F457422

General Info

Members Datasets Scaffolds Average Seq Length
512 295 1024 250

Family's Representative Sequence

Representative Sequence 3300009979|Ga0105032_100154|Ga0105032_1001547
Length 297
Sequence LHFFVIPSAARDLLDAANIRSLAALGMTKKAAEQAPLYKAASTLQCRMAKTLLVTGATSGFGAAIARKFAAAGWNLVATGRRADRLRPLVDDFGADRVHAAAFDIRDADAMSQALTALPENFRGVDLLVNNAGLALGTAPAQRADLAQWRQMIDTNVTALAALTHALLPMLIERKGAIVNISSIAGNYPYAGGNVYGGTKAFVTQFTLGLRSDLHGTGVRVTSIEPGLAETEFTLVRTSGDQAASDKLYEGAQPIVADDIAEAVYWVAMLPPHLNINRLEVMPVSQSFAGFQIHRDA

Samples

Sample ID Description Type Environment
1 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
160 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
161 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
162 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
163 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
187 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
190 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
194 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
246 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
247 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
258 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
259 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
260 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
261 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
262 2643221695 Lysobacter sp. Root494 Isolate Unclassified
263 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
264 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
265 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
266 2818991457 Xanthomonas translucens 569 Isolate Unclassified
267 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
268 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
269 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
270 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
271 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
272 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
273 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
274 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
275 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
276 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
277 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
278 2919513703 Luteimonas sp. 3794 Isolate Unclassified
279 2919675420 Luteimonas terrae 4099 Isolate Unclassified
280 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
281 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
282 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
283 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
284 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
285 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
286 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
287 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
288 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
289 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
290 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
291 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
292 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
293 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
294 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
295 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.38
Metatranscriptomes 0
Isolates 7.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 7.23
Nodule 0.2
Rhizoplane 3.52
Rhizosphere 75.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105032_100154 3300009979 Bacteria 7375
2 JGI24741J21665_1000001 3300001915 Bacteria 68427
3 JGI24737J22298_10001332 3300001990 Bacteria 8752
4 JGI25152J39213_1000076 3300002773 Bacteria 66295
5 JGI25150J39212_1000382 3300002774 Bacteria 21228
6 JGI25151J46595_10000231 3300003187 Bacteria 66295
7 JGI25153J46596_10000166 3300003215 Bacteria 66295
8 Ga0055526_1006452 3300003771 Bacteria 6359
9 Ga0055537_1000299 3300003773 Bacteria 34588
10 Ga0055536_1002416 3300003781 Bacteria 10502
11 Ga0055534_1000322 3300003784 Bacteria 31844
12 Ga0055528_1000194 3300003790 Bacteria 51826
13 Ga0055530_10003189 3300003791 Bacteria 9617
14 Ga0058692_1000005 3300003856 Bacteria 398815
15 Ga0058692_1000021 3300003856 Bacteria 240308
16 Ga0065165_1038023 3300005262 Bacteria 1454
17 Ga0065704_10000840 3300005289 Bacteria 18236
18 Ga0070658_10017884 3300005327 Bacteria 5670
19 Ga0070658_10109839 3300005327 Bacteria 2283
20 Ga0070676_10207228 3300005328 Bacteria 1288
21 Ga0070683_100067720 3300005329 Bacteria 3325
22 Ga0070690_100000109 3300005330 Bacteria 42695
23 Ga0070690_100052722 3300005330 Bacteria 2601
24 Ga0068869_100014113 3300005334 Bacteria 5330
25 Ga0068869_100062640 3300005334 Bacteria 2730
26 Ga0068869_100240945 3300005334 Bacteria 1441
27 Ga0070666_10000297 3300005335 Bacteria 32302
28 Ga0070666_10036591 3300005335 Bacteria 3260
29 Ga0068868_100081769 3300005338 Bacteria 2590
30 Ga0068868_100136792 3300005338 Bacteria 2009
31 Ga0070689_100001907 3300005340 Bacteria 13473
32 Ga0070661_100025041 3300005344 Bacteria 4285
