ga0075435_100006302 3300007076 Bacteria 8379
179 Ga0075435_100013820 3300007076 Bacteria 6018
180 Ga0075435_100046095 3300007076 Bacteria 3495
181 Ga0075435_100086629 3300007076 Bacteria 2580
182 Ga0075435_100229544 3300007076 Unclassified 1577
183 Ga0099794_10000928 3300007265 Bacteria 9896
184 Ga0099794_10171820 3300007265 Bacteria 1105
185 Ga0099795_10531651 3300007788 Unclassified 552
186 Ga0105240_10125190 3300009093 Bacteria 3090
187 Ga0105240_10504303 3300009093 Bacteria 1345
188 Ga0105240_11397131 3300009093 Bacteria 736
189 Ga0111539_10055749 3300009094 Bacteria 4699
190 Ga0111539_10160895 3300009094 Unclassified 2626
191 Ga0111539_10840582 3300009094 Unclassified 1068
192 Ga0105245_10090667 3300009098 Bacteria 2812
193 Ga0105245_10091336 3300009098 Bacteria 2802
194 Ga0105245_10807116 3300009098 Unclassified 977
195 Ga0105247_10009761 3300009101 Bacteria 5821
196 Ga0114129_10014630 3300009147 Bacteria 11179
197 Ga0114129_10143182 3300009147 Bacteria 3276
198 Ga0114129_10153466 3300009147 Bacteria 3151
199 Ga0114129_10233436 3300009147 Bacteria 2477
200 Ga0114129_11009622 3300009147 Archaea 1047
201 Ga0114129_11273046 3300009147 Unclassified 913
202 Ga0114129_11473404 3300009147 Unclassified 837
203 Ga0114129_11740762 3300009147 Unclassified 759
204 Ga0114129_12217173 3300009147 Bacteria 661
205 Ga0105243_10575976 3300009148 Bacteria 1080
206 Ga0105241_10087737 3300009174 Bacteria 2449
207 Ga0105241_10089093 3300009174 Unclassified 2431
208 Ga0105241_10141904 3300009174 Bacteria 1957
209 Ga0105241_10624246 3300009174 Unclassified 976
210 Ga0105242_10003389 3300009176 Bacteria 12406
211 Ga0105248_10169097 3300009177 Bacteria 2464
212 Ga0105248_10755323 3300009177 Unclassified 1097
213 Ga0105248_11276275 3300009177 Unclassified 831
214 Ga0105238_10175705 3300009551 Bacteria 2118
215 Ga0105249_10039963 3300009553 Bacteria 4260
216 Ga0105239_10231297 3300010375 Bacteria 2074
217 Ga0105239_10595645 3300010375 Unclassified 1261
218 Ga0105239_11225565 3300010375 Bacteria 865
219 Ga0105246_10015894 3300011119 Bacteria 4760
220 Ga0105246_10190138 3300011119 Bacteria 1588
221 Ga0157315_1008082 3300012508 Unclassified 870
222 Ga0157373_10002380 3300013100 Bacteria 14283
223 Ga0157373_10077482 3300013100 Bacteria 2345
224 Ga0157373_10120628 3300013100 Unclassified 1843
225 Ga0157371_10002907 3300013102 Bacteria 16015
226 Ga0157370_10006933 3300013104 Bacteria 12382
227 Ga0157369_10001003 3300013105 Bacteria 35669
228 Ga0157369_10018225 3300013105 Bacteria 7874
229 Ga0157369_10021280 3300013105 Bacteria 7253
230 Ga0157374_10005580 3300013296 Bacteria 10593
231 Ga0157374_10069083 3300013296 Bacteria 3326
232 Ga0157374_10140347 3300013296 Bacteria 2345
233 Ga0157372_10139142 3300013307 Unclassified 2796
234 Ga0157372_10257809 3300013307 Bacteria 2025
235 Ga0157372_10782370 3300013307 Bacteria 1109
236 Ga0157375_10055998 3300013308 Bacteria 3890
237 Ga0163163_10278786 3300014325 Bacteria 1723
238 Ga0163163_12097382 3300014325 Bacteria 625
239 Ga0157380_10027507 3300014326 Unclassified 4325
240 Ga0182008_10050339 3300014497 Bacteria 2067
241 Ga0157377_10001555 3300014745 Bacteria 9979
242 Ga0157376_10014359 3300014969 Bacteria 5943
243 Ga0182006_1171976 3300015261 Unclassified 725
244 Ga0163161_10007569 3300017792 Bacteria 7509
245 Ga0197907_10788264 3300020069 Unclassified 748
246 Ga0206354_10499979 3300020081 Bacteria 1901
247 Ga0206354_11045861 3300020081 Unclassified 852
248 Ga0213871_10125279 3300021441 Bacteria 768
249 Ga0207697_10002780 3300025315 Bacteria 8929
250 Ga0207656_10090925 3300025321 Bacteria 1385
251 Ga0207682_10004106 3300025893 Bacteria 6177
252 Ga0207688_10057032 3300025901 Bacteria 2195
253 Ga0207647_10002672 3300025904 Bacteria 13456
254 Ga0207699_10436596 3300025906 Unclassified 937
255 Ga0207645_10001560 3300025907 Bacteria 18746
256 Ga0207643_10000639 3300025908 Bacteria 21958
257 Ga0207705_10149124 3300025909 Bacteria 1751
258 Ga0207684_10006757 3300025910 Bacteria 10411
259 Ga0207684_10026638 3300025910 Bacteria 4929
260 Ga0207684_10094813 3300025910 Bacteria 2546
261 Ga0207684_10100277 3300025910 Bacteria 2474
262 Ga0207684_10122496 3300025910 Bacteria 2230
263 Ga0207684_11105031 3300025910 Bacteria 660
264 Ga0207695_10320351 3300025913 Bacteria 1440
265 Ga0207695_10660441 3300025913 Bacteria 926
266 Ga0207660_10897641 3300025917 Bacteria 723
267 Ga0207662_10003901 3300025918 Bacteria 7770
268 Ga0207662_10027438 3300025918 Bacteria 3286
269 Ga0207657_10001261 3300025919 Bacteria 27065
270 Ga0207657_10005688 3300025919 Bacteria 13006
271 Ga0207649_10158055 3300025920 Bacteria 1568
272 Ga0207652_10745414 3300025921 Bacteria 872
273 Ga0207646_10000037 3300025922 Bacteria 196362
274 Ga0207646_10037698 3300025922 Bacteria 4357
275 Ga0207646_10045159 3300025922 Bacteria 3955
276 Ga0207646_10544614 3300025922 Bacteria 1044
277 Ga0207646_10771810 3300025922 Bacteria 857
278 Ga0207681_10640794 3300025923 Unclassified 880
279 Ga0207694_10146809 3300025924 Unclassified 1899
280 Ga0207694_10240161 3300025924 Bacteria 1480
281 Ga0207650_10000177 3300025925 Bacteria 75244
282 Ga0207650_10040788 3300025925 Bacteria 3399
283 Ga0207659_10071638 3300025926 Bacteria 2531
284 Ga0207687_10049613 3300025927 Bacteria 2919
285 Ga0207700_10002698 3300025928 Bacteria 10229
286 Ga0207644_10192432 3300025931 Unclassified 1604
287 Ga0207644_10903988 3300025931 Unclassified 740
288 Ga0207690_10402101 3300025932 Unclassified 1092
289 Ga0207690_10745309 3300025932 Unclassified 807
290 Ga0207706_10002495 3300025933 Bacteria 17927
291 Ga0207706_10050747 3300025933 Unclassified 3666
292 Ga0207706_10363744 3300025933 Bacteria 1257
293 Ga0207706_10703718 3300025933 Unclassified 863
294 Ga0207670_10011311 3300025936 Bacteria 5174
295 Ga0207670_10066416 3300025936 Bacteria 2478
296 Ga0207669_10251467 3300025937 Unclassified 1316
297 Ga0207665_10218441 3300025939 Unclassified 1396
298 Ga0207665_10862196 3300025939 Archaea 717
299 Ga0207691_10001447 3300025940 Bacteria 23651
300 Ga0207711_10157713 3300025941 Unclassified 2052
301 Ga0207711_10180516 3300025941 Bacteria 1919
302 Ga0207711_10238366 3300025941 Unclassified 1668
303 Ga0207689_10002307 3300025942 Bacteria 17863
304 Ga0207689_10157922 3300025942 Bacteria 1869
305 Ga0207661_10016213 3300025944 Bacteria 5494
306 Ga0207661_10031498 3300025944 Bacteria 4098
307 Ga0207679_10000143 3300025945 Bacteria 59141
308 Ga0207679_10723538 3300025945 Unclassified 904
309 Ga0207667_10031734 3300025949 Bacteria 5701
310 Ga0207667_11292411 3300025949 Bacteria 706
311 Ga0207651_10043637 3300025960 Bacteria 2994
312 Ga0207668_10059933 3300025972 Bacteria 2669
313 Ga0207640_10004709 3300025981 Bacteria 7409
314 Ga0207640_10232365 3300025981 Unclassified 1419
315 Ga0207640_10791981 3300025981 Unclassified 820
316 Ga0207658_10005160 3300025986 Bacteria 8995
317 Ga0207658_10295432 3300025986 Bacteria 1394
318 Ga0207677_10020934 3300026023 Bacteria 3985
319 Ga0207703_11424508 3300026035 Unclassified 667
320 Ga0207639_10017818 3300026041 Bacteria 5037
321 Ga0207678_10001668 3300026067 Bacteria 20376
322 Ga0207678_10926136 3300026067 Unclassified 771
323 Ga0207708_10337425 3300026075 Unclassified 1233
324 Ga0207702_10071365 3300026078 Bacteria 2990
325 Ga0207702_10187998 3300026078 Bacteria 1906
326 Ga0207641_10003028 3300026088 Bacteria 15142
327 Ga0207641_11375059 3300026088 Unclassified 707
328 Ga0207648_10003457 3300026089 Bacteria 16564
329 Ga0207676_10001159 3300026095 Bacteria 19817
330 Ga0207676_10011008 3300026095 Bacteria 6457
331 Ga0207676_10936926 3300026095 Unclassified 851
332 Ga0207676_11910967 3300026095 Unclassified 592
333 Ga0207674_10000195 3300026116 Bacteria 75067
334 Ga0207674_10498715 3300026116 Bacteria 1176
335 Ga0207674_10744573 3300026116 Unclassified 946
336 Ga0207674_11128874 3300026116 Unclassified 753
337 Ga0207675_100165589 3300026118 Unclassified 2111
338 Ga0207675_100283608 3300026118 Bacteria 1610
339 Ga0207683_10003688 3300026121 Bacteria 13306
340 Ga0207683_10856109 3300026121 Bacteria 844
341 Ga0207698_10260595 3300026142 Unclassified 1592
342 Ga0207698_11255616 3300026142 Bacteria 755
343 Ga0209969_1000819 3300027360 Bacteria 4180
344 Ga0209967_1011141 3300027364 Bacteria 1258
345 Ga0209996_1011764 3300027395 Bacteria 1171
346 Ga0209995_1000526 3300027471 Bacteria 5798
347 Ga0209968_1001120 3300027526 Bacteria 4084
348 Ga0209999_1002816 3300027543 Bacteria 3080
349 Ga0209970_1014279 3300027614 Bacteria 1319
350 Ga0209983_1003507 3300027665 Bacteria 3342
351 Ga0209588_1050130 3300027671 Bacteria 1351
352 Ga0209971_1000031 3300027682 Bacteria 50315
353 Ga0209966_1000020 3300027695 Bacteria 68386
354 Ga0209998_10000024 3300027717 Bacteria 64123
355 Ga0209974_10009769 3300027876 Bacteria 3252
356 Ga0207428_10028705 3300027907 Bacteria 4620
357 Ga0207428_10097852 3300027907 Bacteria 2271
358 Ga0268266_10003235 3300028379 Bacteria 16447
359 Ga0268266_10213480 3300028379 Bacteria 1771
360 Ga0268266_10596101 3300028379 Unclassified 1061
361 Ga0268265_10010967 3300028380 Bacteria 6120
362 Ga0268264_10112259 3300028381 Bacteria 2389
363 Ga0268264_10997612 3300028381 Bacteria 844
364 Ga0265762_1001102 3300030760 Bacteria 4860
365 Ga0307409_101043717 3300031995 Unclassified 837
366 Ga0307416_101195075 3300032002 Unclassified 866
367 Ga0307415_100688471 3300032126 Unclassified 921
368 Ga0316212_1000829 3300033547 Bacteria 4000
369 Ga0373930_0018331 3300034816 Bacteria 1344
370 Ga0373948_0049372 3300034817 Unclassified 900
371 Ga0373959_0001464 3300034820 Bacteria 3770
372 Ga0373938_0000524 3300034957 Bacteria 6232
373 Ga0373928_0010312 3300035084 Bacteria 1835
374 Ga0373929_0001741 3300035085 Bacteria 4091
375 Ga0373949_0026594 3300035090 Bacteria 1356
376 Ga0373949_0030222 3300035090 Bacteria 1287
377 Ga0373951_0011661 3300035091 Bacteria 1975
378 Ga0373952_0000806 3300035092 Bacteria 5635
379 Ga0373932_0025789 3300035112 Bacteria 1594
380 Ga0373939_0000138 3300035114 Bacteria 20969
381 Ga0373941_0000086 3300035115 Bacteria 15129
382 Ga0373960_0008180 3300035121 Bacteria 2499
383 Ga0373942_0001119 3300035207 Bacteria 7120
384 Ga0373961_0006481 3300035241 Bacteria 2810
385 Ga0373962_0014123 3300035242 Bacteria 2031
386 Ga0373931_0002913 3300035691 Bacteria 7634
387 Ga0373933_0249035 3300035724 Bacteria 1144
388 Ga0373937_1251851 3300036401 Bacteria 690
389 Ga0395900_0006116 3300037418 Bacteria 12551
390 Ga0395898_0004956 3300037466 Bacteria 14452
391 Ga0395898_1252723 3300037466 Unclassified 672
392 Ga0395905_0116356 3300037471 Bacteria 2513
393 Ga0395905_0261199 3300037471 Unclassified 1617
394 Ga0395905_0374369 3300037471 Bacteria 1318
395 Ga0395905_0890661 3300037471 Bacteria 793
396 Ga0436364_0910392 3300037853 Bacteria 658
397 Ga0395901_0000893 3300038443 Bacteria 32764
398 Ga0395901_0689782 3300038443 Bacteria 1020
399 Ga0242422_00891 3300038699 Unclassified 2023
400 Ga0436365_0524461 3300039437 Bacteria 1620
401 Ga0436365_1738066 3300039437 Bacteria 103785
402 Ga0436360_0729932 3300039438 Bacteria 1461