33 Ga0070661_100029336 3300005344 Bacteria 3970
34 Ga0070661_100037304 3300005344 Bacteria 3535
35 Ga0070661_100479267 3300005344 Bacteria 993
36 Ga0070692_10086405 3300005345 Bacteria 1697
37 Ga0070692_10283241 3300005345 Bacteria 1005
38 Ga0070668_100006208 3300005347 Bacteria 8851
39 Ga0070668_100282602 3300005347 Bacteria 1387
40 Ga0070669_100018521 3300005353 Bacteria 4976
41 Ga0070675_100236305 3300005354 Bacteria 1596
42 Ga0070671_100107405 3300005355 Bacteria 2343
43 Ga0070674_100052956 3300005356 Bacteria 2800
44 Ga0070673_100295658 3300005364 Bacteria 1424
45 Ga0070701_10000209 3300005438 Bacteria 18356
46 Ga0070705_100012137 3300005440 Bacteria 4370
47 Ga0070700_100001596 3300005441 Bacteria 11305
48 Ga0070700_100047934 3300005441 Bacteria 2646
49 Ga0070678_100010131 3300005456 Bacteria 5742
50 Ga0070678_100077054 3300005456 Bacteria 2514
51 Ga0070678_100221778 3300005456 Bacteria 1572
52 Ga0070678_100514202 3300005456 Bacteria 1058
53 Ga0070662_100235847 3300005457 Bacteria 1465
54 Ga0070681_10000015 3300005458 Bacteria 130427
55 Ga0070681_10009622 3300005458 Bacteria 9504
56 Ga0070681_10301522 3300005458 Bacteria 1512
57 Ga0070681_10365406 3300005458 Bacteria 1353
58 Ga0068867_100006989 3300005459 Bacteria 7975
59 Ga0068867_100097485 3300005459 Bacteria 2240
60 Ga0068867_100120634 3300005459 Bacteria 2026
61 Ga0068867_100251343 3300005459 Bacteria 1438
62 Ga0070684_100113058 3300005535 Bacteria 2436
63 Ga0068853_100158874 3300005539 Bacteria 2038
64 Ga0070686_100001022 3300005544 Bacteria 16090
65 Ga0070695_100157985 3300005545 Bacteria 1589
66 Ga0070695_100563874 3300005545 Bacteria 889
67 Ga0070693_100050083 3300005547 Bacteria 2386
68 Ga0070665_100034726 3300005548 Bacteria 5072
69 Ga0068855_100036522 3300005563 Bacteria 5847
70 Ga0068855_100368951 3300005563 Bacteria 1578
71 Ga0068855_100723436 3300005563 Bacteria 1063
72 Ga0068855_100764412 3300005563 Bacteria 1029
73 Ga0068857_100120067 3300005577 Bacteria 2366
74 Ga0068857_100391206 3300005577 Bacteria 1292
75 Ga0068854_100074161 3300005578 Bacteria 2495
76 Ga0068854_100096475 3300005578 Bacteria 2209
77 Ga0068856_100051401 3300005614 Bacteria 4063
78 Ga0070702_100012964 3300005615 Bacteria 4197
79 Ga0068852_100388952 3300005616 Bacteria 1369
80 Ga0068852_100930599 3300005616 Bacteria 887
81 Ga0068859_100008470 3300005617 Bacteria 10408
82 Ga0068859_100011782 3300005617 Bacteria 8786
83 Ga0068866_10000537 3300005718 Bacteria 17337
84 Ga0068866_10043360 3300005718 Bacteria 2245
85 Ga0068866_10044972 3300005718 Bacteria 2212
86 Ga0068861_100008944 3300005719 Bacteria 6902
87 Ga0068861_100460234 3300005719 Bacteria 1142
88 Ga0068851_10016192 3300005834 Bacteria 3564
89 Ga0068870_10023065 3300005840 Bacteria 3065
90 Ga0068870_10069578 3300005840 Bacteria 1915
91 Ga0068863_101083112 3300005841 Bacteria 806
92 Ga0068858_100009310 3300005842 Bacteria 9376
93 Ga0068858_100350741 3300005842 Bacteria 1413
94 Ga0068860_100020596 3300005843 Bacteria 6388
95 Ga0068860_100129728 3300005843 Bacteria 2418
96 Ga0068862_100118391 3300005844 Bacteria 2332
97 Ga0068862_100181332 3300005844 Bacteria 1890
98 Ga0081455_10119841 3300005937 Bacteria 2074
99 Ga0075364_10014924 3300006051 Bacteria 4809
100 Ga0075364_10041932 3300006051 Bacteria 2973
101 Ga0097621_100023997 3300006237 Bacteria 4756
102 Ga0097621_100024216 3300006237 Bacteria 4737
103 Ga0097621_100326425 3300006237 Bacteria 1360
104 Ga0068871_100010954 3300006358 Bacteria 6642
105 Ga0068871_100017302 3300006358 Bacteria 5451
106 Ga0097620_100008470 3300006931 Bacteria 10408
107 Ga0097620_100011781 3300006931 Bacteria 8786
108 Ga0105251_10000014 3300009011 Bacteria 150347
109 Ga0105251_10002449 3300009011 Bacteria 14578
110 Ga0105244_10052220 3300009036 Bacteria 2081
111 Ga0105240_10421334 3300009093 Bacteria 1500
112 Ga0105245_10002983 3300009098 Bacteria 15176
113 Ga0105245_10055216 3300009098 Bacteria 3567
114 Ga0105245_10067794 3300009098 Bacteria 3232
115 Ga0105245_10582462 3300009098 Bacteria 1144
116 Ga0105247_10357587 3300009101 Bacteria 1029
117 Ga0105243_10011499 3300009148 Bacteria 6697
118 Ga0105243_10019243 3300009148 Bacteria 5177
119 Ga0105243_10029402 3300009148 Bacteria 4225
120 Ga0105243_10189714 3300009148 Bacteria 1794
121 Ga0105243_10625998 3300009148 Bacteria 1039
122 Ga0105241_10004687 3300009174 Bacteria 10097
123 Ga0105241_10007453 3300009174 Bacteria 8054
124 Ga0105241_10119846 3300009174 Bacteria 2117
125 Ga0105242_10037106 3300009176 Bacteria 3913
126 Ga0105242_10282788 3300009176 Bacteria 1507
127 Ga0105242_10344270 3300009176 Bacteria 1375
128 Ga0105248_10022461 3300009177 Bacteria 6997
129 Ga0105237_10023633 3300009545 Bacteria 6295
130 Ga0105238_10001691 3300009551 Bacteria 22202
131 Ga0105249_10007100 3300009553 Bacteria 9779
132 Ga0105246_10047389 3300011119 Bacteria 2935
133 Ga0105246_10231921 3300011119 Bacteria 1454
134 Ga0105246_10280493 3300011119 Bacteria 1336
135 Ga0105246_10802529 3300011119 Bacteria 835
136 Ga0157343_1000302 3300012488 Bacteria 1896
137 Ga0157373_10011048 3300013100 Bacteria 6649