403 Ga0436361_0068265 3300039447 Unclassified 603
404 Ga0436363_0606919 3300039450 Unclassified 546
405 Ga0439431_0258607 3300041997 Unclassified 518
406 Ga0439448_0018809 3300042005 Unclassified 2121
407 Ga0439435_0021051 3300042436 Unclassified 1689
408 Ga0439460_0034586 3300042461 Unclassified 1457
409 Ga0451577_0106161 3300042876 Bacteria 2510
410 Ga0451577_0108922 3300042876 Bacteria 2477
411 Ga0439440_0009259 3300042993 Unclassified 2039
412 Ga0453683_0002445 3300044673 Bacteria 14394
413 Ga0453683_0129805 3300044673 Bacteria 1587
414 Ga0453684_1121112 3300044712 Bacteria 830
415 Ga0451576_0010342 3300045051 Bacteria 10713
416 Ga0451576_0110810 3300045051 Bacteria 2856
417 Ga0451576_1085668 3300045051 Bacteria 838
418 Ga0451576_1921342 3300045051 Unclassified 610
419 Ga0495669_0597777 3300046684 Unclassified 537
420 Ga0496100_0088097 3300048903 Bacteria 2112
421 Ga0496101_0475260 3300048904 Unclassified 987
422 Ga0496102_0212725 3300048905 Bacteria 1823
423 Ga0496102_0231649 3300048905 Bacteria 1741
424 Ga0496103_0046092 3300048906 Bacteria 2691
425 Ga0496106_0058178 3300048909 Bacteria 2926
426 Ga0496106_0191571 3300048909 Unclassified 1626
427 Ga0496106_0737713 3300048909 Unclassified 784
428 Ga0496107_0046578 3300048910 Bacteria 3121
429 Ga0496107_0529349 3300048910 Unclassified 874
430 Ga0496108_0000689 3300048911 Bacteria 26147
431 Ga0496109_0001300 3300048912 Bacteria 20670
432 Ga0496110_0043918 3300048913 Bacteria 3902
433 Ga0496115_0428869 3300048918 Bacteria 1070
434 Ga0501032_0228077 3300049569 Unclassified 1211
435 Ga0501033_0072748 3300049570 Bacteria 2524
436 Ga0501036_0272373 3300049572 Bacteria 1417
437 Ga0501038_0038405 3300049574 Bacteria 4193
438 Ga0501039_0006276 3300049575 Bacteria 9027
439 Ga0501040_0002281 3300049576 Bacteria 12329
440 Ga0501041_0034373 3300049577 Bacteria 3068
441 Ga0501042_0022078 3300049578 Bacteria 4443
442 Ga0501043_0093359 3300049579 Bacteria 2366
443 Ga0501046_0000607 3300049580 Bacteria 35214
444 Ga0501046_0459772 3300049580 Bacteria 915
445 Ga0501047_0053799 3300049581 Bacteria 3894
446 Ga0501067_0327527 3300049583 Bacteria 853
447 Ga0501068_0068188 3300049584 Bacteria 2168
448 Ga0501068_0177681 3300049584 Bacteria 1345
449 Ga0501069_0058008 3300049585 Bacteria 2159
450 Ga0501070_0025641 3300049586 Bacteria 4945
451 Ga0501072_0049358 3300049588 Bacteria 3313
452 Ga0501073_0004686 3300049589 Bacteria 10276
453 Ga0501073_0662468 3300049589 Bacteria 720
454 Ga0501074_0007780 3300049590 Bacteria 7758
455 Ga0501074_0088465 3300049590 Bacteria 2218
456 Ga0501074_1140211 3300049590 Unclassified 547
457 Ga0501075_0005460 3300049591 Bacteria 8691
458 Ga0501076_0053357 3300049592 Bacteria 3203
459 Ga0501077_0134496 3300049593 Unclassified 1568
460 Ga0501217_026373 3300049661 Bacteria 1404
461 Ga0501079_0000976 3300049741 Bacteria 19702
462 Ga0501080_0046004 3300049742 Bacteria 4065
463 Ga0501080_0131268 3300049742 Bacteria 2319
464 Ga0501081_0017810 3300049743 Bacteria 4708
465 Ga0501081_0911785 3300049743 Bacteria 663
466 Ga0501083_0058995 3300049744 Bacteria 2567
467 Ga0501083_0071395 3300049744 Unclassified 2308
468 Ga0501045_0003234 3300049824 Bacteria 11126
469 Ga0501045_0201339 3300049824 Unclassified 1483
470 nmdc:mga05p37_1090256_c1 3300050507 Bacteria 837
471 nmdc:mga05p37_1153359_c1 3300050507 Bacteria 806
472 nmdc:mga05p37_1195207_c1 3300050507 Bacteria 786
473 nmdc:mga05p37_133931_c1 3300050507 Bacteria 3040
474 nmdc:mga05p37_1580043_c1 3300050507 Bacteria 648
475 nmdc:mga05p37_479355_c1 3300050507 Bacteria 1433
476 nmdc:mga05p37_594168_c1 3300050507 Unclassified 1251
477 nmdc:mga09592_1558590_c1 3300050508 Bacteria 536
478 nmdc:mga09592_965702_c1 3300050508 Unclassified 714
479 nmdc:mga0qj67_172933_c1 3300050509 Bacteria 1754
480 nmdc:mga06r32_159581_c1 3300050510 Bacteria 2237
481 nmdc:mga06r32_162149_c1 3300050510 Bacteria 2218
482 nmdc:mga06r32_268647_c1 3300050510 Unclassified 1693
483 nmdc:mga06r32_345464_c1 3300050510 Bacteria 1472
484 nmdc:mga06r32_54016_c1 3300050510 Unclassified 3851
485 nmdc:mga06r32_722177_c1 3300050510 Bacteria 961
486 nmdc:mga06r32_85049_c1 3300050510 Bacteria 3084
487 nmdc:mga08y16_64803_c1 3300050511 Unclassified 3815
488 nmdc:mga08y16_814776_c1 3300050511 Unclassified 925
489 nmdc:mga08y16_945711_c1 3300050511 Unclassified 845
490 nmdc:mga0n895_1329251_c1 3300050512 Unclassified 689
491 nmdc:mga0n895_137297_c1 3300050512 Unclassified 2472
492 nmdc:mga0n895_362992_c1 3300050512 Bacteria 1466
493 nmdc:mga0n895_41798_c1 3300050512 Bacteria 4458
494 nmdc:mga0n895_4_c1 3300050512 Bacteria 133851
495 nmdc:mga0n895_50053_c1 3300050512 Bacteria 4096
496 nmdc:mga0n895_80538_c1 3300050512 Bacteria 3245
497 nmdc:mga0rr50_168177_c1 3300050513 Unclassified 1784
498 nmdc:mga0rr50_221644_c1 3300050513 Unclassified 1562
499 nmdc:mga0rr50_43462_c1 3300050513 Unclassified 3289
500 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
501 nmdc:mga08x19_137781_c1 3300050514 Unclassified 1646
502 nmdc:mga08x19_228025_c1 3300050514 Unclassified 1282
503 nmdc:mga08x19_48137_c1 3300050514 Bacteria 2730
504 nmdc:mga08x19_5253_c1 3300050514 Bacteria 7664
505 nmdc:mga0a205_196177_c1 3300050515 Bacteria 1910
506 nmdc:mga0a205_30717_c1 3300050515 Bacteria 5146
507 nmdc:mga0a205_311286_c1 3300050515 Bacteria 1447
508 nmdc:mga0a205_697575_c1 3300050515 Bacteria 865
509 Ga0501084_0010953 3300054114 Bacteria 7511
510 Ga0501082_0001321 3300060353 Bacteria 21707
511 Ga0501082_0012651 3300060353 Bacteria 7253
512 Ga0530510_0062847 3300061734 Bacteria 2688

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100003108 Ga0075428_10000310814 136
2 3300006914 Ga0075436_100097474 Ga0075436_1000974743 138
3 3300027671 Ga0209588_1050130 Ga0209588_10501302 138
4 3300005327 Ga0070658_11064725 Ga0070658_110647251 139
5 3300005343 Ga0070687_100035503 Ga0070687_1000355031 139
6 3300005364 Ga0070673_100387537 Ga0070673_1003875372 139
7 3300005366 Ga0070659_100078244 Ga0070659_1000782444 139
8 3300005539 Ga0068853_100116109 Ga0068853_1001161092 139
9 3300005543 Ga0070672_101130777 Ga0070672_1011307771 139
10 3300005544 Ga0070686_100004656 Ga0070686_1000046566 139
11 3300005546 Ga0070696_100319163 Ga0070696_1003191632 139
12 3300005563 Ga0068855_100229287 Ga0068855_1002292872 139
13 3300005578 Ga0068854_100355855 Ga0068854_1003558552 139
14 3300005616 Ga0068852_100379183 Ga0068852_1003791832 139
15 3300005719 Ga0068861_100192292 Ga0068861_1001922922 139
16 3300006871 Ga0075434_100007466 Ga0075434_1000074667 139
17 3300006914 Ga0075436_100007102 Ga0075436_1000071026 139
18 3300006914 Ga0075436_100151523 Ga0075436_1001515233 139
19 3300007076 Ga0075435_100000051 Ga0075435_10000005144 139
20 3300007076 Ga0075435_100006302 Ga0075435_1000063024 139
21 3300025913 Ga0207695_10320351 Ga0207695_103203511 139
22 3300025931 Ga0207644_10903988 Ga0207644_109039881 139
23 3300025941 Ga0207711_10238366 Ga0207711_102383662 139
24 3300025981 Ga0207640_10791981 Ga0207640_107919811 139
25 3300034816 Ga0373930_0018331 Ga0373930_0018331_197_616 139
26 3300034817 Ga0373948_0049372 Ga0373948_0049372_461_880 139
27 3300034820 Ga0373959_0001464 Ga0373959_0001464_3247_3666 139
28 3300034957 Ga0373938_0000524 Ga0373938_0000524_3501_3920 139
29 3300035084 Ga0373928_0010312 Ga0373928_0010312_342_761 139
30 3300035085 Ga0373929_0001741 Ga0373929_0001741_3476_3895 139
31 3300035090 Ga0373949_0026594 Ga0373949_0026594_586_1005 139
32 3300035091 Ga0373951_0011661 Ga0373951_0011661_143_562 139
33 3300035092 Ga0373952_0000806 Ga0373952_0000806_2075_2494 139
34 3300035112 Ga0373932_0025789 Ga0373932_0025789_77_496 139
35 3300035114 Ga0373939_0000138 Ga0373939_0000138_6695_7114 139
36 3300035115 Ga0373941_0000086 Ga0373941_0000086_3327_3746 139
37 3300035121 Ga0373960_0008180 Ga0373960_0008180_1651_2070 139
38 3300035207 Ga0373942_0001119 Ga0373942_0001119_6546_6965 139
39 3300035241 Ga0373961_0006481 Ga0373961_0006481_1981_2400 139
40 3300035242 Ga0373962_0014123 Ga0373962_0014123_1103_1522 139
41 3300035691 Ga0373931_0002913 Ga0373931_0002913_5418_5837 139
42 3300045051 Ga0451576_0010342 Ga0451576_0010342_10157_10576 139
43 3300050512 nmdc:mga0n895_4_c1 nmdc:mga0n895_4_c1_19259_19678 139
44 3300050513 nmdc:mga0rr50_4_c1 nmdc:mga0rr50_4_c1_165420_165839 139
45 3300050514 nmdc:mga08x19_5253_c1 nmdc:mga08x19_5253_c1_3835_4254 139
46 3300033547 Ga0316212_1000829 Ga0316212_10008294 140
47 3300005437 Ga0070710_10547688 Ga0070710_105476881 141
48 3300005439 Ga0070711_100000674 Ga0070711_1000006742 141
49 3300005467 Ga0070706_100169661 Ga0070706_1001696613 141
50 3300005467 Ga0070706_100182362 Ga0070706_1001823622 141
51 3300005471 Ga0070698_100252672 Ga0070698_1002526722 141
52 3300005536 Ga0070697_100026992 Ga0070697_1000269925 141
53 3300006028 Ga0070717_10003286 Ga0070717_1000328612 141
54 3300006028 Ga0070717_10056378 Ga0070717_100563783 141
55 3300006028 Ga0070717_10099335 Ga0070717_100993353 141
56 3300006175 Ga0070712_100095581 Ga0070712_1000955813 141
57 3300006914 Ga0075436_100235533 Ga0075436_1002355331 141
58 3300007788 Ga0099795_10531651 Ga0099795_105316511 141
59 3300014325 Ga0163163_12097382 Ga0163163_120973822 141
60 3300025910 Ga0207684_10122496 Ga0207684_101224962 141
61 3300025928 Ga0207700_10002698 Ga0207700_100026987 141
62 3300030760 Ga0265762_1001102 Ga0265762_10011021 141
63 3300050512 nmdc:mga0n895_1329251_c1 nmdc:mga0n895_1329251_c1_182_625 141
64 3300050514 nmdc:mga08x19_48137_c1 nmdc:mga08x19_48137_c1_107_550 141
65 3300005293 Ga0065715_10136418 Ga0065715_101364182 142
66 3300005329 Ga0070683_100182271 Ga0070683_1001822712 142
67 3300005336 Ga0070680_100478016 Ga0070680_1004780162 142
68 3300005340 Ga0070689_100066217 Ga0070689_1000662173 142
69 3300005341 Ga0070691_10123081 Ga0070691_101230812 142
70 3300005445 Ga0070708_100815561 Ga0070708_1008155612 142
71 3300005458 Ga0070681_10239774 Ga0070681_102397741 142
72 3300005518 Ga0070699_100273406 Ga0070699_1002734062 142
73 3300005518 Ga0070699_100661012 Ga0070699_1006610121 142
74 3300005530 Ga0070679_100182908 Ga0070679_1001829082 142
75 3300005535 Ga0070684_101001475 Ga0070684_1010014752 142
76 3300005844 Ga0068862_100388222 Ga0068862_1003882221 142
77 3300009147 Ga0114129_10014630 Ga0114129_100146302 142
78 3300009147 Ga0114129_10143182 Ga0114129_101431822 142
79 3300009147 Ga0114129_10153466 Ga0114129_101534663 142
80 3300009551 Ga0105238_10175705 Ga0105238_101757052 142
81 3300020069 Ga0197907_10788264 Ga0197907_107882641 142
82 3300020081 Ga0206354_11045861 Ga0206354_110458611 142
83 3300021441 Ga0213871_10125279 Ga0213871_101252792 142
84 3300025921 Ga0207652_10745414 Ga0207652_107454142 142
85 3300025924 Ga0207694_10240161 Ga0207694_102401612 142
86 3300025939 Ga0207665_10862196 Ga0207665_108621961 142
87 3300025944 Ga0207661_10031498 Ga0207661_100314982 142
88 3300026116 Ga0207674_11128874 Ga0207674_111288741 142
89 3300035724 Ga0373933_0249035 Ga0373933_0249035_366_800 142
90 3300037471 Ga0395905_0116356 Ga0395905_0116356_1794_2222 142
91 3300037471 Ga0395905_0261199 Ga0395905_0261199_838_1266 142
92 3300037471 Ga0395905_0890661 Ga0395905_0890661_19_447 142
93 3300038443 Ga0395901_0689782 Ga0395901_0689782_68_496 142
94 3300039437 Ga0436365_1738066 Ga0436365_1738066_81205_81633 142
95 3300044673 Ga0453683_0002445 Ga0453683_0002445_2345_2773 142
96 3300049580 Ga0501046_0459772 Ga0501046_0459772_318_758 142
97 3300049589 Ga0501073_0004686 Ga0501073_0004686_8158_8604 142
98 3300049589 Ga0501073_0662468 Ga0501073_0662468_61_507 142
99 3300050507 nmdc:mga05p37_1153359_c1 nmdc:mga05p37_1153359_c1_121_573 142
100 3300050507 nmdc:mga05p37_133931_c1 nmdc:mga05p37_133931_c1_1315_1743 142
101 3300050507 nmdc:mga05p37_1580043_c1 nmdc:mga05p37_1580043_c1_154_582 142
102 3300050512 nmdc:mga0n895_362992_c1 nmdc:mga0n895_362992_c1_657_1091 142
103 3300050512 nmdc:mga0n895_41798_c1 nmdc:mga0n895_41798_c1_3729_4157 142
104 3300050515 nmdc:mga0a205_30717_c1 nmdc:mga0a205_30717_c1_3602_4030 142
105 3300050515 nmdc:mga0a205_311286_c1 nmdc:mga0a205_311286_c1_667_1095 142
106 3300050515 nmdc:mga0a205_697575_c1 nmdc:mga0a205_697575_c1_182_610 142