138 Ga0157373_10031226 3300013100 Bacteria 3834
139 Ga0157373_10096098 3300013100 Bacteria 2086
140 Ga0157373_10310400 3300013100 Bacteria 1121
141 Ga0157371_10000112 3300013102 Bacteria 122773
142 Ga0157371_10277119 3300013102 Bacteria 1211
143 Ga0157370_10030157 3300013104 Bacteria 5316
144 Ga0157370_10055265 3300013104 Bacteria 3782
145 Ga0157370_10144944 3300013104 Bacteria 2212
146 Ga0157369_10009495 3300013105 Bacteria 11122
147 Ga0157369_10029418 3300013105 Bacteria 6070
148 Ga0157369_10046167 3300013105 Bacteria 4735
149 Ga0157374_10441917 3300013296 Bacteria 1301
150 Ga0157378_10001061 3300013297 Bacteria 25145
151 Ga0157378_10043775 3300013297 Bacteria 3974
152 Ga0157378_10107171 3300013297 Bacteria 2557
153 Ga0157378_10364356 3300013297 Bacteria 1415
154 Ga0157372_10036550 3300013307 Bacteria 5413
155 Ga0157372_10563338 3300013307 Bacteria 1328
156 Ga0157375_10101354 3300013308 Bacteria 2962
157 Ga0157375_10115853 3300013308 Bacteria 2783
158 Ga0157375_10274252 3300013308 Bacteria 1849
159 Ga0163163_10001061 3300014325 Bacteria 23332
160 Ga0157380_10011574 3300014326 Bacteria 6376
161 Ga0157380_10332067 3300014326 Bacteria 1414
162 Ga0182008_10000102 3300014497 Bacteria 65960
163 Ga0157379_10017217 3300014968 Bacteria 6366
164 Ga0157379_10838153 3300014968 Bacteria 869
165 Ga0182007_10000078 3300015262 Bacteria 74593
166 Ga0182005_1000186 3300015265 Bacteria 42690
167 Ga0163161_10007101 3300017792 Bacteria 7742
168 Ga0163161_10224764 3300017792 Bacteria 1455
169 Ga0207425_1000029 3300025245 Bacteria 268521
170 Ga0209129_1000216 3300025258 Bacteria 66352
171 Ga0209565_1000071 3300025263 Bacteria 166213
172 Ga0209673_1000425 3300025273 Bacteria 73588
173 Ga0209130_1028808 3300025284 Bacteria 1163
174 Ga0209675_1000018 3300025291 Bacteria 377481
175 Ga0209676_1000185 3300025292 Bacteria 142505
176 Ga0209676_1000248 3300025292 Bacteria 115456
177 Ga0209025_1000076 3300025294 Bacteria 273934
178 Ga0209564_1000148 3300025295 Bacteria 172177
179 Ga0209758_1000473 3300025297 Bacteria 66352
180 Ga0209050_1000182 3300025298 Bacteria 142435
181 Ga0209050_1014148 3300025298 Bacteria 3466
182 Ga0209256_1002766 3300025299 Bacteria 13524
183 Ga0209256_1008863 3300025299 Bacteria 4548
184 Ga0209051_1001212 3300025303 Bacteria 23226
185 Ga0209257_1000348 3300025304 Bacteria 95101
186 Ga0209257_1000470 3300025304 Bacteria 73603
187 Ga0209257_1001784 3300025304 Bacteria 23701
188 Ga0207656_10003831 3300025321 Bacteria 5211
189 Ga0207655_1034063 3300025728 Bacteria 2295
190 Ga0207655_1047726 3300025728 Bacteria 1764
191 Ga0207713_1000290 3300025735 Bacteria 58238
192 Ga0207713_1006727 3300025735 Bacteria 6946
193 Ga0207642_10001223 3300025899 Bacteria 7944
194 Ga0207642_10080178 3300025899 Bacteria 1583
195 Ga0207642_10099005 3300025899 Bacteria 1459
196 Ga0207680_10004322 3300025903 Bacteria 6735
197 Ga0207647_10002228 3300025904 Bacteria 14768
198 Ga0207647_10029892 3300025904 Bacteria 3520
199 Ga0207643_10036518 3300025908 Bacteria 2756
200 Ga0207643_10278492 3300025908 Bacteria 1037
201 Ga0207705_10422791 3300025909 Bacteria 1032
202 Ga0207707_10001005 3300025912 Bacteria 27031
203 Ga0207707_10251583 3300025912 Bacteria 1535
204 Ga0207695_10004315 3300025913 Bacteria 19489
205 Ga0207671_10001967 3300025914 Bacteria 22671
206 Ga0207671_10018273 3300025914 Bacteria 5383
207 Ga0207671_10170952 3300025914 Bacteria 1688
208 Ga0207657_10003419 3300025919 Bacteria 16946
209 Ga0207649_10007992 3300025920 Bacteria 5754
210 Ga0207649_10128516 3300025920 Bacteria 1718
211 Ga0207652_10446161 3300025921 Bacteria 1166
212 Ga0207681_10001471 3300025923 Bacteria 15187
213 Ga0207681_10116015 3300025923 Bacteria 1956
214 Ga0207694_10014676 3300025924 Bacteria 5905
215 Ga0207650_10006093 3300025925 Bacteria 8222
216 Ga0207650_10182127 3300025925 Bacteria 1674
217 Ga0207687_10004941 3300025927 Bacteria 8849
218 Ga0207687_10258432 3300025927 Bacteria 1387
219 Ga0207687_10388261 3300025927 Bacteria 1145
220 Ga0207690_10406472 3300025932 Bacteria 1087
221 Ga0207706_10026771 3300025933 Bacteria 5162
222 Ga0207686_10006687 3300025934 Bacteria 6214
223 Ga0207686_10046931 3300025934 Bacteria 2668
224 Ga0207709_10001022 3300025935 Bacteria 20703
225 Ga0207709_10016800 3300025935 Bacteria 4076
226 Ga0207709_10028786 3300025935 Bacteria 3215
227 Ga0207709_10223253 3300025935 Bacteria 1360
228 Ga0207670_10003286 3300025936 Bacteria 8565
229 Ga0207669_10107209 3300025937 Bacteria 1863
230 Ga0207704_10008119 3300025938 Bacteria 4998
231 Ga0207704_10064760 3300025938 Bacteria 2285
232 Ga0207704_10137356 3300025938 Bacteria 1704
233 Ga0207691_10470464 3300025940 Bacteria 1069
234 Ga0207711_10092278 3300025941 Bacteria 2665
235 Ga0207689_10002393 3300025942 Bacteria 17493
236 Ga0207689_10010830 3300025942 Bacteria 7844
237 Ga0207689_10142935 3300025942 Bacteria 1971
238 Ga0207689_10284290 3300025942 Bacteria 1370
239 Ga0207661_10367378 3300025944 Bacteria 1300
240 Ga0207667_10017509 3300025949 Bacteria 8063
241 Ga0207667_10032671 3300025949 Bacteria 5604
242 Ga0207712_10051380 3300025961 Bacteria 2882
243 Ga0207712_10543942 3300025961 Bacteria 998
244 Ga0207668_10002592 3300025972 Bacteria 10569
245 Ga0207668_10067661 3300025972 Bacteria 2536
246 Ga0207668_10275387 3300025972 Bacteria 1378
247 Ga0207668_10473548 3300025972 Bacteria 1073
248 Ga0207640_10080993 3300025981 Bacteria 2218
249 Ga0207640_10281416 3300025981 Bacteria 1307
250 Ga0207640_10694720 3300025981 Bacteria 871
251 Ga0207677_10016086 3300026023 Bacteria 4421
252 Ga0207677_10210065 3300026023 Bacteria 1554
253 Ga0207703_10004164 3300026035 Bacteria 11927
254 Ga0207639_10019190 3300026041 Bacteria 4872
255 Ga0207639_10120142 3300026041 Bacteria 2158
256 Ga0207678_10000007 3300026067 Bacteria 179943
257 Ga0207678_10419940 3300026067 Bacteria 1160
258 Ga0207708_10001483 3300026075 Bacteria 17511
259 Ga0207708_10057623 3300026075 Bacteria 2964
260 Ga0207702_10006883 3300026078 Bacteria 9744
261 Ga0207702_10388114 3300026078 Bacteria 1344
262 Ga0207641_10572008 3300026088 Bacteria 1104
263 Ga0207648_10002714 3300026089 Bacteria 18812
264 Ga0207648_10045147 3300026089 Bacteria 3865
265 Ga0207676_10167727 3300026095 Bacteria 1910
266 Ga0207674_10004934 3300026116 Bacteria 15934
267 Ga0207674_10022736 3300026116 Bacteria 6727
268 Ga0207674_10156088 3300026116 Bacteria 2237
269 Ga0207675_100004700 3300026118 Bacteria 13141
270 Ga0207683_10033672 3300026121 Bacteria 4451
271 Ga0207683_10090986 3300026121 Bacteria 2718
272 Ga0207683_10155248 3300026121 Bacteria 2067
273 Ga0207683_10860514 3300026121 Bacteria 842
274 Ga0207698_10062456 3300026142 Bacteria 2909
275 Ga0209371_1000031 3300027312 Bacteria 399263
276 Ga0209371_1000045 3300027312 Bacteria 316174
277 Ga0268266_10055548 3300028379 Bacteria 3404
278 Ga0268266_10174272 3300028379 Bacteria 1954
279 Ga0268265_10046430 3300028380 Bacteria 3247
280 Ga0268265_10196856 3300028380 Bacteria 1745
281 Ga0268265_10262956 3300028380 Bacteria 1535
282 Ga0268264_10040762 3300028381 Bacteria 3837
283 Ga0268264_10141345 3300028381 Bacteria 2147
284 Ga0268264_10295572 3300028381 Bacteria 1523
285 Ga0268256_1000034 3300030500 Bacteria 398909
286 Ga0268256_1000047 3300030500 Bacteria 316174
287 Ga0316176_1143235 3300030732 Bacteria 1581
288 Ga0316178_1155819 3300030735 Bacteria 1463
289 Ga0316183_1066654 3300030742 Bacteria 6239
290 Ga0316181_1011986 3300030744 Bacteria 2355
291 Ga0316182_1063845 3300030745 Bacteria 1456
292 Ga0316182_1175214 3300030745 Bacteria 1423
293 Ga0307408_100076007 3300031548 Bacteria 2497
294 Ga0307408_100187420 3300031548 Bacteria 1664
295 Ga0307408_100332144 3300031548 Bacteria 1284
296 Ga0307405_10000196 3300031731 Bacteria 22239
297 Ga0307405_10057441 3300031731 Bacteria 2444
298 Ga0307405_10110444 3300031731 Bacteria 1862
299 Ga0307405_10136127 3300031731 Bacteria 1705
300 Ga0307405_10188707 3300031731 Bacteria 1487
301 Ga0307413_10290003 3300031824 Bacteria 1235
302 Ga0307410_10096462 3300031852 Bacteria 2110
303 Ga0307410_10115276 3300031852 Bacteria 1951
304 Ga0307410_10226510 3300031852 Bacteria 1441
305 Ga0307410_10521976 3300031852 Bacteria 980
306 Ga0307406_10141114 3300031901 Bacteria 1705
307 Ga0307406_10262616 3300031901 Bacteria 1307
308 Ga0307406_10333422 3300031901 Bacteria 1178
309 Ga0307412_10001898 3300031911 Bacteria 11556
310 Ga0307412_10070531 3300031911 Bacteria 2382
311 Ga0307412_10198609 3300031911 Bacteria 1521
312 Ga0307412_10609993 3300031911 Bacteria 925
313 Ga0307416_100110125 3300032002 Bacteria 2424
314 Ga0307416_100589980 3300032002 Bacteria 1189
315 Ga0307414_10001907 3300032004 Bacteria 10787
316 Ga0307414_10028099 3300032004 Bacteria 3644
317 Ga0307414_10157039 3300032004 Bacteria 1802
318 Ga0307414_10310403 3300032004 Bacteria 1338
319 Ga0307414_10612899 3300032004 Bacteria 977
320 Ga0307414_10653224 3300032004 Bacteria 948
321 Ga0307411_10058583 3300032005 Bacteria 2549
322 Ga0307411_10126530 3300032005 Bacteria 1859
323 Ga0307411_10313648 3300032005 Bacteria 1263
324 Ga0307411_10316510 3300032005 Bacteria 1258
325 Ga0307415_100775132 3300032126 Bacteria 873
326 Ga0373953_0179910 3300035117 Bacteria 912
327 Ga0373937_0322350 3300036401 Bacteria 1462
328 Ga0395899_0035327 3300037312 Bacteria 3752
329 Ga0395899_0116114 3300037312 Bacteria 1920
330 Ga0395899_0142331 3300037312 Bacteria 1705
331 Ga0395899_0157142 3300037312 Bacteria 1608
332 Ga0395900_0000013 3300037418 Bacteria 388765
333 Ga0395900_0000145 3300037418 Bacteria 119964
334 Ga0395900_0002553 3300037418 Bacteria 19958
335 Ga0395900_0008745 3300037418 Bacteria 10402
336 Ga0395900_0024458 3300037418 Bacteria 6185
337 Ga0395898_0049009 3300037466 Bacteria 4140
338 Ga0395898_0086310 3300037466 Bacteria 3024
339 Ga0395901_0002732 3300038443 Bacteria 17799
340 Ga0395901_0127315 3300038443 Bacteria 2676
341 Ga0237819_01020 3300038705 Bacteria 8403
342 Ga0237819_01284 3300038705 Bacteria 6821
343 Ga0439436_0025748 3300041404 Bacteria 1727
344 Ga0439436_0030349 3300041404 Bacteria 1571
345 Ga0439465_0002560 3300041413 Bacteria 5919
346 Ga0439465_0056392 3300041413 Bacteria 1295
347 Ga0451793_1776040 3300041452 Bacteria 4905
348 Ga0451797_1277088 3300041453 Bacteria 2123