107 3300042005 Ga0439448_0018809 Ga0439448_0018809_1182_1613 143
108 3300005444 Ga0070694_100593872 Ga0070694_1005938722 144
109 3300005535 Ga0070684_100304928 Ga0070684_1003049282 144
110 3300005618 Ga0068864_100019391 Ga0068864_1000193915 144
111 3300006852 Ga0075433_10390826 Ga0075433_103908262 144
112 3300006871 Ga0075434_100274986 Ga0075434_1002749863 144
113 3300009093 Ga0105240_10125190 Ga0105240_101251902 144
114 3300009093 Ga0105240_10504303 Ga0105240_105043032 144
115 3300009094 Ga0111539_10160895 Ga0111539_101608952 144
116 3300013104 Ga0157370_10006933 Ga0157370_100069339 144
117 3300013105 Ga0157369_10001003 Ga0157369_1000100316 144
118 3300020081 Ga0206354_10499979 Ga0206354_104999792 144
119 3300026095 Ga0207676_10011008 Ga0207676_100110086 144
120 3300045051 Ga0451576_1085668 Ga0451576_1085668_336_770 144
121 3300050515 nmdc:mga0a205_196177_c1 nmdc:mga0a205_196177_c1_646_1080 144
122 3300003347 JGI26128J50194_1006590 JGI26128J50194_10065902 145
123 3300003349 JGI26129J50193_1010430 JGI26129J50193_10104302 145
124 3300003911 JGI25405J52794_10025671 JGI25405J52794_100256711 145
125 3300005295 Ga0065707_10262742 Ga0065707_102627422 145
126 3300005434 Ga0070709_10813392 Ga0070709_108133921 145
127 3300005434 Ga0070709_11158549 Ga0070709_111585491 145
128 3300005440 Ga0070705_101455288 Ga0070705_1014552881 145
129 3300005444 Ga0070694_100056884 Ga0070694_1000568842 145
130 3300005445 Ga0070708_100126723 Ga0070708_1001267232 145
131 3300005445 Ga0070708_100269096 Ga0070708_1002690963 145
132 3300005445 Ga0070708_100353701 Ga0070708_1003537012 145
133 3300005445 Ga0070708_100478475 Ga0070708_1004784752 145
134 3300005445 Ga0070708_100856207 Ga0070708_1008562071 145
135 3300005445 Ga0070708_101005836 Ga0070708_1010058362 145
136 3300005457 Ga0070662_100015410 Ga0070662_1000154103 145
137 3300005467 Ga0070706_100012720 Ga0070706_1000127202 145
138 3300005467 Ga0070706_100094363 Ga0070706_1000943634 145
139 3300005467 Ga0070706_100151857 Ga0070706_1001518572 145
140 3300005467 Ga0070706_100167209 Ga0070706_1001672092 145
141 3300005468 Ga0070707_100000050 Ga0070707_10000005022 145
142 3300005468 Ga0070707_100013117 Ga0070707_1000131172 145
143 3300005468 Ga0070707_100169401 Ga0070707_1001694013 145
144 3300005471 Ga0070698_100003437 Ga0070698_1000034379 145
145 3300005471 Ga0070698_100029289 Ga0070698_1000292895 145
146 3300005471 Ga0070698_100136460 Ga0070698_1001364602 145
147 3300005471 Ga0070698_101420719 Ga0070698_1014207191 145
148 3300005518 Ga0070699_100002495 Ga0070699_10000249515 145
149 3300005518 Ga0070699_100010410 Ga0070699_1000104106 145
150 3300005518 Ga0070699_100104125 Ga0070699_1001041253 145
151 3300005518 Ga0070699_100259159 Ga0070699_1002591593 145
152 3300005518 Ga0070699_100305570 Ga0070699_1003055702 145
153 3300005518 Ga0070699_100617065 Ga0070699_1006170652 145
154 3300005518 Ga0070699_100909890 Ga0070699_1009098902 145
155 3300005518 Ga0070699_101203794 Ga0070699_1012037941 145
156 3300005518 Ga0070699_101585877 Ga0070699_1015858771 145
157 3300005536 Ga0070697_100018675 Ga0070697_1000186757 145
158 3300005536 Ga0070697_100043246 Ga0070697_1000432463 145
159 3300005536 Ga0070697_100070003 Ga0070697_1000700032 145
160 3300005536 Ga0070697_100146907 Ga0070697_1001469074 145
161 3300005536 Ga0070697_100166926 Ga0070697_1001669262 145
162 3300005536 Ga0070697_100258509 Ga0070697_1002585091 145
163 3300005536 Ga0070697_100644097 Ga0070697_1006440972 145
164 3300005536 Ga0070697_100646849 Ga0070697_1006468492 145
165 3300005536 Ga0070697_100704675 Ga0070697_1007046752 145
166 3300005545 Ga0070695_100011739 Ga0070695_1000117392 145
167 3300005545 Ga0070695_100208810 Ga0070695_1002088102 145
168 3300005546 Ga0070696_100446022 Ga0070696_1004460222 145
169 3300005548 Ga0070665_100087159 Ga0070665_1000871592 145
170 3300005549 Ga0070704_100392938 Ga0070704_1003929381 145
171 3300005549 Ga0070704_100606082 Ga0070704_1006060822 145
172 3300005549 Ga0070704_101333379 Ga0070704_1013333792 145
173 3300005577 Ga0068857_100648008 Ga0068857_1006480082 145
174 3300005578 Ga0068854_100004621 Ga0068854_1000046214 145
175 3300005615 Ga0070702_100147947 Ga0070702_1001479472 145
176 3300005618 Ga0068864_100182793 Ga0068864_1001827933 145
177 3300005618 Ga0068864_101214912 Ga0068864_1012149121 145
178 3300005937 Ga0081455_10000208 Ga0081455_1000020870 145
179 3300006844 Ga0075428_100305243 Ga0075428_1003052433 145
180 3300006844 Ga0075428_100439985 Ga0075428_1004399852 145
181 3300006844 Ga0075428_101005861 Ga0075428_1010058611 145
182 3300006846 Ga0075430_100106022 Ga0075430_1001060222 145
183 3300006847 Ga0075431_100019321 Ga0075431_1000193213 145
184 3300006847 Ga0075431_100129844 Ga0075431_1001298443 145
185 3300006847 Ga0075431_100150287 Ga0075431_1001502873 145
186 3300006847 Ga0075431_100204244 Ga0075431_1002042442 145
187 3300006847 Ga0075431_100357269 Ga0075431_1003572691 145
188 3300006847 Ga0075431_100358295 Ga0075431_1003582952 145
189 3300006852 Ga0075433_10224621 Ga0075433_102246213 145
190 3300006852 Ga0075433_10776699 Ga0075433_107766992 145
191 3300006871 Ga0075434_100043592 Ga0075434_1000435923 145
192 3300006871 Ga0075434_100114010 Ga0075434_1001140104 145
193 3300006871 Ga0075434_100263422 Ga0075434_1002634223 145
194 3300006914 Ga0075436_100022925 Ga0075436_1000229253 145
195 3300006914 Ga0075436_100971445 Ga0075436_1009714451 145
196 3300006931 Ga0097620_102031266 Ga0097620_1020312661 145
197 3300007076 Ga0075435_100013820 Ga0075435_1000138207 145
198 3300007076 Ga0075435_100046095 Ga0075435_1000460952 145
199 3300007076 Ga0075435_100086629 Ga0075435_1000866294 145
200 3300007076 Ga0075435_100229544 Ga0075435_1002295442 145
201 3300007265 Ga0099794_10000928 Ga0099794_100009285 145
202 3300007265 Ga0099794_10171820 Ga0099794_101718202 145
203 3300009093 Ga0105240_11397131 Ga0105240_113971312 145
204 3300009094 Ga0111539_10055749 Ga0111539_100557491 145
205 3300009098 Ga0105245_10807116 Ga0105245_108071162 145
206 3300009147 Ga0114129_10233436 Ga0114129_102334361 145
207 3300009147 Ga0114129_11009622 Ga0114129_110096222 145
208 3300009147 Ga0114129_11273046 Ga0114129_112730461 145
209 3300009147 Ga0114129_11473404 Ga0114129_114734041 145
210 3300009147 Ga0114129_11740762 Ga0114129_117407622 145
211 3300009147 Ga0114129_12217173 Ga0114129_122171732 145
212 3300009148 Ga0105243_10575976 Ga0105243_105759763 145
213 3300009174 Ga0105241_10141904 Ga0105241_101419042 145
214 3300009174 Ga0105241_10624246 Ga0105241_106242461 145
215 3300009177 Ga0105248_10169097 Ga0105248_101690973 145