349 Ga0451800_0074932 3300041459 Bacteria 3557
350 Ga0451806_098287 3300041462 Bacteria 3502
351 Ga0451807_1324676 3300041486 Bacteria 2904
352 Ga0451841_0860167 3300041498 Bacteria 1052
353 Ga0439433_0050270 3300041999 Bacteria 982
354 Ga0439432_025102 3300042006 Bacteria 1956
355 Ga0439432_033643 3300042006 Bacteria 1648
356 Ga0439432_055536 3300042006 Bacteria 1228
357 Ga0439449_0007251 3300042007 Bacteria 4215
358 Ga0439449_0026711 3300042007 Bacteria 2154
359 Ga0439452_033814 3300042010 Bacteria 1239
360 Ga0450911_000911 3300042115 Bacteria 7867
361 Ga0450898_032310 3300042134 Bacteria 965
362 Ga0451576_0955277 3300045051 Bacteria 899
363 Ga0495627_068971 3300046453 Bacteria 1035
364 Ga0495638_0000231 3300046460 Bacteria 76477
365 Ga0495638_0002988 3300046460 Bacteria 13495
366 Ga0495610_0000242 3300046512 Bacteria 57692
367 Ga0495616_0034254 3300046513 Bacteria 2639
368 Ga0495631_0000388 3300046518 Bacteria 30331
369 Ga0495643_0000701 3300046522 Bacteria 38480
370 Ga0495663_0002206 3300046525 Bacteria 5924
371 Ga0495663_0002423 3300046525 Bacteria 5605
372 Ga0495663_0002861 3300046525 Bacteria 5100
373 Ga0495663_0019103 3300046525 Bacteria 1957
374 Ga0495633_0004230 3300046558 Bacteria 9192
375 Ga0495633_0008474 3300046558 Bacteria 5782
376 Ga0495656_0010476 3300046615 Bacteria 3373
377 Ga0495656_0203624 3300046615 Bacteria 983
378 Ga0495625_0017513 3300046660 Bacteria 5609
379 Ga0495625_0062819 3300046660 Bacteria 2623
380 Ga0495670_0173901 3300046691 Bacteria 1135
381 Ga0495660_0002288 3300046810 Bacteria 12311
382 Ga0495636_0017724 3300047318 Bacteria 2852
383 Ga0495636_0028967 3300047318 Bacteria 2259
384 Ga0495636_0091527 3300047318 Bacteria 1320
385 Ga0495672_0000092 3300047320 Bacteria 146431
386 Ga0495681_0015813 3300047470 Bacteria 4258
387 Ga0495686_0002273 3300047472 Bacteria 18497
388 Ga0495686_0002438 3300047472 Bacteria 17562
389 Ga0495686_0041262 3300047472 Bacteria 2938
390 Ga0496100_0221714 3300048903 Bacteria 1388
391 Ga0496101_0222010 3300048904 Bacteria 1467
392 Ga0496102_0353751 3300048905 Bacteria 1383
393 Ga0496103_0124396 3300048906 Bacteria 1644
394 Ga0496104_0400530 3300048907 Bacteria 1285
395 Ga0496106_0139794 3300048909 Bacteria 1904
396 Ga0496108_0262150 3300048911 Bacteria 1504
397 Ga0496109_0398342 3300048912 Bacteria 1300
398 Ga0496110_0082094 3300048913 Bacteria 2874
399 Ga0496110_0107203 3300048913 Bacteria 2508
400 Ga0496110_0195155 3300048913 Bacteria 1838
401 Ga0496111_0395516 3300048914 Bacteria 1021
402 Ga0496114_0107509 3300048917 Bacteria 2387
403 Ga0496116_0002397 3300048919 Bacteria 19749
404 Ga0496116_0042464 3300048919 Bacteria 3107
405 Ga0496116_0050142 3300048919 Bacteria 2783
406 Ga0496117_0000299 3300048920 Bacteria 87312
407 Ga0496117_0001192 3300048920 Bacteria 39109
408 Ga0496117_0002348 3300048920 Bacteria 24193
409 Ga0496117_0005810 3300048920 Bacteria 12782
410 Ga0496118_0000213 3300048921 Bacteria 101146
411 Ga0496118_0000288 3300048921 Bacteria 87720
412 Ga0496118_0002180 3300048921 Bacteria 27253
413 Ga0496118_0004071 3300048921 Bacteria 17729
414 Ga0496118_0035283 3300048921 Bacteria 4064
415 Ga0496118_0074823 3300048921 Bacteria 2418
416 Ga0496119_0000176 3300048922 Bacteria 89501
417 Ga0496119_0001471 3300048922 Bacteria 28191
418 Ga0496120_0000277 3300048923 Bacteria 85951
419 Ga0496120_0000786 3300048923 Bacteria 45817
420 Ga0496121_0027464 3300048924 Bacteria 5326
421 Ga0496122_0000144 3300048925 Bacteria 166503
422 Ga0496122_0003749 3300048925 Bacteria 19606
423 Ga0496122_0011030 3300048925 Bacteria 9229
424 Ga0496122_0013288 3300048925 Bacteria 8069
425 Ga0496122_0043726 3300048925 Bacteria 3505
426 Ga0496122_0231996 3300048925 Bacteria 1048
427 Ga0496123_0000665 3300048926 Bacteria 56849
428 Ga0496123_0001387 3300048926 Bacteria 33973
429 Ga0496123_0012023 3300048926 Bacteria 7423
430 Ga0496123_0027927 3300048926 Bacteria 4189
431 Ga0496123_0038075 3300048926 Bacteria 3386
432 Ga0496124_0001413 3300048927 Bacteria 35745
433 Ga0496124_0001960 3300048927 Bacteria 28118
434 Ga0496124_0008273 3300048927 Bacteria 10904
435 Ga0496124_0010318 3300048927 Bacteria 9478
436 Ga0496124_0021680 3300048927 Bacteria 5916
437 Ga0496124_0379750 3300048927 Bacteria 988
438 Ga0496125_0001174 3300048928 Bacteria 39666
439 Ga0496125_0005412 3300048928 Bacteria 14220
440 Ga0496125_0008625 3300048928 Bacteria 10635
441 Ga0496125_0014265 3300048928 Bacteria 7743
442 Ga0496125_0030656 3300048928 Bacteria 4807
443 Ga0496126_0003774 3300048929 Bacteria 18815
444 Ga0496126_0017061 3300048929 Bacteria 7242
445 Ga0496126_0071492 3300048929 Bacteria 3088
446 Ga0496126_0120417 3300048929 Bacteria 2277
447 Ga0496126_0149327 3300048929 Bacteria 2004
448 Ga0501290_000459 3300049513 Bacteria 6356
449 Ga0501031_0267848 3300049568 Bacteria 1109
450 Ga0501033_0001420 3300049570 Bacteria 21266
451 Ga0501034_0000798 3300049571 Bacteria 46906
452 Ga0501034_0069350 3300049571 Bacteria 3536
453 Ga0501036_0024194 3300049572 Bacteria 5119
454 Ga0501047_0017152 3300049581 Bacteria 6928
455 Ga0501067_0180806 3300049583 Bacteria 1175
456 Ga0501068_0065651 3300049584 Bacteria 2209
457 Ga0501069_0097752 3300049585 Bacteria 1665
458 Ga0501073_0021409 3300049589 Bacteria 4661
459 Ga0501198_024688 3300049649 Bacteria 974
460 Ga0501223_033188 3300049663 Bacteria 1003
461 Ga0501239_002396 3300049672 Bacteria 1699
462 Ga0501080_0162705 3300049742 Bacteria 2060
463 Ga0501083_0073088 3300049744 Bacteria 2279
464 Ga0501275_000083 3300049772 Bacteria 9555
465 Ga0501035_0145848 3300049822 Bacteria 2056
466 Ga0501044_0050447 3300049823 Bacteria 4293
467 nmdc:mga00v17_121158_c1 3300050491 Bacteria 1665
468 nmdc:mga00v17_124560_c1 3300050491 Bacteria 1644
469 nmdc:mga00v17_50229_c1 3300050491 Bacteria 2533
470 nmdc:mga00v17_54872_c1 3300050491 Bacteria 2432
471 Ga0500565_011006 3300053734 Bacteria 934
472 Ga0501084_0252938 3300054114 Bacteria 1487
473 Ga0501082_0140177 3300060353 Bacteria 2099
474 2547501552 2547132130 Bacteria 4660562
475 2572255759 2571042365 Bacteria 3289345
476 2578459996 2576861471 Bacteria 4648976
477 2643906525 2643221579 Bacteria 4443405
478 2643913967 2643221581 Bacteria 3893603
479 2644530863 2643221695 Bacteria 3441323
480 2747950174 2747842428 Bacteria 4689383
481 2765577270 2765235840 Bacteria 4663337
482 2816519911 2816332141 Bacteria 4436036
483 2819663221 2818991457 Bacteria 5323295
484 2842394664 2842391507 Bacteria 4486072
485 2842760825 2842757796 Bacteria 3981385
486 2848699909 2848694841 Bacteria 9205737
487 2852652564 2852649853 Bacteria 4036942
488 2852689215 2852684882 Bacteria 5463342
489 2857445584 2857442823 Bacteria 4562550
490 2874223816 2874220319 Bacteria 4594709
491 2894417583 2894414249 Bacteria 4405451
492 2919090262 2919089067 Bacteria 4560942
493 2919133050 2919130084 Bacteria 5301837
494 2919138416 2919134579 Bacteria 4480386
495 2919514031 2919513703 Bacteria 3844312
496 2919676194 2919675420 Bacteria 3969095
497 2923516434 2923516293 Bacteria 3716336
498 2928498213 2928496128 Bacteria 4631123
499 2929195900 2929195423 Bacteria 5325372
500 2939593078 2939589442 Bacteria 4214238
501 2939626223 2939622612 Bacteria 4698046
502 2939627840 2939626828 Bacteria 4695272
503 2941479641 2941475908 Bacteria 4145589
504 2961050580 2961047084 Bacteria 4594415
505 2961065745 2961064222 Bacteria 4749990
506 2974310429 2974307012 Bacteria 4172388
507 2977251162 2977247770 Bacteria 4160543
508 2984518197 2984514374 Bacteria 4172479
509 2987605780 2987605356 Bacteria 4187822
510 8021623168 8021622325 Bacteria 4844743
511 8021629736 8021626552 Bacteria 4665214
512 8021648989 8021648035 Bacteria 4772378
513 Ga0105032_100154
514 JGI24741J21665_1000001
515 JGI24737J22298_10001332
516 JGI25152J39213_1000076
517 JGI25150J39212_1000382
518 JGI25151J46595_10000231
519 JGI25153J46596_10000166
520 Ga0055526_1006452
521 Ga0055537_1000299
522 Ga0055536_1002416
523 Ga0055534_1000322
524 Ga0055528_1000194
525 Ga0055530_10003189
526 Ga0058692_1000005
527 Ga0058692_1000021
528 Ga0065165_1038023
529 Ga0065704_10000840
530 Ga0070658_10017884
531 Ga0070658_10109839
532 Ga0070676_10207228
533 Ga0070683_100067720
534 Ga0070690_100000109
535 Ga0070690_100052722
536 Ga0068869_100014113
537 Ga0068869_100062640
538 Ga0068869_100240945
539 Ga0070666_10000297
540 Ga0070666_10036591
541 Ga0068868_100081769
542 Ga0068868_100136792
543 Ga0070689_100001907
544 Ga0070661_100025041
545 Ga0070661_100029336
546 Ga0070661_100037304
547 Ga0070661_100479267
548 Ga0070692_10086405
549 Ga0070692_10283241
550 Ga0070668_100006208
551 Ga0070668_100282602
552 Ga0070669_100018521
553 Ga0070675_100236305
554 Ga0070671_100107405
555 Ga0070674_100052956
556 Ga0070673_100295658
557 Ga0070701_10000209
558 Ga0070705_100012137
559 Ga0070700_100001596
560 Ga0070700_100047934
561 Ga0070678_100010131
562 Ga0070678_100077054
563 Ga0070678_100221778
564 Ga0070678_100514202
565 Ga0070662_100235847
566 Ga0070681_10000015
567 Ga0070681_10009622
568 Ga0070681_10301522
569 Ga0070681_10365406
570 Ga0068867_100006989
571 Ga0068867_100097485
572 Ga0068867_100120634
573 Ga0068867_100251343
574 Ga0070684_100113058
575 Ga0068853_100158874
576 Ga0070686_100001022
577 Ga0070695_100157985
578 Ga0070695_100563874
579 Ga0070693_100050083
580 Ga0070665_100034726
581 Ga0068855_100036522
582 Ga0068855_100368951
583 Ga0068855_100723436
584 Ga0068855_100764412
585 Ga0068857_100120067
586 Ga0068857_100391206
587 Ga0068854_100074161
588 Ga0068854_100096475
589 Ga0068856_100051401
590 Ga0070702_100012964
591 Ga0068852_100388952
592 Ga0068852_100930599
593 Ga0068859_100008470
594 Ga0068859_100011782
595 Ga0068866_10000537
596 Ga0068866_10043360
597 Ga0068866_10044972
598 Ga0068861_100008944
599 Ga0068861_100460234
600 Ga0068851_10016192
601 Ga0068870_10023065
602 Ga0068870_10069578
603 Ga0068863_101083112
604 Ga0068858_100009310
605 Ga0068858_100350741
606 Ga0068860_100020596
607 Ga0068860_100129728
608 Ga0068862_100118391
609 Ga0068862_100181332
610 Ga0081455_10119841
611 Ga0075364_10014924
612 Ga0075364_10041932
613 Ga0097621_100023997
614 Ga0097621_100024216
615 Ga0097621_100326425
616 Ga0068871_100010954
617 Ga0068871_100017302
618 Ga0097620_100008470