216 3300009177 Ga0105248_10755323 Ga0105248_107553232 145
217 3300010375 Ga0105239_10595645 Ga0105239_105956452 145
218 3300011119 Ga0105246_10190138 Ga0105246_101901381 145
219 3300013100 Ga0157373_10120628 Ga0157373_101206282 145
220 3300013307 Ga0157372_10139142 Ga0157372_101391422 145
221 3300013307 Ga0157372_10257809 Ga0157372_102578092 145
222 3300025906 Ga0207699_10436596 Ga0207699_104365962 145
223 3300025910 Ga0207684_10006757 Ga0207684_100067576 145
224 3300025910 Ga0207684_10026638 Ga0207684_100266383 145
225 3300025910 Ga0207684_10094813 Ga0207684_100948134 145
226 3300025910 Ga0207684_10100277 Ga0207684_101002772 145
227 3300025910 Ga0207684_11105031 Ga0207684_111050312 145
228 3300025913 Ga0207695_10660441 Ga0207695_106604411 145
229 3300025918 Ga0207662_10027438 Ga0207662_100274383 145
230 3300025922 Ga0207646_10000037 Ga0207646_1000003754 145
231 3300025922 Ga0207646_10037698 Ga0207646_100376982 145
232 3300025922 Ga0207646_10045159 Ga0207646_100451593 145
233 3300025922 Ga0207646_10544614 Ga0207646_105446142 145
234 3300025922 Ga0207646_10771810 Ga0207646_107718102 145
235 3300025932 Ga0207690_10402101 Ga0207690_104021012 145
236 3300025933 Ga0207706_10363744 Ga0207706_103637442 145
237 3300025933 Ga0207706_10703718 Ga0207706_107037182 145
238 3300025936 Ga0207670_10066416 Ga0207670_100664163 145
239 3300025941 Ga0207711_10157713 Ga0207711_101577133 145
240 3300025981 Ga0207640_10004709 Ga0207640_100047097 145
241 3300026035 Ga0207703_11424508 Ga0207703_114245082 145
242 3300026095 Ga0207676_10936926 Ga0207676_109369262 145
243 3300026095 Ga0207676_11910967 Ga0207676_119109671 145
244 3300026116 Ga0207674_10498715 Ga0207674_104987152 145
245 3300026116 Ga0207674_10744573 Ga0207674_107445732 145
246 3300026118 Ga0207675_100165589 Ga0207675_1001655893 145
247 3300026142 Ga0207698_10260595 Ga0207698_102605952 145
248 3300027360 Ga0209969_1000819 Ga0209969_10008192 145
249 3300027364 Ga0209967_1011141 Ga0209967_10111412 145
250 3300027395 Ga0209996_1011764 Ga0209996_10117643 145
251 3300027471 Ga0209995_1000526 Ga0209995_10005264 145
252 3300027526 Ga0209968_1001120 Ga0209968_10011204 145
253 3300027543 Ga0209999_1002816 Ga0209999_10028162 145
254 3300027614 Ga0209970_1014279 Ga0209970_10142793 145
255 3300027665 Ga0209983_1003507 Ga0209983_10035074 145
256 3300027682 Ga0209971_1000031 Ga0209971_100003138 145
257 3300027695 Ga0209966_1000020 Ga0209966_10000207 145
258 3300027717 Ga0209998_10000024 Ga0209998_1000002411 145
259 3300027876 Ga0209974_10009769 Ga0209974_100097694 145
260 3300027907 Ga0207428_10028705 Ga0207428_100287054 145
261 3300027907 Ga0207428_10097852 Ga0207428_100978522 145
262 3300028379 Ga0268266_10596101 Ga0268266_105961012 145
263 3300031995 Ga0307409_101043717 Ga0307409_1010437171 145
264 3300032002 Ga0307416_101195075 Ga0307416_1011950752 145
265 3300032126 Ga0307415_100688471 Ga0307415_1006884711 145
266 3300035090 Ga0373949_0030222 Ga0373949_0030222_334_771 145
267 3300036401 Ga0373937_1251851 Ga0373937_1251851_172_609 145
268 3300037418 Ga0395900_0006116 Ga0395900_0006116_11396_11833 145
269 3300037466 Ga0395898_0004956 Ga0395898_0004956_12745_13182 145
270 3300037471 Ga0395905_0374369 Ga0395905_0374369_374_811 145
271 3300037853 Ga0436364_0910392 Ga0436364_0910392_59_496 145
272 3300038443 Ga0395901_0000893 Ga0395901_0000893_5905_6342 145
273 3300038699 Ga0242422_00891 Ga0242422_00891_395_832 145
274 3300039437 Ga0436365_0524461 Ga0436365_0524461_43_480 145
275 3300041997 Ga0439431_0258607 Ga0439431_0258607_53_490 145
276 3300042436 Ga0439435_0021051 Ga0439435_0021051_650_1087 145
277 3300042461 Ga0439460_0034586 Ga0439460_0034586_937_1374 145
278 3300042876 Ga0451577_0106161 Ga0451577_0106161_82_519 145
279 3300042876 Ga0451577_0108922 Ga0451577_0108922_624_1061 145
280 3300042993 Ga0439440_0009259 Ga0439440_0009259_772_1209 145
281 3300044673 Ga0453683_0129805 Ga0453683_0129805_17_454 145
282 3300044712 Ga0453684_1121112 Ga0453684_1121112_216_653 145
283 3300045051 Ga0451576_0110810 Ga0451576_0110810_1091_1528 145
284 3300045051 Ga0451576_1921342 Ga0451576_1921342_99_536 145
285 3300048904 Ga0496101_0475260 Ga0496101_0475260_429_866 145
286 3300048909 Ga0496106_0191571 Ga0496106_0191571_716_1153 145
287 3300048909 Ga0496106_0737713 Ga0496106_0737713_202_639 145
288 3300048910 Ga0496107_0529349 Ga0496107_0529349_344_781 145
289 3300049569 Ga0501032_0228077 Ga0501032_0228077_628_1065 145
290 3300049570 Ga0501033_0072748 Ga0501033_0072748_1610_2047 145
291 3300049572 Ga0501036_0272373 Ga0501036_0272373_439_876 145
292 3300049574 Ga0501038_0038405 Ga0501038_0038405_660_1097 145
293 3300049575 Ga0501039_0006276 Ga0501039_0006276_3240_3677 145
294 3300049576 Ga0501040_0002281 Ga0501040_0002281_3126_3563 145
295 3300049577 Ga0501041_0034373 Ga0501041_0034373_1708_2145 145
296 3300049578 Ga0501042_0022078 Ga0501042_0022078_2879_3316 145
297 3300049579 Ga0501043_0093359 Ga0501043_0093359_1105_1542 145
298 3300049580 Ga0501046_0000607 Ga0501046_0000607_8443_8880 145
299 3300049581 Ga0501047_0053799 Ga0501047_0053799_485_922 145
300 3300049584 Ga0501068_0068188 Ga0501068_0068188_1178_1615 145
301 3300049585 Ga0501069_0058008 Ga0501069_0058008_641_1078 145
302 3300049588 Ga0501072_0049358 Ga0501072_0049358_1624_2061 145
303 3300049590 Ga0501074_0007780 Ga0501074_0007780_2421_2858 145
304 3300049590 Ga0501074_1140211 Ga0501074_1140211_29_466 145
305 3300049591 Ga0501075_0005460 Ga0501075_0005460_6424_6861 145
306 3300049592 Ga0501076_0053357 Ga0501076_0053357_1818_2255 145
307 3300049593 Ga0501077_0134496 Ga0501077_0134496_795_1232 145
308 3300049661 Ga0501217_026373 Ga0501217_026373_401_838 145
309 3300049741 Ga0501079_0000976 Ga0501079_0000976_2728_3165 145
310 3300049742 Ga0501080_0046004 Ga0501080_0046004_2503_2940 145
311 3300049743 Ga0501081_0017810 Ga0501081_0017810_2780_3217 145
312 3300049744 Ga0501083_0058995 Ga0501083_0058995_142_579 145
313 3300049824 Ga0501045_0003234 Ga0501045_0003234_3515_3952 145
314 3300049824 Ga0501045_0201339 Ga0501045_0201339_845_1282 145
315 3300050507 nmdc:mga05p37_1090256_c1 nmdc:mga05p37_1090256_c1_90_539 145
316 3300050507 nmdc:mga05p37_1195207_c1 nmdc:mga05p37_1195207_c1_159_596 145
317 3300050507 nmdc:mga05p37_479355_c1 nmdc:mga05p37_479355_c1_596_1045 145
318 3300050507 nmdc:mga05p37_594168_c1 nmdc:mga05p37_594168_c1_554_991 145
319 3300050508 nmdc:mga09592_1558590_c1 nmdc:mga09592_1558590_c1_50_487 145
320 3300050508 nmdc:mga09592_965702_c1 nmdc:mga09592_965702_c1_61_498 145
321 3300050509 nmdc:mga0qj67_172933_c1 nmdc:mga0qj67_172933_c1_637_1074 145