619 Ga0097620_100011781
620 Ga0105251_10000014
621 Ga0105251_10002449
622 Ga0105244_10052220
623 Ga0105240_10421334
624 Ga0105245_10002983
625 Ga0105245_10055216
626 Ga0105245_10067794
627 Ga0105245_10582462
628 Ga0105247_10357587
629 Ga0105243_10011499
630 Ga0105243_10019243
631 Ga0105243_10029402
632 Ga0105243_10189714
633 Ga0105243_10625998
634 Ga0105241_10004687
635 Ga0105241_10007453
636 Ga0105241_10119846
637 Ga0105242_10037106
638 Ga0105242_10282788
639 Ga0105242_10344270
640 Ga0105248_10022461
641 Ga0105237_10023633
642 Ga0105238_10001691
643 Ga0105249_10007100
644 Ga0105246_10047389
645 Ga0105246_10231921
646 Ga0105246_10280493
647 Ga0105246_10802529
648 Ga0157343_1000302
649 Ga0157373_10011048
650 Ga0157373_10031226
651 Ga0157373_10096098
652 Ga0157373_10310400
653 Ga0157371_10000112
654 Ga0157371_10277119
655 Ga0157370_10030157
656 Ga0157370_10055265
657 Ga0157370_10144944
658 Ga0157369_10009495
659 Ga0157369_10029418
660 Ga0157369_10046167
661 Ga0157374_10441917
662 Ga0157378_10001061
663 Ga0157378_10043775
664 Ga0157378_10107171
665 Ga0157378_10364356
666 Ga0157372_10036550
667 Ga0157372_10563338
668 Ga0157375_10101354
669 Ga0157375_10115853
670 Ga0157375_10274252
671 Ga0163163_10001061
672 Ga0157380_10011574
673 Ga0157380_10332067
674 Ga0182008_10000102
675 Ga0157379_10017217
676 Ga0157379_10838153
677 Ga0182007_10000078
678 Ga0182005_1000186
679 Ga0163161_10007101
680 Ga0163161_10224764
681 Ga0207425_1000029
682 Ga0209129_1000216
683 Ga0209565_1000071
684 Ga0209673_1000425
685 Ga0209130_1028808
686 Ga0209675_1000018
687 Ga0209676_1000185
688 Ga0209676_1000248
689 Ga0209025_1000076
690 Ga0209564_1000148
691 Ga0209758_1000473
692 Ga0209050_1000182
693 Ga0209050_1014148
694 Ga0209256_1002766
695 Ga0209256_1008863
696 Ga0209051_1001212
697 Ga0209257_1000348
698 Ga0209257_1000470
699 Ga0209257_1001784
700 Ga0207656_10003831
701 Ga0207655_1034063
702 Ga0207655_1047726
703 Ga0207713_1000290
704 Ga0207713_1006727
705 Ga0207642_10001223
706 Ga0207642_10080178
707 Ga0207642_10099005
708 Ga0207680_10004322
709 Ga0207647_10002228
710 Ga0207647_10029892
711 Ga0207643_10036518
712 Ga0207643_10278492
713 Ga0207705_10422791
714 Ga0207707_10001005
715 Ga0207707_10251583
716 Ga0207695_10004315
717 Ga0207671_10001967
718 Ga0207671_10018273
719 Ga0207671_10170952
720 Ga0207657_10003419
721 Ga0207649_10007992
722 Ga0207649_10128516
723 Ga0207652_10446161
724 Ga0207681_10001471
725 Ga0207681_10116015
726 Ga0207694_10014676
727 Ga0207650_10006093
728 Ga0207650_10182127
729 Ga0207687_10004941
730 Ga0207687_10258432
731 Ga0207687_10388261
732 Ga0207690_10406472
733 Ga0207706_10026771
734 Ga0207686_10006687
735 Ga0207686_10046931
736 Ga0207709_10001022
737 Ga0207709_10016800
738 Ga0207709_10028786
739 Ga0207709_10223253
740 Ga0207670_10003286
741 Ga0207669_10107209
742 Ga0207704_10008119
743 Ga0207704_10064760
744 Ga0207704_10137356
745 Ga0207691_10470464
746 Ga0207711_10092278
747 Ga0207689_10002393
748 Ga0207689_10010830
749 Ga0207689_10142935
750 Ga0207689_10284290
751 Ga0207661_10367378
752 Ga0207667_10017509
753 Ga0207667_10032671
754 Ga0207712_10051380
755 Ga0207712_10543942
756 Ga0207668_10002592
757 Ga0207668_10067661
758 Ga0207668_10275387
759 Ga0207668_10473548
760 Ga0207640_10080993
761 Ga0207640_10281416
762 Ga0207640_10694720
763 Ga0207677_10016086
764 Ga0207677_10210065
765 Ga0207703_10004164
766 Ga0207639_10019190
767 Ga0207639_10120142
768 Ga0207678_10000007
769 Ga0207678_10419940
770 Ga0207708_10001483
771 Ga0207708_10057623
772 Ga0207702_10006883
773 Ga0207702_10388114
774 Ga0207641_10572008
775 Ga0207648_10002714
776 Ga0207648_10045147
777 Ga0207676_10167727
778 Ga0207674_10004934
779 Ga0207674_10022736
780 Ga0207674_10156088
781 Ga0207675_100004700
782 Ga0207683_10033672
783 Ga0207683_10090986
784 Ga0207683_10155248
785 Ga0207683_10860514
786 Ga0207698_10062456
787 Ga0209371_1000031
788 Ga0209371_1000045
789 Ga0268266_10055548
790 Ga0268266_10174272
791 Ga0268265_10046430
792 Ga0268265_10196856
793 Ga0268265_10262956
794 Ga0268264_10040762
795 Ga0268264_10141345
796 Ga0268264_10295572
797 Ga0268256_1000034
798 Ga0268256_1000047
799 Ga0316176_1143235
800 Ga0316178_1155819
801 Ga0316183_1066654
802 Ga0316181_1011986
803 Ga0316182_1063845
804 Ga0316182_1175214
805 Ga0307408_100076007
806 Ga0307408_100187420
807 Ga0307408_100332144
808 Ga0307405_10000196
809 Ga0307405_10057441
810 Ga0307405_10110444
811 Ga0307405_10136127
812 Ga0307405_10188707
813 Ga0307413_10290003
814 Ga0307410_10096462
815 Ga0307410_10115276
816 Ga0307410_10226510
817 Ga0307410_10521976
818 Ga0307406_10141114
819 Ga0307406_10262616
820 Ga0307406_10333422
821 Ga0307412_10001898
822 Ga0307412_10070531
823 Ga0307412_10198609
824 Ga0307412_10609993
825 Ga0307416_100110125
826 Ga0307416_100589980
827 Ga0307414_10001907
828 Ga0307414_10028099
829 Ga0307414_10157039
830 Ga0307414_10310403
831 Ga0307414_10612899
832 Ga0307414_10653224
833 Ga0307411_10058583
834 Ga0307411_10126530
835 Ga0307411_10313648
836 Ga0307411_10316510
837 Ga0307415_100775132
838 Ga0373953_0179910
839 Ga0373937_0322350
840 Ga0395899_0035327