322 3300050510 nmdc:mga06r32_159581_c1 nmdc:mga06r32_159581_c1_1271_1708 145
323 3300050510 nmdc:mga06r32_162149_c1 nmdc:mga06r32_162149_c1_542_991 145
324 3300050510 nmdc:mga06r32_268647_c1 nmdc:mga06r32_268647_c1_517_954 145
325 3300050510 nmdc:mga06r32_345464_c1 nmdc:mga06r32_345464_c1_987_1424 145
326 3300050510 nmdc:mga06r32_54016_c1 nmdc:mga06r32_54016_c1_143_580 145
327 3300050510 nmdc:mga06r32_722177_c1 nmdc:mga06r32_722177_c1_64_522 145
328 3300050510 nmdc:mga06r32_85049_c1 nmdc:mga06r32_85049_c1_1126_1563 145
329 3300050511 nmdc:mga08y16_64803_c1 nmdc:mga08y16_64803_c1_830_1267 145
330 3300050511 nmdc:mga08y16_945711_c1 nmdc:mga08y16_945711_c1_349_786 145
331 3300050512 nmdc:mga0n895_137297_c1 nmdc:mga0n895_137297_c1_1072_1509 145
332 3300050512 nmdc:mga0n895_50053_c1 nmdc:mga0n895_50053_c1_1894_2331 145
333 3300050512 nmdc:mga0n895_80538_c1 nmdc:mga0n895_80538_c1_1554_1991 145
334 3300050513 nmdc:mga0rr50_168177_c1 nmdc:mga0rr50_168177_c1_839_1276 145
335 3300050513 nmdc:mga0rr50_221644_c1 nmdc:mga0rr50_221644_c1_558_995 145
336 3300050513 nmdc:mga0rr50_43462_c1 nmdc:mga0rr50_43462_c1_1195_1632 145
337 3300050514 nmdc:mga08x19_137781_c1 nmdc:mga08x19_137781_c1_1060_1497 145
338 3300050514 nmdc:mga08x19_228025_c1 nmdc:mga08x19_228025_c1_89_526 145
339 3300054114 Ga0501084_0010953 Ga0501084_0010953_6328_6765 145
340 3300060353 Ga0501082_0001321 Ga0501082_0001321_8166_8603 145
341 3300061734 Ga0530510_0062847 Ga0530510_0062847_1577_2014 145
342 3300049584 Ga0501068_0177681 Ga0501068_0177681_838_1284 146
343 3300049586 Ga0501070_0025641 Ga0501070_0025641_3698_4144 146
344 3300049590 Ga0501074_0088465 Ga0501074_0088465_773_1219 146
345 3300049742 Ga0501080_0131268 Ga0501080_0131268_427_873 146
346 3300049743 Ga0501081_0911785 Ga0501081_0911785_173_619 146
347 3300049744 Ga0501083_0071395 Ga0501083_0071395_1242_1688 146
348 3300060353 Ga0501082_0012651 Ga0501082_0012651_1247_1693 146
349 3300037466 Ga0395898_1252723 Ga0395898_1252723_13_456 147
350 3300015261 Ga0182006_1171976 Ga0182006_11719762 149
351 3300028379 Ga0268266_10213480 Ga0268266_102134803 150
352 3300005331 Ga0070670_100221723 Ga0070670_1002217232 151
353 3300005339 Ga0070660_100087160 Ga0070660_1000871602 151
354 3300005344 Ga0070661_100168682 Ga0070661_1001686821 151
355 3300005455 Ga0070663_101211066 Ga0070663_1012110661 151
356 3300005457 Ga0070662_100019519 Ga0070662_1000195195 151
357 3300005535 Ga0070684_100366017 Ga0070684_1003660173 151
358 3300005563 Ga0068855_100514410 Ga0068855_1005144103 151
359 3300005564 Ga0070664_100199625 Ga0070664_1001996252 151
360 3300005578 Ga0068854_100433188 Ga0068854_1004331882 151
361 3300005614 Ga0068856_100067395 Ga0068856_1000673955 151
362 3300005843 Ga0068860_101037714 Ga0068860_1010377142 151
363 3300006173 Ga0070716_100437704 Ga0070716_1004377041 151
364 3300009174 Ga0105241_10089093 Ga0105241_100890931 151
365 3300009177 Ga0105248_11276275 Ga0105248_112762751 151
366 3300010375 Ga0105239_10231297 Ga0105239_102312971 151
367 3300013100 Ga0157373_10077482 Ga0157373_100774821 151
368 3300013105 Ga0157369_10018225 Ga0157369_100182258 151
369 3300013296 Ga0157374_10069083 Ga0157374_100690832 151
370 3300013307 Ga0157372_10782370 Ga0157372_107823703 151
371 3300014325 Ga0163163_10278786 Ga0163163_102787863 151
372 3300014497 Ga0182008_10050339 Ga0182008_100503392 151
373 3300014969 Ga0157376_10014359 Ga0157376_100143596 151
374 3300025321 Ga0207656_10090925 Ga0207656_100909251 151
375 3300025909 Ga0207705_10149124 Ga0207705_101491241 151
376 3300025917 Ga0207660_10897641 Ga0207660_108976411 151
377 3300025919 Ga0207657_10005688 Ga0207657_1000568813 151
378 3300025920 Ga0207649_10158055 Ga0207649_101580552 151
379 3300025924 Ga0207694_10146809 Ga0207694_101468091 151
380 3300025933 Ga0207706_10050747 Ga0207706_100507473 151
381 3300025945 Ga0207679_10723538 Ga0207679_107235381 151
382 3300025949 Ga0207667_11292411 Ga0207667_112924112 151
383 3300025986 Ga0207658_10295432 Ga0207658_102954321 151
384 3300026067 Ga0207678_10926136 Ga0207678_109261362 151
385 3300026078 Ga0207702_10187998 Ga0207702_101879983 151
386 3300026118 Ga0207675_100283608 Ga0207675_1002836082 151
387 3300026121 Ga0207683_10856109 Ga0207683_108561092 151
388 3300026142 Ga0207698_11255616 Ga0207698_112556161 151
389 3300028381 Ga0268264_10997612 Ga0268264_109976122 151
390 3300048905 Ga0496102_0231649 Ga0496102_0231649_714_1172 151
391 3300001978 JGI24747J21853_1012948 JGI24747J21853_10129482 152
392 3300001991 JGI24743J22301_10006256 JGI24743J22301_100062561 152
393 3300005289 Ga0065704_10423223 Ga0065704_104232231 152
394 3300005327 Ga0070658_10092204 Ga0070658_100922041 152
395 3300005328 Ga0070676_10028309 Ga0070676_100283093 152
396 3300005334 Ga0068869_100049617 Ga0068869_1000496172 152
397 3300005335 Ga0070666_10113694 Ga0070666_101136942 152
398 3300005336 Ga0070680_100153174 Ga0070680_1001531743 152
399 3300005337 Ga0070682_100008051 Ga0070682_1000080518 152
400 3300005338 Ga0068868_100020426 Ga0068868_1000204264 152
401 3300005340 Ga0070689_100067085 Ga0070689_1000670854 152
402 3300005343 Ga0070687_100001840 Ga0070687_1000018405 152
403 3300005353 Ga0070669_100005119 Ga0070669_1000051194 152
404 3300005354 Ga0070675_100009409 Ga0070675_1000094099 152
405 3300005355 Ga0070671_100365827 Ga0070671_1003658272 152
406 3300005356 Ga0070674_100211449 Ga0070674_1002114492 152
407 3300005366 Ga0070659_100002666 Ga0070659_10000266611 152
408 3300005455 Ga0070663_100018203 Ga0070663_1000182032 152
409 3300005457 Ga0070662_100002683 Ga0070662_1000026834 152
410 3300005459 Ga0068867_100003854 Ga0068867_1000038549 152
411 3300005466 Ga0070685_10020596 Ga0070685_100205963 152
412 3300005518 Ga0070699_101002876 Ga0070699_1010028761 152
413 3300005535 Ga0070684_100009298 Ga0070684_1000092983 152
414 3300005536 Ga0070697_100032136 Ga0070697_1000321362 152
415 3300005539 Ga0068853_100006343 Ga0068853_1000063439 152
416 3300005543 Ga0070672_100131384 Ga0070672_1001313842 152
417 3300005544 Ga0070686_100001440 Ga0070686_10000144013 152
418 3300005563 Ga0068855_100304257 Ga0068855_1003042572 152
419 3300005577 Ga0068857_100193153 Ga0068857_1001931532 152
420 3300005578 Ga0068854_100579220 Ga0068854_1005792201 152
421 3300005614 Ga0068856_100012826 Ga0068856_1000128269 152
422 3300005615 Ga0070702_100010550 Ga0070702_1000105506 152
423 3300005616 Ga0068852_100054256 Ga0068852_1000542563 152
424 3300005618 Ga0068864_100195582 Ga0068864_1001955822 152
425 3300005718 Ga0068866_10012445 Ga0068866_100124453 152
426 3300005719 Ga0068861_100063942 Ga0068861_1000639422 152