841 Ga0395899_0116114
842 Ga0395899_0142331
843 Ga0395899_0157142
844 Ga0395900_0000013
845 Ga0395900_0000145
846 Ga0395900_0002553
847 Ga0395900_0008745
848 Ga0395900_0024458
849 Ga0395898_0049009
850 Ga0395898_0086310
851 Ga0395901_0002732
852 Ga0395901_0127315
853 Ga0237819_01020
854 Ga0237819_01284
855 Ga0439436_0025748
856 Ga0439436_0030349
857 Ga0439465_0002560
858 Ga0439465_0056392
859 Ga0451793_1776040
860 Ga0451797_1277088
861 Ga0451800_0074932
862 Ga0451806_098287
863 Ga0451807_1324676
864 Ga0451841_0860167
865 Ga0439433_0050270
866 Ga0439432_025102
867 Ga0439432_033643
868 Ga0439432_055536
869 Ga0439449_0007251
870 Ga0439449_0026711
871 Ga0439452_033814
872 Ga0450911_000911
873 Ga0450898_032310
874 Ga0451576_0955277
875 Ga0495627_068971
876 Ga0495638_0000231
877 Ga0495638_0002988
878 Ga0495610_0000242
879 Ga0495616_0034254
880 Ga0495631_0000388
881 Ga0495643_0000701
882 Ga0495663_0002206
883 Ga0495663_0002423
884 Ga0495663_0002861
885 Ga0495663_0019103
886 Ga0495633_0004230
887 Ga0495633_0008474
888 Ga0495656_0010476
889 Ga0495656_0203624
890 Ga0495625_0017513
891 Ga0495625_0062819
892 Ga0495670_0173901
893 Ga0495660_0002288
894 Ga0495636_0017724
895 Ga0495636_0028967
896 Ga0495636_0091527
897 Ga0495672_0000092
898 Ga0495681_0015813
899 Ga0495686_0002273
900 Ga0495686_0002438
901 Ga0495686_0041262
902 Ga0496100_0221714
903 Ga0496101_0222010
904 Ga0496102_0353751
905 Ga0496103_0124396
906 Ga0496104_0400530
907 Ga0496106_0139794
908 Ga0496108_0262150
909 Ga0496109_0398342
910 Ga0496110_0082094
911 Ga0496110_0107203
912 Ga0496110_0195155
913 Ga0496111_0395516
914 Ga0496114_0107509
915 Ga0496116_0002397
916 Ga0496116_0042464
917 Ga0496116_0050142
918 Ga0496117_0000299
919 Ga0496117_0001192
920 Ga0496117_0002348
921 Ga0496117_0005810
922 Ga0496118_0000213
923 Ga0496118_0000288
924 Ga0496118_0002180
925 Ga0496118_0004071
926 Ga0496118_0035283
927 Ga0496118_0074823
928 Ga0496119_0000176
929 Ga0496119_0001471
930 Ga0496120_0000277
931 Ga0496120_0000786
932 Ga0496121_0027464
933 Ga0496122_0000144
934 Ga0496122_0003749
935 Ga0496122_0011030
936 Ga0496122_0013288
937 Ga0496122_0043726
938 Ga0496122_0231996
939 Ga0496123_0000665
940 Ga0496123_0001387
941 Ga0496123_0012023
942 Ga0496123_0027927
943 Ga0496123_0038075
944 Ga0496124_0001413
945 Ga0496124_0001960
946 Ga0496124_0008273
947 Ga0496124_0010318
948 Ga0496124_0021680
949 Ga0496124_0379750
950 Ga0496125_0001174
951 Ga0496125_0005412
952 Ga0496125_0008625
953 Ga0496125_0014265
954 Ga0496125_0030656
955 Ga0496126_0003774
956 Ga0496126_0017061
957 Ga0496126_0071492
958 Ga0496126_0120417
959 Ga0496126_0149327
960 Ga0501290_000459
961 Ga0501031_0267848
962 Ga0501033_0001420
963 Ga0501034_0000798
964 Ga0501034_0069350
965 Ga0501036_0024194
966 Ga0501047_0017152
967 Ga0501067_0180806
968 Ga0501068_0065651
969 Ga0501069_0097752
970 Ga0501073_0021409
971 Ga0501198_024688
972 Ga0501223_033188
973 Ga0501239_002396
974 Ga0501080_0162705
975 Ga0501083_0073088
976 Ga0501275_000083
977 Ga0501035_0145848
978 Ga0501044_0050447
979 nmdc:mga00v17_121158_c1
980 nmdc:mga00v17_124560_c1
981 nmdc:mga00v17_50229_c1
982 nmdc:mga00v17_54872_c1
983 Ga0500565_011006
984 Ga0501084_0252938
985 Ga0501082_0140177
986 2547501552
987 2572255759
988 2578459996
989 2643906525
990 2643913967
991 2644530863
992 2747950174
993 2765577270
994 2816519911
995 2819663221
996 2842394664
997 2842760825
998 2848699909
999 2852652564
1000 2852689215
1001 2857445584
1002 2874223816
1003 2894417583
1004 2919090262
1005 2919133050
1006 2919138416
1007 2919514031
1008 2919676194
1009 2923516434
1010 2928498213
1011 2929195900
1012 2939593078
1013 2939626223
1014 2939627840
1015 2941479641
1016 2961050580
1017 2961065745
1018 2974310429
1019 2977251162
1020 2984518197
1021 2987605780
1022 8021623168
1023 8021629736
1024 8021648989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

50

242

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

56

269

0.87

PF08659

KR

KR domain

50

230

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9545 4 240
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9515 4 240
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.946 4 240
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9429 4 240
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9313 1 235
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9349 4 46 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9322 88 183 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9321 5 233 3.40.50.720
2nwqD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9314 4 234 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9313 1 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q6GD03-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9734 1 180 GO:0016491
AF-A0A4Q6GD03-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9681 1 180 GO:0016491
AF-A0A455VGI0-F1-model_v4 deleted 0.9574 4 167
AF-A0A356QBP6-F1-model_v4 Short-chain dehydrogenase 0.955 4 169 GO:0016491
AF-A0A3D4ARW2-F1-model_v4 Short-chain dehydrogenase 0.9527 1 145 GO:0016491

Map