427 3300005834 Ga0068851_10045214 Ga0068851_100452142 152
428 3300005840 Ga0068870_10047272 Ga0068870_100472722 152
429 3300006173 Ga0070716_100845173 Ga0070716_1008451732 152
430 3300006237 Ga0097621_100141888 Ga0097621_1001418882 152
431 3300006358 Ga0068871_101323297 Ga0068871_1013232971 152
432 3300006852 Ga0075433_10023500 Ga0075433_100235002 152
433 3300006871 Ga0075434_100055542 Ga0075434_1000555422 152
434 3300006881 Ga0068865_100008484 Ga0068865_1000084844 152
435 3300009094 Ga0111539_10840582 Ga0111539_108405822 152
436 3300009098 Ga0105245_10090667 Ga0105245_100906671 152
437 3300009098 Ga0105245_10091336 Ga0105245_100913362 152
438 3300009101 Ga0105247_10009761 Ga0105247_100097616 152
439 3300009174 Ga0105241_10087737 Ga0105241_100877372 152
440 3300009176 Ga0105242_10003389 Ga0105242_1000338913 152
441 3300009553 Ga0105249_10039963 Ga0105249_100399633 152
442 3300010375 Ga0105239_11225565 Ga0105239_112255652 152
443 3300011119 Ga0105246_10015894 Ga0105246_100158944 152
444 3300012508 Ga0157315_1008082 Ga0157315_10080822 152
445 3300013100 Ga0157373_10002380 Ga0157373_100023805 152
446 3300013102 Ga0157371_10002907 Ga0157371_100029073 152
447 3300013105 Ga0157369_10021280 Ga0157369_100212806 152
448 3300013296 Ga0157374_10005580 Ga0157374_100055806 152
449 3300013296 Ga0157374_10140347 Ga0157374_101403471 152
450 3300013308 Ga0157375_10055998 Ga0157375_100559983 152
451 3300014326 Ga0157380_10027507 Ga0157380_100275072 152
452 3300014745 Ga0157377_10001555 Ga0157377_100015556 152
453 3300017792 Ga0163161_10007569 Ga0163161_100075695 152
454 3300025315 Ga0207697_10002780 Ga0207697_100027802 152
455 3300025893 Ga0207682_10004106 Ga0207682_100041063 152
456 3300025901 Ga0207688_10057032 Ga0207688_100570322 152
457 3300025904 Ga0207647_10002672 Ga0207647_100026724 152
458 3300025907 Ga0207645_10001560 Ga0207645_1000156017 152
459 3300025908 Ga0207643_10000639 Ga0207643_1000063914 152
460 3300025918 Ga0207662_10003901 Ga0207662_100039016 152
461 3300025919 Ga0207657_10001261 Ga0207657_1000126116 152
462 3300025923 Ga0207681_10640794 Ga0207681_106407941 152
463 3300025925 Ga0207650_10000177 Ga0207650_100001774 152
464 3300025925 Ga0207650_10040788 Ga0207650_100407883 152
465 3300025926 Ga0207659_10071638 Ga0207659_100716383 152
466 3300025927 Ga0207687_10049613 Ga0207687_100496134 152
467 3300025931 Ga0207644_10192432 Ga0207644_101924322 152
468 3300025932 Ga0207690_10745309 Ga0207690_107453092 152
469 3300025933 Ga0207706_10002495 Ga0207706_100024954 152
470 3300025936 Ga0207670_10011311 Ga0207670_100113115 152
471 3300025937 Ga0207669_10251467 Ga0207669_102514672 152
472 3300025939 Ga0207665_10218441 Ga0207665_102184412 152
473 3300025940 Ga0207691_10001447 Ga0207691_1000144710 152
474 3300025941 Ga0207711_10180516 Ga0207711_101805162 152
475 3300025942 Ga0207689_10002307 Ga0207689_100023073 152
476 3300025942 Ga0207689_10157922 Ga0207689_101579223 152
477 3300025944 Ga0207661_10016213 Ga0207661_100162134 152
478 3300025945 Ga0207679_10000143 Ga0207679_1000014345 152
479 3300025949 Ga0207667_10031734 Ga0207667_100317342 152
480 3300025960 Ga0207651_10043637 Ga0207651_100436374 152
481 3300025972 Ga0207668_10059933 Ga0207668_100599332 152
482 3300025981 Ga0207640_10232365 Ga0207640_102323652 152
483 3300025986 Ga0207658_10005160 Ga0207658_1000516012 152
484 3300026023 Ga0207677_10020934 Ga0207677_100209344 152
485 3300026041 Ga0207639_10017818 Ga0207639_100178185 152
486 3300026067 Ga0207678_10001668 Ga0207678_1000166817 152
487 3300026075 Ga0207708_10337425 Ga0207708_103374252 152
488 3300026078 Ga0207702_10071365 Ga0207702_100713654 152
489 3300026088 Ga0207641_10003028 Ga0207641_100030285 152
490 3300026088 Ga0207641_11375059 Ga0207641_113750592 152
491 3300026089 Ga0207648_10003457 Ga0207648_1000345718 152
492 3300026095 Ga0207676_10001159 Ga0207676_1000115914 152
493 3300026116 Ga0207674_10000195 Ga0207674_100001954 152
494 3300026121 Ga0207683_10003688 Ga0207683_100036886 152
495 3300028379 Ga0268266_10003235 Ga0268266_1000323516 152
496 3300028380 Ga0268265_10010967 Ga0268265_100109672 152
497 3300028381 Ga0268264_10112259 Ga0268264_101122592 152
498 3300039438 Ga0436360_0729932 Ga0436360_0729932_207_665 152
499 3300039447 Ga0436361_0068265 Ga0436361_0068265_11_469 152
500 3300039450 Ga0436363_0606919 Ga0436363_0606919_68_526 152
501 3300046684 Ga0495669_0597777 Ga0495669_0597777_58_516 152
502 3300048903 Ga0496100_0088097 Ga0496100_0088097_146_604 152
503 3300048905 Ga0496102_0212725 Ga0496102_0212725_1111_1569 152
504 3300048906 Ga0496103_0046092 Ga0496103_0046092_577_1035 152
505 3300048909 Ga0496106_0058178 Ga0496106_0058178_639_1097 152
506 3300048910 Ga0496107_0046578 Ga0496107_0046578_2028_2486 152
507 3300048911 Ga0496108_0000689 Ga0496108_0000689_2260_2718 152
508 3300048912 Ga0496109_0001300 Ga0496109_0001300_2449_2907 152
509 3300048913 Ga0496110_0043918 Ga0496110_0043918_79_537 152
510 3300048918 Ga0496115_0428869 Ga0496115_0428869_539_997 152
511 3300049583 Ga0501067_0327527 Ga0501067_0327527_86_604 152
512 3300050511 nmdc:mga08y16_814776_c1 nmdc:mga08y16_814776_c1_245_703 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

78

155

0.96

PF14539

DUF4442

Domain of unknown function (DUF4442)

44

163

0.87

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

71

162

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.963 28 144
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9607 26 142
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9568 24 146
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9568 26 143
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9562 25 144
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9618 26 143 3.10.129.10
af_Q9M2E4_49_183_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9577 34 144 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9517 24 142 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9404 25 144 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9312 26 143 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2D7HDP7-F1-model_v4 Thioesterase 0.9926 33 146 GO:0047617
AF-A0A1F7P700-F1-model_v4 Thioesterase domain-containing protein 0.9924 29 152 GO:0005829
GO:0061522
AF-A0A831Y662-F1-model_v4 PaaI family thioesterase 0.9871 23 152 GO:0005829
GO:0061522
AF-A0A7W0G0I7-F1-model_v4 PaaI family thioesterase 0.9868 35 144 GO:0047617
AF-A0A2V8WJJ9-F1-model_v4 PaaI family thioesterase 0.9845 25 152 GO:0005829
GO:0061522

Feature Viewer

pLDDT pTM Quality
93.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map